diff --git a/README.md b/README.md
index e27f31f..19c4cfd 100644
--- a/README.md
+++ b/README.md
@@ -67,6 +67,7 @@ In action
 - Help menu
 - Offline cache
 - Supports multiple coin stat APIs
+- Auto-refresh
 - Works on macOS, Linux, and Windows
 - It's very lightweight; can be left running indefinitely
 
@@ -617,7 +618,7 @@ Frequently asked questions:
 
 - Q: I'm no longer seeing any data!
 
-  - A: Run `cointop --clean` to delete the cache and then rerun cointop. If you're still not seeing any data, then please [submit an issue](https://github.com/miguelmota/cointop/issues/new).
+  - A: Run cointop with the `--clean` flag to delete the cache. If you're still not seeing any data, then please [submit an issue](https://github.com/miguelmota/cointop/issues/new).
 
 - Q: How do I get a CoinMarketCap Pro API key?
 
@@ -876,11 +877,11 @@ Frequently asked questions:
 
 - Q: How can I delete the cache?
 
-  - A: Run `cointop -clean` to delete the cache files. Cointop will generate new cache files after fetching data.
+  - A: Run `cointop clean` to delete the cache files. Cointop will generate new cache files after fetching data.
 
 - Q: How can I reset cointop?
 
-  - A: Run `cointop -reset` to delete the config files and cache. Cointop will generate a new config when starting up.
+  - A: Run the command `cointop reset` to delete the config files and cache. Cointop will generate a new config when starting up. You can run `cointop --reset` to reset before running cointop.
 
 - Q: What is the size of the binary?
 
@@ -894,6 +895,24 @@ Frequently asked questions:
 
   - A: *rate.sx* is great for one-off queries or fetching data for bash scripts because it doesn't require installing anything. Cointop differs in that it is interactive and also supports more currencies.
 
+- Q: How can I get just the coin price with cointop?
+
+  - A: Use the `cointop price` command. Here are some examples:
+
+    ```bash
+    $ cointop price --coin ethereum
+    $277.76
+
+    $ cointop price -c ethereum --currency btc
+    Ƀ0.02814
+
+    $ cointop -c ethereum -f eur
+    €245.51
+
+    $ cointop price -c ethereum -f usd --api coinmarketcap
+    $276.37
+    ```
+
 ## Mentioned in
 
 Cointop has been mentioned in:
diff --git a/cmd/cointop.go b/cmd/cointop.go
index 8a9db92..550c26a 100644
--- a/cmd/cointop.go
+++ b/cmd/cointop.go
@@ -1,70 +1,167 @@
 package cmd
 
 import (
-	"flag"
-	"fmt"
+	"log"
+	"os"
 
 	"github.com/miguelmota/cointop/cointop"
+	"github.com/spf13/cobra"
 )
 
-// Run ...
-func Run() {
-	var v, ver, test, clean, reset, hideMarketbar, hideChart, hideStatusbar, onlyTable bool
+// Execute executes the program
+func Execute() {
+	var version, test, clean, reset, hideMarketbar, hideChart, hideStatusbar, onlyTable bool
 	var refreshRate uint
-	var config, cmcAPIKey, apiChoice, colorscheme string
-	flag.BoolVar(&v, "v", false, "Version")
-	flag.BoolVar(&ver, "version", false, "Display current version")
-	flag.BoolVar(&test, "test", false, "Run test (for Homebrew)")
-	flag.BoolVar(&clean, "clean", false, "Wipe clean the cache")
-	flag.BoolVar(&reset, "reset", false, "Reset the config. Make sure to backup any relevant changes first!")
-	flag.BoolVar(&hideMarketbar, "hide-marketbar", false, "Hide the top marketbar")
-	flag.BoolVar(&hideChart, "hide-chart", false, "Hide the chart view")
-	flag.BoolVar(&hideStatusbar, "hide-statusbar", false, "Hide the bottom statusbar")
-	flag.BoolVar(&onlyTable, "only-table", false, "Show only the table. Hides the chart and top and bottom bars")
-	flag.UintVar(&refreshRate, "refresh-rate", 60, "Refresh rate in seconds. Set to 0 to not auto-refresh")
-	flag.StringVar(&config, "config", "", "Config filepath. (default ~/.cointop/config.toml)")
-	flag.StringVar(&cmcAPIKey, "coinmarketcap-api-key", "", "Set the CoinMarketCap API key")
-	flag.StringVar(&apiChoice, "api", cointop.CoinGecko, "API choice. Available choices are \"coinmarketcap\" and \"coingecko\"")
-	flag.StringVar(&colorscheme, "colorscheme", "", "Colorscheme to use (defualt \"cointop\"). To install standard themes, do:\n\ngit clone git@github.com:cointop-sh/colors.git ~/.cointop/colors\n\nFor additional instructions, visit: https://github.com/cointop-sh/colors")
-	flag.Parse()
-
-	refreshRateFlagFound := false
-	var refreshRateP *uint
-	flag.Visit(func(f *flag.Flag) {
-		if f.Name == "refresh-rate" {
-			refreshRateFlagFound = true
-		}
-	})
+	var config, cmcAPIKey, apiChoice, colorscheme, coin, currency string
+
+	var rootCmd = &cobra.Command{
+		Use:   "cointop",
+		Short: "Cointop is an interactive terminal based app for tracking cryptocurrencies",
+		Long: `
+           _       _
+  ___ ___ (_)_ __ | |_ ___  _ __
+ / __/ _ \| | '_ \| __/ _ \| '_ \
+| (_| (_) | | | | | || (_) | |_) |
+ \___\___/|_|_| |_|\__\___/| .__/
+                           |_|
+
+Cointop is a fast and lightweight interactive terminal based UI application for tracking and monitoring cryptocurrency coin stats in real-time.
+
+For more information, visit: https://github.com/miguelmota/cointop`,
+		RunE: func(cmd *cobra.Command, args []string) error {
+			if version {
+				cointop.PrintVersion()
+				return nil
+			}
+
+			if test {
+				// TODO: deprecate test flag, only have test command
+				doTest()
+				return nil
+			}
+
+			// NOTE: if reset flag enabled, reset and run cointop
+			if reset {
+				if err := cointop.Reset(); err != nil {
+					return err
+				}
+			}
+
+			// NOTE: if clean flag enabled, clean and run cointop
+			if clean {
+				if err := cointop.Clean(); err != nil {
+					return err
+				}
+			}
 
-	if refreshRateFlagFound {
-		refreshRateP = &refreshRate
+			var refreshRateP *uint
+			if cmd.Flags().Changed("refresh-rate") {
+				refreshRateP = &refreshRate
+			}
+
+			ct, err := cointop.NewCointop(&cointop.Config{
+				ConfigFilepath:      config,
+				CoinMarketCapAPIKey: cmcAPIKey,
+				APIChoice:           apiChoice,
+				Colorscheme:         colorscheme,
+				HideMarketbar:       hideMarketbar,
+				HideChart:           hideChart,
+				HideStatusbar:       hideStatusbar,
+				OnlyTable:           onlyTable,
+				RefreshRate:         refreshRateP,
+			})
+			if err != nil {
+				return err
+			}
+
+			return ct.Run()
+		},
+	}
+
+	rootCmd.Flags().BoolVarP(&version, "version", "v", false, "Display current version")
+	rootCmd.Flags().BoolVarP(&test, "test", "", false, "Run test (for Homebrew)")
+	rootCmd.Flags().BoolVarP(&clean, "clean", "", false, "Wipe clean the cache")
+	rootCmd.Flags().BoolVarP(&reset, "reset", "", false, "Reset the config. Make sure to backup any relevant changes first!")
+	rootCmd.Flags().BoolVarP(&hideMarketbar, "hide-marketbar", "", false, "Hide the top marketbar")
+	rootCmd.Flags().BoolVarP(&hideChart, "hide-chart", "", false, "Hide the chart view")
+	rootCmd.Flags().BoolVarP(&hideStatusbar, "hide-statusbar", "", false, "Hide the bottom statusbar")
+	rootCmd.Flags().BoolVarP(&onlyTable, "only-table", "", false, "Show only the table. Hides the chart and top and bottom bars")
+	rootCmd.Flags().UintVarP(&refreshRate, "refresh-rate", "r", 60, "Refresh rate in seconds. Set to 0 to not auto-refresh")
+	rootCmd.Flags().StringVarP(&config, "config", "c", "", "Config filepath. (default ~/.cointop/config.toml)")
+	rootCmd.Flags().StringVarP(&cmcAPIKey, "coinmarketcap-api-key", "", "", "Set the CoinMarketCap API key")
+	rootCmd.Flags().StringVarP(&apiChoice, "api", "", cointop.CoinGecko, "API choice. Available choices are \"coinmarketcap\" and \"coingecko\"")
+	rootCmd.Flags().StringVarP(&colorscheme, "colorscheme", "", "", "Colorscheme to use (default \"cointop\"). To install standard themes, do:\n\ngit clone git@github.com:cointop-sh/colors.git ~/.cointop/colors\n\nFor additional instructions, visit: https://github.com/cointop-sh/colors")
+
+	var versionCmd = &cobra.Command{
+		Use:   "version",
+		Short: "Displays the current version",
+		Long:  `The version command displays the current version`,
+		Run: func(cmd *cobra.Command, args []string) {
+			cointop.PrintVersion()
+		},
 	}
 
-	if v || ver {
-		fmt.Printf("cointop v%s", cointop.Version())
-	} else if test {
-		doTest()
-	} else if clean {
-		cointop.Clean()
-	} else if reset {
-		cointop.Reset()
-	} else {
-		cointop.NewCointop(&cointop.Config{
-			ConfigFilepath:      config,
-			CoinMarketCapAPIKey: cmcAPIKey,
-			APIChoice:           apiChoice,
-			Colorscheme:         colorscheme,
-			HideMarketbar:       hideMarketbar,
-			HideChart:           hideChart,
-			HideStatusbar:       hideStatusbar,
-			OnlyTable:           onlyTable,
-			RefreshRate:         refreshRateP,
-		}).Run()
+	var cleanCmd = &cobra.Command{
+		Use:   "clean",
+		Short: "Clear the cache",
+		Long:  `The clean command clears the cache`,
+		RunE: func(cmd *cobra.Command, args []string) error {
+			// NOTE: if clean command, clean but don't run cointop
+			return cointop.Clean()
+		},
+	}
+
+	var resetCmd = &cobra.Command{
+		Use:   "reset",
+		Short: "Resets the config and clear the cache",
+		Long:  `The reset command resets the config and clears the cache`,
+		RunE: func(cmd *cobra.Command, args []string) error {
+			// NOTE: if reset command, reset but don't run cointop
+			return cointop.Reset()
+		},
+	}
+
+	var priceCmd = &cobra.Command{
+		Use:   "price",
+		Short: "Displays the current price of a coin",
+		Long:  `The price command display the current price of a coin`,
+		RunE: func(cmd *cobra.Command, args []string) error {
+			return cointop.PrintPrice(&cointop.PriceConfig{
+				Coin:      coin,
+				Currency:  currency,
+				APIChoice: apiChoice,
+			})
+		},
+	}
+
+	var testCmd = &cobra.Command{
+		Use:   "test",
+		Short: "Runs tests",
+		Long:  `The test command runs tests for Homebrew`,
+		Run: func(cmd *cobra.Command, args []string) {
+			doTest()
+		},
+	}
+
+	priceCmd.Flags().StringVarP(&coin, "coin", "c", "bitcoin", "Full name of the coin (default \"bitcoin\")")
+	priceCmd.Flags().StringVarP(&currency, "currency", "f", "USD", "The currency to convert to (default \"USD\")")
+	priceCmd.Flags().StringVarP(&apiChoice, "api", "a", cointop.CoinGecko, "API choice. Available choices are \"coinmarketcap\" and \"coingecko\"")
+
+	rootCmd.AddCommand(versionCmd, cleanCmd, resetCmd, priceCmd, testCmd)
+
+	if err := rootCmd.Execute(); err != nil {
+		log.Fatal(err)
+		os.Exit(1)
 	}
 }
 
 func doTest() {
-	cointop.NewCointop(&cointop.Config{
+	ct, err := cointop.NewCointop(&cointop.Config{
 		NoPrompts: true,
-	}).Exit()
+	})
+	if err != nil {
+		log.Fatal(err)
+	}
+
+	ct.Exit()
 }
diff --git a/cointop/cointop.go b/cointop/cointop.go
index 8530247..204d607 100644
--- a/cointop/cointop.go
+++ b/cointop/cointop.go
@@ -14,9 +14,9 @@ import (
 	"github.com/miguelmota/cointop/cointop/common/api/types"
 	"github.com/miguelmota/cointop/cointop/common/filecache"
 	"github.com/miguelmota/cointop/cointop/common/gizak/termui"
+	"github.com/miguelmota/cointop/cointop/common/humanize"
 	"github.com/miguelmota/cointop/cointop/common/table"
 	"github.com/patrickmn/go-cache"
-	log "github.com/sirupsen/logrus"
 )
 
 // TODO: clean up and optimize codebase
@@ -139,7 +139,7 @@ var defaultConfigPath = "~/.cointop/config.toml"
 var defaultColorscheme = "cointop"
 
 // NewCointop initializes cointop
-func NewCointop(config *Config) *Cointop {
+func NewCointop(config *Config) (*Cointop, error) {
 	var debug bool
 	if os.Getenv("DEBUG") != "" {
 		debug = true
@@ -202,7 +202,7 @@ func NewCointop(config *Config) *Cointop {
 
 	err := ct.setupConfig()
 	if err != nil {
-		log.Fatal(err)
+		return nil, err
 	}
 
 	ct.cache.Set("onlyTable", ct.State.onlyTable, cache.NoExpiration)
@@ -225,7 +225,7 @@ func NewCointop(config *Config) *Cointop {
 	if config.CoinMarketCapAPIKey != "" {
 		ct.apiKeys.cmc = config.CoinMarketCapAPIKey
 		if err := ct.saveConfig(); err != nil {
-			log.Fatal(err)
+			return nil, err
 		}
 	}
 
@@ -235,14 +235,14 @@ func NewCointop(config *Config) *Cointop {
 
 	colors, err := ct.getColorschemeColors()
 	if err != nil {
-		log.Fatal(err)
+		return nil, err
 	}
 	ct.colorscheme = NewColorscheme(colors)
 
 	if config.APIChoice != "" {
 		ct.apiChoice = config.APIChoice
 		if err := ct.saveConfig(); err != nil {
-			log.Fatal(err)
+			return nil, err
 		}
 	}
 
@@ -256,7 +256,7 @@ func NewCointop(config *Config) *Cointop {
 			ct.apiKeys.cmc = apiKey
 		}
 		if err := ct.saveConfig(); err != nil {
-			log.Fatal(err)
+			return nil, err
 		}
 	}
 
@@ -269,7 +269,7 @@ func NewCointop(config *Config) *Cointop {
 	} else if ct.apiChoice == CoinGecko {
 		ct.api = api.NewCG()
 	} else {
-		log.Fatal(ErrInvalidAPIChoice)
+		return nil, ErrInvalidAPIChoice
 	}
 
 	coinscachekey := ct.cacheKey("allCoinsSlugMap")
@@ -312,17 +312,17 @@ func NewCointop(config *Config) *Cointop {
 	// TODO: notify offline status in status bar
 	/*
 		if err := ct.api.Ping(); err != nil {
-			log.Fatal(err)
+			return nil, err
 		}
 	*/
-	return ct
+	return ct, nil
 }
 
 // Run runs cointop
-func (ct *Cointop) Run() {
+func (ct *Cointop) Run() error {
 	g, err := gocui.NewGui(gocui.Output256)
 	if err != nil {
-		log.Fatalf("new gocui: %v", err)
+		return fmt.Errorf("new gocui: %v", err)
 	}
 
 	g.FgColor = ct.colorscheme.BaseFg()
@@ -335,20 +335,51 @@ func (ct *Cointop) Run() {
 	g.Highlight = true
 	g.SetManagerFunc(ct.layout)
 	if err := ct.keybindings(g); err != nil {
-		log.Fatalf("keybindings: %v", err)
+		return fmt.Errorf("keybindings: %v", err)
 	}
 	if err := g.MainLoop(); err != nil && err != gocui.ErrQuit {
-		log.Fatalf("main loop: %v", err)
+		return fmt.Errorf("main loop: %v", err)
 	}
+
+	return nil
+}
+
+// PriceConfig is the config options for the price command
+type PriceConfig struct {
+	Coin      string
+	Currency  string
+	APIChoice string
+}
+
+// PrintPrice outputs the current price of the coin
+func PrintPrice(config *PriceConfig) error {
+	var priceAPI api.Interface
+	if config.APIChoice == CoinMarketCap {
+		priceAPI = api.NewCMC("")
+	} else if config.APIChoice == CoinGecko {
+		priceAPI = api.NewCG()
+	} else {
+		return ErrInvalidAPIChoice
+	}
+
+	price, err := priceAPI.Price(config.Coin, config.Currency)
+	if err != nil {
+		return err
+	}
+
+	symbol := currencySymbol(config.Currency)
+	fmt.Fprintf(os.Stdout, "%s%s", symbol, humanize.Commaf(price))
+
+	return nil
 }
 
 // Clean ...
-func Clean() {
+func Clean() error {
 	tmpPath := "/tmp"
 	if _, err := os.Stat(tmpPath); !os.IsNotExist(err) {
 		files, err := ioutil.ReadDir(tmpPath)
 		if err != nil {
-			log.Fatal(err)
+			return err
 		}
 
 		for _, f := range files {
@@ -356,27 +387,31 @@ func Clean() {
 				file := fmt.Sprintf("%s/%s", tmpPath, f.Name())
 				fmt.Printf("removing %s\n", file)
 				if err := os.Remove(file); err != nil {
-					log.Fatal(err)
+					return err
 				}
 			}
 		}
 	}
 
 	fmt.Println("cointop cache has been cleaned")
+	return nil
 }
 
 // Reset ...
-func Reset() {
-	Clean()
+func Reset() error {
+	if err := Clean(); err != nil {
+		return err
+	}
 
 	// default config path
 	configPath := fmt.Sprintf("%s%s", UserHomeDir(), "/.cointop")
 	if _, err := os.Stat(configPath); !os.IsNotExist(err) {
 		fmt.Printf("removing %s\n", configPath)
 		if err := os.RemoveAll(configPath); err != nil {
-			log.Fatal(err)
+			return err
 		}
 	}
 
 	fmt.Println("cointop has been reset")
+	return nil
 }
diff --git a/cointop/common/api/impl/coingecko/coingecko.go b/cointop/common/api/impl/coingecko/coingecko.go
index 3e6000f..2b35069 100644
--- a/cointop/common/api/impl/coingecko/coingecko.go
+++ b/cointop/common/api/impl/coingecko/coingecko.go
@@ -16,6 +16,9 @@ import (
 // ErrPingFailed is the error for when pinging the API fails
 var ErrPingFailed = errors.New("Failed to ping")
 
+// ErrNotFound is the error when the target is not found
+var ErrNotFound = errors.New("Not found")
+
 // Service service
 type Service struct {
 	client *gecko.Client
@@ -233,6 +236,25 @@ func (s *Service) GetGlobalMarketData(convert string) (apitypes.GlobalMarketData
 	return ret, nil
 }
 
+// Price returns the current price of the coin
+func (s *Service) Price(name string, convert string) (float64, error) {
+	ids := []string{name}
+	convert = strings.ToLower(convert)
+	currencies := []string{convert}
+	list, err := s.client.SimplePrice(ids, currencies)
+	if err != nil {
+		return 0, err
+	}
+
+	for _, item := range *list {
+		if p, ok := item[convert]; ok {
+			return util.FormatPrice(float64(p), convert), nil
+		}
+	}
+
+	return 0, ErrNotFound
+}
+
 // CoinLink returns the URL link for the coin
 func (s *Service) CoinLink(name string) string {
 	slug := util.NameToSlug(name)
diff --git a/cointop/common/api/impl/coinmarketcap/coinmarketcap.go b/cointop/common/api/impl/coinmarketcap/coinmarketcap.go
index 520b6cd..66ae2d1 100644
--- a/cointop/common/api/impl/coinmarketcap/coinmarketcap.go
+++ b/cointop/common/api/impl/coinmarketcap/coinmarketcap.go
@@ -4,6 +4,7 @@ import (
 	"errors"
 	"fmt"
 	"os"
+	"strings"
 	"time"
 
 	apitypes "github.com/miguelmota/cointop/cointop/common/api/types"
@@ -164,6 +165,25 @@ func (s *Service) GetGlobalMarketData(convert string) (apitypes.GlobalMarketData
 	return ret, nil
 }
 
+// Price returns the current price of the coin
+func (s *Service) Price(name string, convert string) (float64, error) {
+	convert = strings.ToUpper(convert)
+	symbol, err := cmcv2.CoinSymbol(name)
+	if err != nil {
+		return 0, err
+	}
+
+	price, err := cmcv2.Price(&cmcv2.PriceOptions{
+		Symbol:  symbol,
+		Convert: convert,
+	})
+	if err != nil {
+		return 0, err
+	}
+
+	return util.FormatPrice(price, convert), nil
+}
+
 // CoinLink returns the URL link for the coin
 func (s *Service) CoinLink(name string) string {
 	slug := util.NameToSlug(name)
diff --git a/cointop/common/api/interface.go b/cointop/common/api/interface.go
index c993b14..edb6bcb 100644
--- a/cointop/common/api/interface.go
+++ b/cointop/common/api/interface.go
@@ -17,4 +17,5 @@ type Interface interface {
 	//GetCoinMarkets(coin string) ([]types.Market, error)
 	CoinLink(name string) string
 	SupportedCurrencies() []string
+	Price(name string, convert string) (float64, error)
 }
diff --git a/cointop/conversion.go b/cointop/conversion.go
index 9c8b832..9179689 100644
--- a/cointop/conversion.go
+++ b/cointop/conversion.go
@@ -3,6 +3,7 @@ package cointop
 import (
 	"fmt"
 	"sort"
+	"strings"
 
 	color "github.com/miguelmota/cointop/cointop/common/color"
 	"github.com/miguelmota/cointop/cointop/common/pad"
@@ -48,7 +49,7 @@ var cryptocurrencyNames = map[string]string{
 	"ETH": "Ethereum",
 }
 
-var currencySymbol = map[string]string{
+var currencySymbolMap = map[string]string{
 	"AUD": "$",
 	"BRL": "R$",
 	"BTC": "Ƀ",
@@ -192,8 +193,19 @@ func (ct *Cointop) setCurrencyConverstion(convert string) func() error {
 	}
 }
 
+// currencySymbol returns the symbol for the currency
+func currencySymbol(currency string) string {
+	symbol, ok := currencySymbolMap[strings.ToUpper(currency)]
+	if ok {
+		return symbol
+	}
+
+	return "$"
+}
+
+// currencySymbol returns the symbol for the currency
 func (ct *Cointop) currencySymbol() string {
-	symbol, ok := currencySymbol[ct.State.currencyConversion]
+	symbol, ok := currencySymbolMap[strings.ToUpper(ct.State.currencyConversion)]
 	if ok {
 		return symbol
 	}
diff --git a/cointop/version.go b/cointop/version.go
index a7d9105..7a9e853 100644
--- a/cointop/version.go
+++ b/cointop/version.go
@@ -1,5 +1,10 @@
 package cointop
 
+import (
+	"fmt"
+	"os"
+)
+
 // TODO: make dynamic based on git tag
 const version = "1.3.2"
 
@@ -12,3 +17,8 @@ func (ct *Cointop) Version() string {
 func Version() string {
 	return version
 }
+
+// PrintVersion prints the version
+func PrintVersion() {
+	fmt.Fprint(os.Stdout, Version())
+}
diff --git a/go.mod b/go.mod
index 34f0e49..8de32e3 100644
--- a/go.mod
+++ b/go.mod
@@ -4,7 +4,7 @@ require (
 	github.com/BurntSushi/toml v0.3.1
 	github.com/anaskhan96/soup v1.1.1 // indirect
 	github.com/fatih/color v1.7.0
-	github.com/gizak/termui v2.3.0+incompatible
+	github.com/gizak/termui v2.3.0+incompatible // indirect
 	github.com/google/pprof v0.0.0-20190502144155-8358a9778bd1 // indirect
 	github.com/jroimartin/gocui v0.4.0
 	github.com/maruel/panicparse v1.1.2-0.20180806203336-f20d4c4d746f
@@ -12,15 +12,17 @@ require (
 	github.com/mattn/go-isatty v0.0.6 // indirect
 	github.com/mattn/go-runewidth v0.0.4
 	github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b // indirect
-	github.com/miguelmota/go-coinmarketcap v0.1.4
+	github.com/miguelmota/go-coinmarketcap v0.1.5
 	github.com/mitchellh/go-wordwrap v1.0.0
 	github.com/nsf/termbox v1.1.2 // indirect
 	github.com/nsf/termbox-go v0.0.0-20190121233118-02980233997d
 	github.com/patrickmn/go-cache v2.1.0+incompatible
 	github.com/sirupsen/logrus v1.4.1
+	github.com/spf13/cobra v0.0.5
 	github.com/tomnomnom/xtermcolor v0.0.0-20160428124646-b78803f00a7e
-	golang.org/x/crypto v0.0.0-20190411191339-88737f569e3a // indirect
-	golang.org/x/net v0.0.0-20190415214537-1da14a5a36f2 // indirect
-	golang.org/x/sys v0.0.0-20190416152802-12500544f89f // indirect
-	golang.org/x/text v0.3.0
+	golang.org/x/crypto v0.0.0-20190701094942-4def268fd1a4 // indirect
+	golang.org/x/net v0.0.0-20190628185345-da137c7871d7 // indirect
+	golang.org/x/sys v0.0.0-20190626221950-04f50cda93cb // indirect
+	golang.org/x/text v0.3.2
+	golang.org/x/tools v0.0.0-20190701194522-38ae2c8f6412 // indirect
 )
diff --git a/go.sum b/go.sum
index 18fe698..9c7b362 100644
--- a/go.sum
+++ b/go.sum
@@ -3,21 +3,31 @@ github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03
 github.com/anaskhan96/soup v1.0.1/go.mod h1:pT5vs4HXDwA5y4KQCsKvnkpQd3D+joP7IqpiGskfWW0=
 github.com/anaskhan96/soup v1.1.1 h1:Duux/0htS2Va7XLJ9qIakCSey790hg9OFRm2FwlMTy0=
 github.com/anaskhan96/soup v1.1.1/go.mod h1:pT5vs4HXDwA5y4KQCsKvnkpQd3D+joP7IqpiGskfWW0=
+github.com/armon/consul-api v0.0.0-20180202201655-eb2c6b5be1b6/go.mod h1:grANhF5doyWs3UAsr3K4I6qtAmlQcZDesFNEHPZAzj8=
 github.com/aybabtme/rgbterm v0.0.0-20170906152045-cc83f3b3ce59 h1:WWB576BN5zNSZc/M9d/10pqEx5VHNhaQ/yOVAkmj5Yo=
 github.com/aybabtme/rgbterm v0.0.0-20170906152045-cc83f3b3ce59/go.mod h1:q/89r3U2H7sSsE2t6Kca0lfwTK8JdoNGS/yzM/4iH5I=
+github.com/coreos/etcd v3.3.10+incompatible/go.mod h1:uF7uidLiAD3TWHmW31ZFd/JWoc32PjwdhPthX9715RE=
+github.com/coreos/go-etcd v2.0.0+incompatible/go.mod h1:Jez6KQU2B/sWsbdaef3ED8NzMklzPG4d5KIOhIy30Tk=
+github.com/coreos/go-semver v0.2.0/go.mod h1:nnelYz7RCh+5ahJtPPxZlU+153eP4D4r3EedlOD2RNk=
+github.com/cpuguy83/go-md2man v1.0.10/go.mod h1:SmD6nW6nTyfqj6ABTjUi3V3JVMnlJmwcJI5acqYI6dE=
 github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
 github.com/fatih/color v1.7.0 h1:DkWD4oS2D8LGGgTQ6IvwJJXSL5Vp2ffcQg58nFV38Ys=
 github.com/fatih/color v1.7.0/go.mod h1:Zm6kSWBoL9eyXnKyktHP6abPY2pDugNf5KwzbycvMj4=
+github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMoQvtojpjFo=
 github.com/gizak/termui v2.3.0+incompatible h1:S8wJoNumYfc/rR5UezUM4HsPEo3RJh0LKdiuDWQpjqw=
 github.com/gizak/termui v2.3.0+incompatible/go.mod h1:PkJoWUt/zacQKysNfQtcw1RW+eK2SxkieVBtl+4ovLA=
 github.com/google/pprof v0.0.0-20190404155422-f8f10df84213/go.mod h1:zfwlbNMJ+OItoe0UupaVj+oy1omPYYDuagoSzA8v9mc=
 github.com/google/pprof v0.0.0-20190502144155-8358a9778bd1/go.mod h1:zfwlbNMJ+OItoe0UupaVj+oy1omPYYDuagoSzA8v9mc=
 github.com/h2non/parth v0.0.0-20190131123155-b4df798d6542/go.mod h1:Ow0tF8D4Kplbc8s8sSb3V2oUCygFHVp8gC3Dn6U4MNI=
+github.com/hashicorp/hcl v1.0.0/go.mod h1:E5yfLk+7swimpb2L/Alb/PJmXilQ/rhwaUYs4T20WEQ=
+github.com/inconshreveable/mousetrap v1.0.0 h1:Z8tu5sraLXCXIcARxBp/8cbvlwVa7Z1NHg9XEKhtSvM=
+github.com/inconshreveable/mousetrap v1.0.0/go.mod h1:PxqpIevigyE2G7u3NXJIT2ANytuPF1OarO4DADm73n8=
 github.com/jroimartin/gocui v0.4.0 h1:52jnalstgmc25FmtGcWqa0tcbMEWS6RpFLsOIO+I+E8=
 github.com/jroimartin/gocui v0.4.0/go.mod h1:7i7bbj99OgFHzo7kB2zPb8pXLqMBSQegY7azfqXMkyY=
 github.com/konsorten/go-windows-terminal-sequences v1.0.1 h1:mweAR1A6xJ3oS2pRaGiHgQ4OO8tzTaLawm8vnODuwDk=
 github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
+github.com/magiconair/properties v1.8.0/go.mod h1:PppfXfuXeibc/6YijjN8zIbojt8czPbwD3XqdrwzmxQ=
 github.com/maruel/panicparse v1.1.1 h1:k62YPcEoLncEEpjMt92GtG5ugb8WL/510Ys3/h5IkRc=
 github.com/maruel/panicparse v1.1.1/go.mod h1:nty42YY5QByNC5MM7q/nj938VbgPU7avs45z6NClpxI=
 github.com/maruel/panicparse v1.1.2-0.20180806203336-f20d4c4d746f h1:mtX2D0ta3lWxCvv276VVIH6mMYzm4jhSfYP70ZJSOQU=
@@ -31,16 +41,14 @@ github.com/mattn/go-runewidth v0.0.4 h1:2BvfKmzob6Bmd4YsL0zygOqfdFnK7GR4QL06Do4/
 github.com/mattn/go-runewidth v0.0.4/go.mod h1:LwmH8dsx7+W8Uxz3IHJYH5QSwggIsqBzpuz5H//U1FU=
 github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b h1:j7+1HpAFS1zy5+Q4qx1fWh90gTKwiN4QCGoY9TWyyO4=
 github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b/go.mod h1:01TrycV0kFyexm33Z7vhZRXopbI8J3TDReVlkTgMUxE=
-github.com/miguelmota/go-coinmarketcap v0.1.1 h1:4meaHf411shSIUZDqzaVNU+sgjTa7O9F8KjJqhsP1AI=
-github.com/miguelmota/go-coinmarketcap v0.1.1/go.mod h1:Jdv/kqtKclIElmoNAZMMJn0DSQv+j7p/H1te/GGnxhA=
-github.com/miguelmota/go-coinmarketcap v0.1.2 h1:XGhLhzruXD14sVS3kuXAtAinvwJK3m1apRase/vfr88=
-github.com/miguelmota/go-coinmarketcap v0.1.2/go.mod h1:Jdv/kqtKclIElmoNAZMMJn0DSQv+j7p/H1te/GGnxhA=
-github.com/miguelmota/go-coinmarketcap v0.1.3 h1:6/TvCnvq6tNVa8NG33X5uiIfIHI55mRmmArnUQ7Hdeg=
-github.com/miguelmota/go-coinmarketcap v0.1.3/go.mod h1:Jdv/kqtKclIElmoNAZMMJn0DSQv+j7p/H1te/GGnxhA=
 github.com/miguelmota/go-coinmarketcap v0.1.4 h1:x3AXc/b8MbFtfAEI5hQphtcbwTm4OAXJPjVOHf1ETt0=
 github.com/miguelmota/go-coinmarketcap v0.1.4/go.mod h1:Jdv/kqtKclIElmoNAZMMJn0DSQv+j7p/H1te/GGnxhA=
+github.com/miguelmota/go-coinmarketcap v0.1.5 h1:NwAqQG+ClGNsYlReM06ERK8CqEkW1tF8BQsTLNp6TyU=
+github.com/miguelmota/go-coinmarketcap v0.1.5/go.mod h1:Jdv/kqtKclIElmoNAZMMJn0DSQv+j7p/H1te/GGnxhA=
+github.com/mitchellh/go-homedir v1.1.0/go.mod h1:SfyaCUpYCn1Vlf4IUYiD9fPX4A5wJrkLzIz1N1q0pr0=
 github.com/mitchellh/go-wordwrap v1.0.0 h1:6GlHJ/LTGMrIJbwgdqdl2eEH8o+Exx/0m8ir9Gns0u4=
 github.com/mitchellh/go-wordwrap v1.0.0/go.mod h1:ZXFpozHsX6DPmq2I0TCekCxypsnAUbP2oI0UX1GXzOo=
+github.com/mitchellh/mapstructure v1.1.2/go.mod h1:FVVH3fgwuzCH5S8UJGiWEs2h04kUh9fWfEaFds41c1Y=
 github.com/nbio/st v0.0.0-20140626010706-e9e8d9816f32/go.mod h1:9wM+0iRr9ahx58uYLpLIr5fm8diHn0JbqRycJi6w0Ms=
 github.com/nsf/termbox v1.1.2 h1:w1jYRf7nu3ZBICMbHKsyihdYyydAAhBEKcTfVxJQsxE=
 github.com/nsf/termbox v1.1.2/go.mod h1:vzR0wsVVTMx636zhtIZ1b1VbIMxrLeI3tSRN13kMIPI=
@@ -48,32 +56,61 @@ github.com/nsf/termbox-go v0.0.0-20190121233118-02980233997d h1:x3S6kxmy49zXVVyh
 github.com/nsf/termbox-go v0.0.0-20190121233118-02980233997d/go.mod h1:IuKpRQcYE1Tfu+oAQqaLisqDeXgjyyltCfsaoYN18NQ=
 github.com/patrickmn/go-cache v2.1.0+incompatible h1:HRMgzkcYKYpi3C8ajMPV8OFXaaRUnok+kx1WdO15EQc=
 github.com/patrickmn/go-cache v2.1.0+incompatible/go.mod h1:3Qf8kWWT7OJRJbdiICTKqZju1ZixQ/KpMGzzAfe6+WQ=
+github.com/pelletier/go-toml v1.2.0/go.mod h1:5z9KED0ma1S8pY6P1sdut58dfprrGBbd/94hg7ilaic=
 github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
+github.com/russross/blackfriday v1.5.2/go.mod h1:JO/DiYxRf+HjHt06OyowR9PTA263kcR/rfWxYHBV53g=
 github.com/sirupsen/logrus v1.4.1 h1:GL2rEmy6nsikmW0r8opw9JIRScdMF5hA8cOYLH7In1k=
 github.com/sirupsen/logrus v1.4.1/go.mod h1:ni0Sbl8bgC9z8RoU9G6nDWqqs/fq4eDPysMBDgk/93Q=
+github.com/spf13/afero v1.1.2/go.mod h1:j4pytiNVoe2o6bmDsKpLACNPDBIoEAkihy7loJ1B0CQ=
+github.com/spf13/cast v1.3.0/go.mod h1:Qx5cxh0v+4UWYiBimWS+eyWzqEqokIECu5etghLkUJE=
+github.com/spf13/cobra v0.0.5 h1:f0B+LkLX6DtmRH1isoNA9VTtNUK9K8xYd28JNNfOv/s=
+github.com/spf13/cobra v0.0.5/go.mod h1:3K3wKZymM7VvHMDS9+Akkh4K60UwM26emMESw8tLCHU=
+github.com/spf13/jwalterweatherman v1.0.0/go.mod h1:cQK4TGJAtQXfYWX+Ddv3mKDzgVb68N+wFjFa4jdeBTo=
+github.com/spf13/pflag v1.0.3 h1:zPAT6CGy6wXeQ7NtTnaTerfKOsV6V6F8agHXFiazDkg=
+github.com/spf13/pflag v1.0.3/go.mod h1:DYY7MBk1bdzusC3SYhjObp+wFpr4gzcvqqNjLnInEg4=
+github.com/spf13/viper v1.3.2/go.mod h1:ZiWeW+zYFKm7srdB9IoDzzZXaJaI5eL9QjNiN/DMA2s=
 github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
 github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
 github.com/tomnomnom/xtermcolor v0.0.0-20160428124646-b78803f00a7e h1:Ee+VZw13r9NTOMnwTPs6O5KZ0MJU54hsxu9FpZ4pQ10=
 github.com/tomnomnom/xtermcolor v0.0.0-20160428124646-b78803f00a7e/go.mod h1:fSIW/szJHsRts/4U8wlMPhs+YqJC+7NYR+Qqb1uJVpA=
+github.com/ugorji/go/codec v0.0.0-20181204163529-d75b2dcb6bc8/go.mod h1:VFNgLljTbGfSG7qAOspJ7OScBnGdDN/yBr0sguwnwf0=
+github.com/xordataexchange/crypt v0.0.3-0.20170626215501-b2862e3d0a77/go.mod h1:aYKd//L2LvnjZzWKhF00oedf4jCCReLcmhLdhm1A27Q=
 golang.org/x/arch v0.0.0-20190312162104-788fe5ffcd8c/go.mod h1:flIaEI6LNU6xOCD5PaJvn9wGP0agmIOqjrtsKGRguv4=
+golang.org/x/crypto v0.0.0-20181203042331-505ab145d0a9/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4=
 golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
 golang.org/x/crypto v0.0.0-20190411191339-88737f569e3a/go.mod h1:WFFai1msRO1wXaEeE5yQxYXgSfI8pQAWXbQop6sCtWE=
+golang.org/x/crypto v0.0.0-20190701094942-4def268fd1a4/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
 golang.org/x/net v0.0.0-20180215212450-dc948dff8834/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
 golang.org/x/net v0.0.0-20181220203305-927f97764cc3 h1:eH6Eip3UpmR+yM/qI9Ijluzb1bNv/cAU/n+6l8tRSis=
 golang.org/x/net v0.0.0-20181220203305-927f97764cc3/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
+golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
 golang.org/x/net v0.0.0-20190415214537-1da14a5a36f2 h1:iC0Y6EDq+rhnAePxGvJs2kzUAYcwESqdcGRPzEUfzTU=
 golang.org/x/net v0.0.0-20190415214537-1da14a5a36f2/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
+golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
+golang.org/x/net v0.0.0-20190628185345-da137c7871d7 h1:rTIdg5QFRR7XCaK4LCjBiPbx8j4DQRpdYMnGn/bJUEU=
+golang.org/x/net v0.0.0-20190628185345-da137c7871d7/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
+golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
+golang.org/x/sys v0.0.0-20181205085412-a5c9d58dba9a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20181221143128-b4a75ba826a6/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20190222072716-a9d3bda3a223 h1:DH4skfRX4EBpamg7iV4ZlCpblAHI6s6TDM39bFZumv8=
 golang.org/x/sys v0.0.0-20190222072716-a9d3bda3a223/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20190403152447-81d4e9dc473e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
+golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20190416152802-12500544f89f h1:1ZH9RnjNgLzh6YrsRp/c6ddZ8Lq0fq9xztNOoWJ2sz4=
 golang.org/x/sys v0.0.0-20190416152802-12500544f89f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
+golang.org/x/sys v0.0.0-20190626221950-04f50cda93cb h1:fgwFCsaw9buMuxNd6+DQfAuSFqbNiQZpcgJQAgJsK6k=
+golang.org/x/sys v0.0.0-20190626221950-04f50cda93cb/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/text v0.3.0 h1:g61tztE5qeGQ89tm6NTjjM9VPIm088od1l6aSorWRWg=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
+golang.org/x/text v0.3.2 h1:tW2bmiBqwgJj/UpqtC8EpXEZVYOwU0yG4iWbprSVAcs=
+golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk=
+golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
+golang.org/x/tools v0.0.0-20190701194522-38ae2c8f6412/go.mod h1:jcCCGcm9btYwXyDqrUWc6MKQKKGJCWEQ3AfLSRIbEuI=
+gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/go-playground/colors.v1 v1.2.0 h1:SPweMUve+ywPrfwao+UvfD5Ah78aOLUkT5RlJiZn52c=
 gopkg.in/go-playground/colors.v1 v1.2.0/go.mod h1:AvbqcMpNXVl5gBrM20jBm3VjjKBbH/kI5UnqjU7lxFI=
 gopkg.in/h2non/gock.v1 v1.0.14/go.mod h1:sX4zAkdYX1TRGJ2JY156cFspQn4yRWn6p9EMdODlynE=
+gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
 rsc.io/pdf v0.1.1/go.mod h1:n8OzWcQ6Sp37PL01nO98y4iUCRdTGarVfzxY20ICaU4=
diff --git a/main.go b/main.go
index a7da060..806466f 100644
--- a/main.go
+++ b/main.go
@@ -5,5 +5,5 @@ import (
 )
 
 func main() {
-	cmd.Run()
+	cmd.Execute()
 }
diff --git a/vendor/github.com/inconshreveable/mousetrap/LICENSE b/vendor/github.com/inconshreveable/mousetrap/LICENSE
new file mode 100644
index 0000000..5f0d1fb
--- /dev/null
+++ b/vendor/github.com/inconshreveable/mousetrap/LICENSE
@@ -0,0 +1,13 @@
+Copyright 2014 Alan Shreve
+
+Licensed under the Apache License, Version 2.0 (the "License");
+you may not use this file except in compliance with the License.
+You may obtain a copy of the License at
+
+   http://www.apache.org/licenses/LICENSE-2.0
+
+Unless required by applicable law or agreed to in writing, software
+distributed under the License is distributed on an "AS IS" BASIS,
+WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+See the License for the specific language governing permissions and
+limitations under the License.
diff --git a/vendor/github.com/inconshreveable/mousetrap/README.md b/vendor/github.com/inconshreveable/mousetrap/README.md
new file mode 100644
index 0000000..7a950d1
--- /dev/null
+++ b/vendor/github.com/inconshreveable/mousetrap/README.md
@@ -0,0 +1,23 @@
+# mousetrap
+
+mousetrap is a tiny library that answers a single question.
+
+On a Windows machine, was the process invoked by someone double clicking on
+the executable file while browsing in explorer?
+
+### Motivation
+
+Windows developers unfamiliar with command line tools will often "double-click"
+the executable for a tool. Because most CLI tools print the help and then exit
+when invoked without arguments, this is often very frustrating for those users.
+
+mousetrap provides a way to detect these invocations so that you can provide
+more helpful behavior and instructions on how to run the CLI tool. To see what
+this looks like, both from an organizational and a technical perspective, see
+https://inconshreveable.com/09-09-2014/sweat-the-small-stuff/
+
+### The interface
+
+The library exposes a single interface:
+
+    func StartedByExplorer() (bool)
diff --git a/vendor/github.com/inconshreveable/mousetrap/trap_others.go b/vendor/github.com/inconshreveable/mousetrap/trap_others.go
new file mode 100644
index 0000000..9d2d8a4
--- /dev/null
+++ b/vendor/github.com/inconshreveable/mousetrap/trap_others.go
@@ -0,0 +1,15 @@
+// +build !windows
+
+package mousetrap
+
+// StartedByExplorer returns true if the program was invoked by the user
+// double-clicking on the executable from explorer.exe
+//
+// It is conservative and returns false if any of the internal calls fail.
+// It does not guarantee that the program was run from a terminal. It only can tell you
+// whether it was launched from explorer.exe
+//
+// On non-Windows platforms, it always returns false.
+func StartedByExplorer() bool {
+	return false
+}
diff --git a/vendor/github.com/inconshreveable/mousetrap/trap_windows.go b/vendor/github.com/inconshreveable/mousetrap/trap_windows.go
new file mode 100644
index 0000000..336142a
--- /dev/null
+++ b/vendor/github.com/inconshreveable/mousetrap/trap_windows.go
@@ -0,0 +1,98 @@
+// +build windows
+// +build !go1.4
+
+package mousetrap
+
+import (
+	"fmt"
+	"os"
+	"syscall"
+	"unsafe"
+)
+
+const (
+	// defined by the Win32 API
+	th32cs_snapprocess uintptr = 0x2
+)
+
+var (
+	kernel                   = syscall.MustLoadDLL("kernel32.dll")
+	CreateToolhelp32Snapshot = kernel.MustFindProc("CreateToolhelp32Snapshot")
+	Process32First           = kernel.MustFindProc("Process32FirstW")
+	Process32Next            = kernel.MustFindProc("Process32NextW")
+)
+
+// ProcessEntry32 structure defined by the Win32 API
+type processEntry32 struct {
+	dwSize              uint32
+	cntUsage            uint32
+	th32ProcessID       uint32
+	th32DefaultHeapID   int
+	th32ModuleID        uint32
+	cntThreads          uint32
+	th32ParentProcessID uint32
+	pcPriClassBase      int32
+	dwFlags             uint32
+	szExeFile           [syscall.MAX_PATH]uint16
+}
+
+func getProcessEntry(pid int) (pe *processEntry32, err error) {
+	snapshot, _, e1 := CreateToolhelp32Snapshot.Call(th32cs_snapprocess, uintptr(0))
+	if snapshot == uintptr(syscall.InvalidHandle) {
+		err = fmt.Errorf("CreateToolhelp32Snapshot: %v", e1)
+		return
+	}
+	defer syscall.CloseHandle(syscall.Handle(snapshot))
+
+	var processEntry processEntry32
+	processEntry.dwSize = uint32(unsafe.Sizeof(processEntry))
+	ok, _, e1 := Process32First.Call(snapshot, uintptr(unsafe.Pointer(&processEntry)))
+	if ok == 0 {
+		err = fmt.Errorf("Process32First: %v", e1)
+		return
+	}
+
+	for {
+		if processEntry.th32ProcessID == uint32(pid) {
+			pe = &processEntry
+			return
+		}
+
+		ok, _, e1 = Process32Next.Call(snapshot, uintptr(unsafe.Pointer(&processEntry)))
+		if ok == 0 {
+			err = fmt.Errorf("Process32Next: %v", e1)
+			return
+		}
+	}
+}
+
+func getppid() (pid int, err error) {
+	pe, err := getProcessEntry(os.Getpid())
+	if err != nil {
+		return
+	}
+
+	pid = int(pe.th32ParentProcessID)
+	return
+}
+
+// StartedByExplorer returns true if the program was invoked by the user double-clicking
+// on the executable from explorer.exe
+//
+// It is conservative and returns false if any of the internal calls fail.
+// It does not guarantee that the program was run from a terminal. It only can tell you
+// whether it was launched from explorer.exe
+func StartedByExplorer() bool {
+	ppid, err := getppid()
+	if err != nil {
+		return false
+	}
+
+	pe, err := getProcessEntry(ppid)
+	if err != nil {
+		return false
+	}
+
+	name := syscall.UTF16ToString(pe.szExeFile[:])
+	return name == "explorer.exe"
+}
diff --git a/vendor/github.com/inconshreveable/mousetrap/trap_windows_1.4.go b/vendor/github.com/inconshreveable/mousetrap/trap_windows_1.4.go
new file mode 100644
index 0000000..9a28e57
--- /dev/null
+++ b/vendor/github.com/inconshreveable/mousetrap/trap_windows_1.4.go
@@ -0,0 +1,46 @@
+// +build windows
+// +build go1.4
+
+package mousetrap
+
+import (
+	"os"
+	"syscall"
+	"unsafe"
+)
+
+func getProcessEntry(pid int) (*syscall.ProcessEntry32, error) {
+	snapshot, err := syscall.CreateToolhelp32Snapshot(syscall.TH32CS_SNAPPROCESS, 0)
+	if err != nil {
+		return nil, err
+	}
+	defer syscall.CloseHandle(snapshot)
+	var procEntry syscall.ProcessEntry32
+	procEntry.Size = uint32(unsafe.Sizeof(procEntry))
+	if err = syscall.Process32First(snapshot, &procEntry); err != nil {
+		return nil, err
+	}
+	for {
+		if procEntry.ProcessID == uint32(pid) {
+			return &procEntry, nil
+		}
+		err = syscall.Process32Next(snapshot, &procEntry)
+		if err != nil {
+			return nil, err
+		}
+	}
+}
+
+// StartedByExplorer returns true if the program was invoked by the user double-clicking
+// on the executable from explorer.exe
+//
+// It is conservative and returns false if any of the internal calls fail.
+// It does not guarantee that the program was run from a terminal. It only can tell you
+// whether it was launched from explorer.exe
+func StartedByExplorer() bool {
+	pe, err := getProcessEntry(os.Getppid())
+	if err != nil {
+		return false
+	}
+	return "explorer.exe" == syscall.UTF16ToString(pe.ExeFile[:])
+}
diff --git a/vendor/github.com/miguelmota/go-coinmarketcap/v2/v2.go b/vendor/github.com/miguelmota/go-coinmarketcap/v2/v2.go
index 5ec6892..d5f03de 100644
--- a/vendor/github.com/miguelmota/go-coinmarketcap/v2/v2.go
+++ b/vendor/github.com/miguelmota/go-coinmarketcap/v2/v2.go
@@ -37,6 +37,7 @@ type Interface interface {
 	Price(options *PriceOptions) (float64, error)
 	CoinID(symbol string) (int, error)
 	CoinSlug(symbol string) (string, error)
+	CoinSymbol(slug string) (string, error)
 }
 
 // listingsMedia listings response media
@@ -315,8 +316,12 @@ func CoinID(symbol string) (int, error) {
 		if l.Symbol == symbol {
 			return l.ID, nil
 		}
+
+		if l.Slug == strings.ToLower(symbol) {
+			return l.ID, nil
+		}
 	}
-	//returns error as default
+
 	return 0, errors.New("coin not found")
 }
 
@@ -336,6 +341,23 @@ func CoinSlug(symbol string) (string, error) {
 	return coin.Slug, nil
 }
 
+// CoinSymbol gets the symbol for the cryptocurrency
+func CoinSymbol(slug string) (string, error) {
+	slug = strings.ToLower(strings.TrimSpace(slug))
+	coin, err := Ticker(&TickerOptions{
+		Symbol: slug,
+	})
+	if err != nil {
+		return "", err
+	}
+
+	if coin == nil {
+		return "", errors.New("coin not found")
+	}
+
+	return coin.Symbol, nil
+}
+
 // toInt helper for parsing strings to int
 func toInt(rawInt string) int {
 	parsed, _ := strconv.Atoi(strings.Replace(strings.Replace(rawInt, "$", "", -1), ",", "", -1))
diff --git a/vendor/github.com/spf13/cobra/.gitignore b/vendor/github.com/spf13/cobra/.gitignore
new file mode 100644
index 0000000..3b053c5
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/.gitignore
@@ -0,0 +1,38 @@
+# Compiled Object files, Static and Dynamic libs (Shared Objects)
+*.o
+*.a
+*.so
+
+# Folders
+_obj
+_test
+
+# Architecture specific extensions/prefixes
+*.[568vq]
+[568vq].out
+
+*.cgo1.go
+*.cgo2.c
+_cgo_defun.c
+_cgo_gotypes.go
+_cgo_export.*
+
+_testmain.go
+
+# Vim files https://github.com/github/gitignore/blob/master/Global/Vim.gitignore
+# swap
+[._]*.s[a-w][a-z]
+[._]s[a-w][a-z]
+# session
+Session.vim
+# temporary
+.netrwhist
+*~
+# auto-generated tag files
+tags
+
+*.exe
+
+cobra.test
+
+.idea/*
diff --git a/vendor/github.com/spf13/cobra/.mailmap b/vendor/github.com/spf13/cobra/.mailmap
new file mode 100644
index 0000000..94ec530
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/.mailmap
@@ -0,0 +1,3 @@
+Steve Francia <steve.francia@gmail.com>
+Bjørn Erik Pedersen <bjorn.erik.pedersen@gmail.com>
+Fabiano Franz <ffranz@redhat.com>                   <contact@fabianofranz.com>
diff --git a/vendor/github.com/spf13/cobra/.travis.yml b/vendor/github.com/spf13/cobra/.travis.yml
new file mode 100644
index 0000000..38b85f4
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/.travis.yml
@@ -0,0 +1,31 @@
+language: go
+
+stages:
+  - diff
+  - test
+
+go:
+  - 1.10.x
+  - 1.11.x
+  - 1.12.x
+  - tip
+
+matrix:
+  allow_failures:
+    - go: tip
+  include:
+    - stage: diff
+      go: 1.12.x
+      script: diff -u <(echo -n) <(gofmt -d -s .)
+
+before_install:
+  - mkdir -p bin
+  - curl -Lso bin/shellcheck https://github.com/caarlos0/shellcheck-docker/releases/download/v0.6.0/shellcheck
+  - chmod +x bin/shellcheck
+  - go get -u github.com/kyoh86/richgo
+script:
+  - PATH=$PATH:$PWD/bin richgo test -v ./...
+  - go build
+  - if [ -z $NOVET ]; then
+      diff -u <(echo -n) <(go vet . 2>&1 | grep -vE 'ExampleCommand|bash_completions.*Fprint');
+    fi
diff --git a/vendor/github.com/spf13/cobra/LICENSE.txt b/vendor/github.com/spf13/cobra/LICENSE.txt
new file mode 100644
index 0000000..298f0e2
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/LICENSE.txt
@@ -0,0 +1,174 @@
+                                Apache License
+                           Version 2.0, January 2004
+                        http://www.apache.org/licenses/
+
+   TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION
+
+   1. Definitions.
+
+      "License" shall mean the terms and conditions for use, reproduction,
+      and distribution as defined by Sections 1 through 9 of this document.
+
+      "Licensor" shall mean the copyright owner or entity authorized by
+      the copyright owner that is granting the License.
+
+      "Legal Entity" shall mean the union of the acting entity and all
+      other entities that control, are controlled by, or are under common
+      control with that entity. For the purposes of this definition,
+      "control" means (i) the power, direct or indirect, to cause the
+      direction or management of such entity, whether by contract or
+      otherwise, or (ii) ownership of fifty percent (50%) or more of the
+      outstanding shares, or (iii) beneficial ownership of such entity.
+
+      "You" (or "Your") shall mean an individual or Legal Entity
+      exercising permissions granted by this License.
+
+      "Source" form shall mean the preferred form for making modifications,
+      including but not limited to software source code, documentation
+      source, and configuration files.
+
+      "Object" form shall mean any form resulting from mechanical
+      transformation or translation of a Source form, including but
+      not limited to compiled object code, generated documentation,
+      and conversions to other media types.
+
+      "Work" shall mean the work of authorship, whether in Source or
+      Object form, made available under the License, as indicated by a
+      copyright notice that is included in or attached to the work
+      (an example is provided in the Appendix below).
+
+      "Derivative Works" shall mean any work, whether in Source or Object
+      form, that is based on (or derived from) the Work and for which the
+      editorial revisions, annotations, elaborations, or other modifications
+      represent, as a whole, an original work of authorship. For the purposes
+      of this License, Derivative Works shall not include works that remain
+      separable from, or merely link (or bind by name) to the interfaces of,
+      the Work and Derivative Works thereof.
+
+      "Contribution" shall mean any work of authorship, including
+      the original version of the Work and any modifications or additions
+      to that Work or Derivative Works thereof, that is intentionally
+      submitted to Licensor for inclusion in the Work by the copyright owner
+      or by an individual or Legal Entity authorized to submit on behalf of
+      the copyright owner. For the purposes of this definition, "submitted"
+      means any form of electronic, verbal, or written communication sent
+      to the Licensor or its representatives, including but not limited to
+      communication on electronic mailing lists, source code control systems,
+      and issue tracking systems that are managed by, or on behalf of, the
+      Licensor for the purpose of discussing and improving the Work, but
+      excluding communication that is conspicuously marked or otherwise
+      designated in writing by the copyright owner as "Not a Contribution."
+
+      "Contributor" shall mean Licensor and any individual or Legal Entity
+      on behalf of whom a Contribution has been received by Licensor and
+      subsequently incorporated within the Work.
+
+   2. Grant of Copyright License. Subject to the terms and conditions of
+      this License, each Contributor hereby grants to You a perpetual,
+      worldwide, non-exclusive, no-charge, royalty-free, irrevocable
+      copyright license to reproduce, prepare Derivative Works of,
+      publicly display, publicly perform, sublicense, and distribute the
+      Work and such Derivative Works in Source or Object form.
+
+   3. Grant of Patent License. Subject to the terms and conditions of
+      this License, each Contributor hereby grants to You a perpetual,
+      worldwide, non-exclusive, no-charge, royalty-free, irrevocable
+      (except as stated in this section) patent license to make, have made,
+      use, offer to sell, sell, import, and otherwise transfer the Work,
+      where such license applies only to those patent claims licensable
+      by such Contributor that are necessarily infringed by their
+      Contribution(s) alone or by combination of their Contribution(s)
+      with the Work to which such Contribution(s) was submitted. If You
+      institute patent litigation against any entity (including a
+      cross-claim or counterclaim in a lawsuit) alleging that the Work
+      or a Contribution incorporated within the Work constitutes direct
+      or contributory patent infringement, then any patent licenses
+      granted to You under this License for that Work shall terminate
+      as of the date such litigation is filed.
+
+   4. Redistribution. You may reproduce and distribute copies of the
+      Work or Derivative Works thereof in any medium, with or without
+      modifications, and in Source or Object form, provided that You
+      meet the following conditions:
+
+      (a) You must give any other recipients of the Work or
+          Derivative Works a copy of this License; and
+
+      (b) You must cause any modified files to carry prominent notices
+          stating that You changed the files; and
+
+      (c) You must retain, in the Source form of any Derivative Works
+          that You distribute, all copyright, patent, trademark, and
+          attribution notices from the Source form of the Work,
+          excluding those notices that do not pertain to any part of
+          the Derivative Works; and
+
+      (d) If the Work includes a "NOTICE" text file as part of its
+          distribution, then any Derivative Works that You distribute must
+          include a readable copy of the attribution notices contained
+          within such NOTICE file, excluding those notices that do not
+          pertain to any part of the Derivative Works, in at least one
+          of the following places: within a NOTICE text file distributed
+          as part of the Derivative Works; within the Source form or
+          documentation, if provided along with the Derivative Works; or,
+          within a display generated by the Derivative Works, if and
+          wherever such third-party notices normally appear. The contents
+          of the NOTICE file are for informational purposes only and
+          do not modify the License. You may add Your own attribution
+          notices within Derivative Works that You distribute, alongside
+          or as an addendum to the NOTICE text from the Work, provided
+          that such additional attribution notices cannot be construed
+          as modifying the License.
+
+      You may add Your own copyright statement to Your modifications and
+      may provide additional or different license terms and conditions
+      for use, reproduction, or distribution of Your modifications, or
+      for any such Derivative Works as a whole, provided Your use,
+      reproduction, and distribution of the Work otherwise complies with
+      the conditions stated in this License.
+
+   5. Submission of Contributions. Unless You explicitly state otherwise,
+      any Contribution intentionally submitted for inclusion in the Work
+      by You to the Licensor shall be under the terms and conditions of
+      this License, without any additional terms or conditions.
+      Notwithstanding the above, nothing herein shall supersede or modify
+      the terms of any separate license agreement you may have executed
+      with Licensor regarding such Contributions.
+
+   6. Trademarks. This License does not grant permission to use the trade
+      names, trademarks, service marks, or product names of the Licensor,
+      except as required for reasonable and customary use in describing the
+      origin of the Work and reproducing the content of the NOTICE file.
+
+   7. Disclaimer of Warranty. Unless required by applicable law or
+      agreed to in writing, Licensor provides the Work (and each
+      Contributor provides its Contributions) on an "AS IS" BASIS,
+      WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or
+      implied, including, without limitation, any warranties or conditions
+      of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A
+      PARTICULAR PURPOSE. You are solely responsible for determining the
+      appropriateness of using or redistributing the Work and assume any
+      risks associated with Your exercise of permissions under this License.
+
+   8. Limitation of Liability. In no event and under no legal theory,
+      whether in tort (including negligence), contract, or otherwise,
+      unless required by applicable law (such as deliberate and grossly
+      negligent acts) or agreed to in writing, shall any Contributor be
+      liable to You for damages, including any direct, indirect, special,
+      incidental, or consequential damages of any character arising as a
+      result of this License or out of the use or inability to use the
+      Work (including but not limited to damages for loss of goodwill,
+      work stoppage, computer failure or malfunction, or any and all
+      other commercial damages or losses), even if such Contributor
+      has been advised of the possibility of such damages.
+
+   9. Accepting Warranty or Additional Liability. While redistributing
+      the Work or Derivative Works thereof, You may choose to offer,
+      and charge a fee for, acceptance of support, warranty, indemnity,
+      or other liability obligations and/or rights consistent with this
+      License. However, in accepting such obligations, You may act only
+      on Your own behalf and on Your sole responsibility, not on behalf
+      of any other Contributor, and only if You agree to indemnify,
+      defend, and hold each Contributor harmless for any liability
+      incurred by, or claims asserted against, such Contributor by reason
+      of your accepting any such warranty or additional liability.
diff --git a/vendor/github.com/spf13/cobra/README.md b/vendor/github.com/spf13/cobra/README.md
new file mode 100644
index 0000000..60c5a42
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/README.md
@@ -0,0 +1,741 @@
+![cobra logo](https://cloud.githubusercontent.com/assets/173412/10886352/ad566232-814f-11e5-9cd0-aa101788c117.png)
+
+Cobra is both a library for creating powerful modern CLI applications as well as a program to generate applications and command files.
+
+Many of the most widely used Go projects are built using Cobra, such as:
+[Kubernetes](http://kubernetes.io/),
+[Hugo](http://gohugo.io),
+[rkt](https://github.com/coreos/rkt),
+[etcd](https://github.com/coreos/etcd),
+[Moby (former Docker)](https://github.com/moby/moby),
+[Docker (distribution)](https://github.com/docker/distribution),
+[OpenShift](https://www.openshift.com/),
+[Delve](https://github.com/derekparker/delve),
+[GopherJS](http://www.gopherjs.org/),
+[CockroachDB](http://www.cockroachlabs.com/),
+[Bleve](http://www.blevesearch.com/),
+[ProjectAtomic (enterprise)](http://www.projectatomic.io/),
+[Giant Swarm's gsctl](https://github.com/giantswarm/gsctl),
+[Nanobox](https://github.com/nanobox-io/nanobox)/[Nanopack](https://github.com/nanopack),
+[rclone](http://rclone.org/),
+[nehm](https://github.com/bogem/nehm),
+[Pouch](https://github.com/alibaba/pouch),
+[Istio](https://istio.io),
+[Prototool](https://github.com/uber/prototool),
+[mattermost-server](https://github.com/mattermost/mattermost-server),
+[Gardener](https://github.com/gardener/gardenctl),
+etc.
+
+[![Build Status](https://travis-ci.org/spf13/cobra.svg "Travis CI status")](https://travis-ci.org/spf13/cobra)
+[![CircleCI status](https://circleci.com/gh/spf13/cobra.png?circle-token=:circle-token "CircleCI status")](https://circleci.com/gh/spf13/cobra)
+[![GoDoc](https://godoc.org/github.com/spf13/cobra?status.svg)](https://godoc.org/github.com/spf13/cobra)
+
+# Table of Contents
+
+- [Overview](#overview)
+- [Concepts](#concepts)
+  * [Commands](#commands)
+  * [Flags](#flags)
+- [Installing](#installing)
+- [Getting Started](#getting-started)
+  * [Using the Cobra Generator](#using-the-cobra-generator)
+  * [Using the Cobra Library](#using-the-cobra-library)
+  * [Working with Flags](#working-with-flags)
+  * [Positional and Custom Arguments](#positional-and-custom-arguments)
+  * [Example](#example)
+  * [Help Command](#help-command)
+  * [Usage Message](#usage-message)
+  * [PreRun and PostRun Hooks](#prerun-and-postrun-hooks)
+  * [Suggestions when "unknown command" happens](#suggestions-when-unknown-command-happens)
+  * [Generating documentation for your command](#generating-documentation-for-your-command)
+  * [Generating bash completions](#generating-bash-completions)
+  * [Generating zsh completions](#generating-zsh-completions)
+- [Contributing](#contributing)
+- [License](#license)
+
+# Overview
+
+Cobra is a library providing a simple interface to create powerful modern CLI
+interfaces similar to git & go tools.
+
+Cobra is also an application that will generate your application scaffolding to rapidly
+develop a Cobra-based application.
+
+Cobra provides:
+* Easy subcommand-based CLIs: `app server`, `app fetch`, etc.
+* Fully POSIX-compliant flags (including short & long versions)
+* Nested subcommands
+* Global, local and cascading flags
+* Easy generation of applications & commands with `cobra init appname` & `cobra add cmdname`
+* Intelligent suggestions (`app srver`... did you mean `app server`?)
+* Automatic help generation for commands and flags
+* Automatic help flag recognition of `-h`, `--help`, etc.
+* Automatically generated bash autocomplete for your application
+* Automatically generated man pages for your application
+* Command aliases so you can change things without breaking them
+* The flexibility to define your own help, usage, etc.
+* Optional tight integration with [viper](http://github.com/spf13/viper) for 12-factor apps
+
+# Concepts
+
+Cobra is built on a structure of commands, arguments & flags.
+
+**Commands** represent actions, **Args** are things and **Flags** are modifiers for those actions.
+
+The best applications will read like sentences when used. Users will know how
+to use the application because they will natively understand how to use it.
+
+The pattern to follow is
+`APPNAME VERB NOUN --ADJECTIVE.`
+    or
+`APPNAME COMMAND ARG --FLAG`
+
+A few good real world examples may better illustrate this point.
+
+In the following example, 'server' is a command, and 'port' is a flag:
+
+    hugo server --port=1313
+
+In this command we are telling Git to clone the url bare.
+
+    git clone URL --bare
+
+## Commands
+
+Command is the central point of the application. Each interaction that
+the application supports will be contained in a Command. A command can
+have children commands and optionally run an action.
+
+In the example above, 'server' is the command.
+
+[More about cobra.Command](https://godoc.org/github.com/spf13/cobra#Command)
+
+## Flags
+
+A flag is a way to modify the behavior of a command. Cobra supports
+fully POSIX-compliant flags as well as the Go [flag package](https://golang.org/pkg/flag/).
+A Cobra command can define flags that persist through to children commands
+and flags that are only available to that command.
+
+In the example above, 'port' is the flag.
+
+Flag functionality is provided by the [pflag
+library](https://github.com/spf13/pflag), a fork of the flag standard library
+which maintains the same interface while adding POSIX compliance.
+
+# Installing
+Using Cobra is easy. First, use `go get` to install the latest version
+of the library. This command will install the `cobra` generator executable
+along with the library and its dependencies:
+
+    go get -u github.com/spf13/cobra/cobra
+
+Next, include Cobra in your application:
+
+```go
+import "github.com/spf13/cobra"
+```
+
+# Getting Started
+
+While you are welcome to provide your own organization, typically a Cobra-based
+application will follow the following organizational structure:
+
+```
+  ▾ appName/
+    ▾ cmd/
+        add.go
+        your.go
+        commands.go
+        here.go
+      main.go
+```
+
+In a Cobra app, typically the main.go file is very bare. It serves one purpose: initializing Cobra.
+
+```go
+package main
+
+import (
+  "{pathToYourApp}/cmd"
+)
+
+func main() {
+  cmd.Execute()
+}
+```
+
+## Using the Cobra Generator
+
+Cobra provides its own program that will create your application and add any
+commands you want. It's the easiest way to incorporate Cobra into your application.
+
+[Here](https://github.com/spf13/cobra/blob/master/cobra/README.md) you can find more information about it.
+
+## Using the Cobra Library
+
+To manually implement Cobra you need to create a bare main.go file and a rootCmd file.
+You will optionally provide additional commands as you see fit.
+
+### Create rootCmd
+
+Cobra doesn't require any special constructors. Simply create your commands.
+
+Ideally you place this in app/cmd/root.go:
+
+```go
+var rootCmd = &cobra.Command{
+  Use:   "hugo",
+  Short: "Hugo is a very fast static site generator",
+  Long: `A Fast and Flexible Static Site Generator built with
+                love by spf13 and friends in Go.
+                Complete documentation is available at http://hugo.spf13.com`,
+  Run: func(cmd *cobra.Command, args []string) {
+    // Do Stuff Here
+  },
+}
+
+func Execute() {
+  if err := rootCmd.Execute(); err != nil {
+    fmt.Println(err)
+    os.Exit(1)
+  }
+}
+```
+
+You will additionally define flags and handle configuration in your init() function.
+
+For example cmd/root.go:
+
+```go
+import (
+  "fmt"
+  "os"
+
+  homedir "github.com/mitchellh/go-homedir"
+  "github.com/spf13/cobra"
+  "github.com/spf13/viper"
+)
+
+func init() {
+  cobra.OnInitialize(initConfig)
+  rootCmd.PersistentFlags().StringVar(&cfgFile, "config", "", "config file (default is $HOME/.cobra.yaml)")
+  rootCmd.PersistentFlags().StringVarP(&projectBase, "projectbase", "b", "", "base project directory eg. github.com/spf13/")
+  rootCmd.PersistentFlags().StringP("author", "a", "YOUR NAME", "Author name for copyright attribution")
+  rootCmd.PersistentFlags().StringVarP(&userLicense, "license", "l", "", "Name of license for the project (can provide `licensetext` in config)")
+  rootCmd.PersistentFlags().Bool("viper", true, "Use Viper for configuration")
+  viper.BindPFlag("author", rootCmd.PersistentFlags().Lookup("author"))
+  viper.BindPFlag("projectbase", rootCmd.PersistentFlags().Lookup("projectbase"))
+  viper.BindPFlag("useViper", rootCmd.PersistentFlags().Lookup("viper"))
+  viper.SetDefault("author", "NAME HERE <EMAIL ADDRESS>")
+  viper.SetDefault("license", "apache")
+}
+
+func initConfig() {
+  // Don't forget to read config either from cfgFile or from home directory!
+  if cfgFile != "" {
+    // Use config file from the flag.
+    viper.SetConfigFile(cfgFile)
+  } else {
+    // Find home directory.
+    home, err := homedir.Dir()
+    if err != nil {
+      fmt.Println(err)
+      os.Exit(1)
+    }
+
+    // Search config in home directory with name ".cobra" (without extension).
+    viper.AddConfigPath(home)
+    viper.SetConfigName(".cobra")
+  }
+
+  if err := viper.ReadInConfig(); err != nil {
+    fmt.Println("Can't read config:", err)
+    os.Exit(1)
+  }
+}
+```
+
+### Create your main.go
+
+With the root command you need to have your main function execute it.
+Execute should be run on the root for clarity, though it can be called on any command.
+
+In a Cobra app, typically the main.go file is very bare. It serves, one purpose, to initialize Cobra.
+
+```go
+package main
+
+import (
+  "{pathToYourApp}/cmd"
+)
+
+func main() {
+  cmd.Execute()
+}
+```
+
+### Create additional commands
+
+Additional commands can be defined and typically are each given their own file
+inside of the cmd/ directory.
+
+If you wanted to create a version command you would create cmd/version.go and
+populate it with the following:
+
+```go
+package cmd
+
+import (
+  "fmt"
+
+  "github.com/spf13/cobra"
+)
+
+func init() {
+  rootCmd.AddCommand(versionCmd)
+}
+
+var versionCmd = &cobra.Command{
+  Use:   "version",
+  Short: "Print the version number of Hugo",
+  Long:  `All software has versions. This is Hugo's`,
+  Run: func(cmd *cobra.Command, args []string) {
+    fmt.Println("Hugo Static Site Generator v0.9 -- HEAD")
+  },
+}
+```
+
+## Working with Flags
+
+Flags provide modifiers to control how the action command operates.
+
+### Assign flags to a command
+
+Since the flags are defined and used in different locations, we need to
+define a variable outside with the correct scope to assign the flag to
+work with.
+
+```go
+var Verbose bool
+var Source string
+```
+
+There are two different approaches to assign a flag.
+
+### Persistent Flags
+
+A flag can be 'persistent' meaning that this flag will be available to the
+command it's assigned to as well as every command under that command. For
+global flags, assign a flag as a persistent flag on the root.
+
+```go
+rootCmd.PersistentFlags().BoolVarP(&Verbose, "verbose", "v", false, "verbose output")
+```
+
+### Local Flags
+
+A flag can also be assigned locally which will only apply to that specific command.
+
+```go
+localCmd.Flags().StringVarP(&Source, "source", "s", "", "Source directory to read from")
+```
+
+### Local Flag on Parent Commands
+
+By default Cobra only parses local flags on the target command, any local flags on
+parent commands are ignored. By enabling `Command.TraverseChildren` Cobra will
+parse local flags on each command before executing the target command.
+
+```go
+command := cobra.Command{
+  Use: "print [OPTIONS] [COMMANDS]",
+  TraverseChildren: true,
+}
+```
+
+### Bind Flags with Config
+
+You can also bind your flags with [viper](https://github.com/spf13/viper):
+```go
+var author string
+
+func init() {
+  rootCmd.PersistentFlags().StringVar(&author, "author", "YOUR NAME", "Author name for copyright attribution")
+  viper.BindPFlag("author", rootCmd.PersistentFlags().Lookup("author"))
+}
+```
+
+In this example the persistent flag `author` is bound with `viper`.
+**Note**, that the variable `author` will not be set to the value from config,
+when the `--author` flag is not provided by user.
+
+More in [viper documentation](https://github.com/spf13/viper#working-with-flags).
+
+### Required flags
+
+Flags are optional by default. If instead you wish your command to report an error
+when a flag has not been set, mark it as required:
+```go
+rootCmd.Flags().StringVarP(&Region, "region", "r", "", "AWS region (required)")
+rootCmd.MarkFlagRequired("region")
+```
+
+## Positional and Custom Arguments
+
+Validation of positional arguments can be specified using the `Args` field
+of `Command`.
+
+The following validators are built in:
+
+- `NoArgs` - the command will report an error if there are any positional args.
+- `ArbitraryArgs` - the command will accept any args.
+- `OnlyValidArgs` - the command will report an error if there are any positional args that are not in the `ValidArgs` field of `Command`.
+- `MinimumNArgs(int)` - the command will report an error if there are not at least N positional args.
+- `MaximumNArgs(int)` - the command will report an error if there are more than N positional args.
+- `ExactArgs(int)` - the command will report an error if there are not exactly N positional args.
+- `ExactValidArgs(int)` - the command will report an error if there are not exactly N positional args OR if there are any positional args that are not in the `ValidArgs` field of `Command`
+- `RangeArgs(min, max)` - the command will report an error if the number of args is not between the minimum and maximum number of expected args.
+
+An example of setting the custom validator:
+
+```go
+var cmd = &cobra.Command{
+  Short: "hello",
+  Args: func(cmd *cobra.Command, args []string) error {
+    if len(args) < 1 {
+      return errors.New("requires a color argument")
+    }
+    if myapp.IsValidColor(args[0]) {
+      return nil
+    }
+    return fmt.Errorf("invalid color specified: %s", args[0])
+  },
+  Run: func(cmd *cobra.Command, args []string) {
+    fmt.Println("Hello, World!")
+  },
+}
+```
+
+## Example
+
+In the example below, we have defined three commands. Two are at the top level
+and one (cmdTimes) is a child of one of the top commands. In this case the root
+is not executable meaning that a subcommand is required. This is accomplished
+by not providing a 'Run' for the 'rootCmd'.
+
+We have only defined one flag for a single command.
+
+More documentation about flags is available at https://github.com/spf13/pflag
+
+```go
+package main
+
+import (
+  "fmt"
+  "strings"
+
+  "github.com/spf13/cobra"
+)
+
+func main() {
+  var echoTimes int
+
+  var cmdPrint = &cobra.Command{
+    Use:   "print [string to print]",
+    Short: "Print anything to the screen",
+    Long: `print is for printing anything back to the screen.
+For many years people have printed back to the screen.`,
+    Args: cobra.MinimumNArgs(1),
+    Run: func(cmd *cobra.Command, args []string) {
+      fmt.Println("Print: " + strings.Join(args, " "))
+    },
+  }
+
+  var cmdEcho = &cobra.Command{
+    Use:   "echo [string to echo]",
+    Short: "Echo anything to the screen",
+    Long: `echo is for echoing anything back.
+Echo works a lot like print, except it has a child command.`,
+    Args: cobra.MinimumNArgs(1),
+    Run: func(cmd *cobra.Command, args []string) {
+      fmt.Println("Print: " + strings.Join(args, " "))
+    },
+  }
+
+  var cmdTimes = &cobra.Command{
+    Use:   "times [string to echo]",
+    Short: "Echo anything to the screen more times",
+    Long: `echo things multiple times back to the user by providing
+a count and a string.`,
+    Args: cobra.MinimumNArgs(1),
+    Run: func(cmd *cobra.Command, args []string) {
+      for i := 0; i < echoTimes; i++ {
+        fmt.Println("Echo: " + strings.Join(args, " "))
+      }
+    },
+  }
+
+  cmdTimes.Flags().IntVarP(&echoTimes, "times", "t", 1, "times to echo the input")
+
+  var rootCmd = &cobra.Command{Use: "app"}
+  rootCmd.AddCommand(cmdPrint, cmdEcho)
+  cmdEcho.AddCommand(cmdTimes)
+  rootCmd.Execute()
+}
+```
+
+For a more complete example of a larger application, please checkout [Hugo](http://gohugo.io/).
+
+## Help Command
+
+Cobra automatically adds a help command to your application when you have subcommands.
+This will be called when a user runs 'app help'. Additionally, help will also
+support all other commands as input. Say, for instance, you have a command called
+'create' without any additional configuration; Cobra will work when 'app help
+create' is called.  Every command will automatically have the '--help' flag added.
+
+### Example
+
+The following output is automatically generated by Cobra. Nothing beyond the
+command and flag definitions are needed.
+
+    $ cobra help
+
+    Cobra is a CLI library for Go that empowers applications.
+    This application is a tool to generate the needed files
+    to quickly create a Cobra application.
+
+    Usage:
+      cobra [command]
+
+    Available Commands:
+      add         Add a command to a Cobra Application
+      help        Help about any command
+      init        Initialize a Cobra Application
+
+    Flags:
+      -a, --author string    author name for copyright attribution (default "YOUR NAME")
+          --config string    config file (default is $HOME/.cobra.yaml)
+      -h, --help             help for cobra
+      -l, --license string   name of license for the project
+          --viper            use Viper for configuration (default true)
+
+    Use "cobra [command] --help" for more information about a command.
+
+
+Help is just a command like any other. There is no special logic or behavior
+around it. In fact, you can provide your own if you want.
+
+### Defining your own help
+
+You can provide your own Help command or your own template for the default command to use
+with following functions:
+
+```go
+cmd.SetHelpCommand(cmd *Command)
+cmd.SetHelpFunc(f func(*Command, []string))
+cmd.SetHelpTemplate(s string)
+```
+
+The latter two will also apply to any children commands.
+
+## Usage Message
+
+When the user provides an invalid flag or invalid command, Cobra responds by
+showing the user the 'usage'.
+
+### Example
+You may recognize this from the help above. That's because the default help
+embeds the usage as part of its output.
+
+    $ cobra --invalid
+    Error: unknown flag: --invalid
+    Usage:
+      cobra [command]
+
+    Available Commands:
+      add         Add a command to a Cobra Application
+      help        Help about any command
+      init        Initialize a Cobra Application
+
+    Flags:
+      -a, --author string    author name for copyright attribution (default "YOUR NAME")
+          --config string    config file (default is $HOME/.cobra.yaml)
+      -h, --help             help for cobra
+      -l, --license string   name of license for the project
+          --viper            use Viper for configuration (default true)
+
+    Use "cobra [command] --help" for more information about a command.
+
+### Defining your own usage
+You can provide your own usage function or template for Cobra to use.
+Like help, the function and template are overridable through public methods:
+
+```go
+cmd.SetUsageFunc(f func(*Command) error)
+cmd.SetUsageTemplate(s string)
+```
+
+## Version Flag
+
+Cobra adds a top-level '--version' flag if the Version field is set on the root command.
+Running an application with the '--version' flag will print the version to stdout using
+the version template. The template can be customized using the
+`cmd.SetVersionTemplate(s string)` function.
+
+## PreRun and PostRun Hooks
+
+It is possible to run functions before or after the main `Run` function of your command. The `PersistentPreRun` and `PreRun` functions will be executed before `Run`. `PersistentPostRun` and `PostRun` will be executed after `Run`.  The `Persistent*Run` functions will be inherited by children if they do not declare their own.  These functions are run in the following order:
+
+- `PersistentPreRun`
+- `PreRun`
+- `Run`
+- `PostRun`
+- `PersistentPostRun`
+
+An example of two commands which use all of these features is below.  When the subcommand is executed, it will run the root command's `PersistentPreRun` but not the root command's `PersistentPostRun`:
+
+```go
+package main
+
+import (
+  "fmt"
+
+  "github.com/spf13/cobra"
+)
+
+func main() {
+
+  var rootCmd = &cobra.Command{
+    Use:   "root [sub]",
+    Short: "My root command",
+    PersistentPreRun: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside rootCmd PersistentPreRun with args: %v\n", args)
+    },
+    PreRun: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside rootCmd PreRun with args: %v\n", args)
+    },
+    Run: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside rootCmd Run with args: %v\n", args)
+    },
+    PostRun: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside rootCmd PostRun with args: %v\n", args)
+    },
+    PersistentPostRun: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside rootCmd PersistentPostRun with args: %v\n", args)
+    },
+  }
+
+  var subCmd = &cobra.Command{
+    Use:   "sub [no options!]",
+    Short: "My subcommand",
+    PreRun: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside subCmd PreRun with args: %v\n", args)
+    },
+    Run: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside subCmd Run with args: %v\n", args)
+    },
+    PostRun: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside subCmd PostRun with args: %v\n", args)
+    },
+    PersistentPostRun: func(cmd *cobra.Command, args []string) {
+      fmt.Printf("Inside subCmd PersistentPostRun with args: %v\n", args)
+    },
+  }
+
+  rootCmd.AddCommand(subCmd)
+
+  rootCmd.SetArgs([]string{""})
+  rootCmd.Execute()
+  fmt.Println()
+  rootCmd.SetArgs([]string{"sub", "arg1", "arg2"})
+  rootCmd.Execute()
+}
+```
+
+Output:
+```
+Inside rootCmd PersistentPreRun with args: []
+Inside rootCmd PreRun with args: []
+Inside rootCmd Run with args: []
+Inside rootCmd PostRun with args: []
+Inside rootCmd PersistentPostRun with args: []
+
+Inside rootCmd PersistentPreRun with args: [arg1 arg2]
+Inside subCmd PreRun with args: [arg1 arg2]
+Inside subCmd Run with args: [arg1 arg2]
+Inside subCmd PostRun with args: [arg1 arg2]
+Inside subCmd PersistentPostRun with args: [arg1 arg2]
+```
+
+## Suggestions when "unknown command" happens
+
+Cobra will print automatic suggestions when "unknown command" errors happen. This allows Cobra to behave similarly to the `git` command when a typo happens. For example:
+
+```
+$ hugo srever
+Error: unknown command "srever" for "hugo"
+
+Did you mean this?
+        server
+
+Run 'hugo --help' for usage.
+```
+
+Suggestions are automatic based on every subcommand registered and use an implementation of [Levenshtein distance](http://en.wikipedia.org/wiki/Levenshtein_distance). Every registered command that matches a minimum distance of 2 (ignoring case) will be displayed as a suggestion.
+
+If you need to disable suggestions or tweak the string distance in your command, use:
+
+```go
+command.DisableSuggestions = true
+```
+
+or
+
+```go
+command.SuggestionsMinimumDistance = 1
+```
+
+You can also explicitly set names for which a given command will be suggested using the `SuggestFor` attribute. This allows suggestions for strings that are not close in terms of string distance, but makes sense in your set of commands and for some which you don't want aliases. Example:
+
+```
+$ kubectl remove
+Error: unknown command "remove" for "kubectl"
+
+Did you mean this?
+        delete
+
+Run 'kubectl help' for usage.
+```
+
+## Generating documentation for your command
+
+Cobra can generate documentation based on subcommands, flags, etc. in the following formats:
+
+- [Markdown](doc/md_docs.md)
+- [ReStructured Text](doc/rest_docs.md)
+- [Man Page](doc/man_docs.md)
+
+## Generating bash completions
+
+Cobra can generate a bash-completion file. If you add more information to your command, these completions can be amazingly powerful and flexible.  Read more about it in [Bash Completions](bash_completions.md).
+
+## Generating zsh completions
+
+Cobra can generate zsh-completion file. Read more about it in
+[Zsh Completions](zsh_completions.md).
+
+# Contributing
+
+1. Fork it
+2. Download your fork to your PC (`git clone https://github.com/your_username/cobra && cd cobra`)
+3. Create your feature branch (`git checkout -b my-new-feature`)
+4. Make changes and add them (`git add .`)
+5. Commit your changes (`git commit -m 'Add some feature'`)
+6. Push to the branch (`git push origin my-new-feature`)
+7. Create new pull request
+
+# License
+
+Cobra is released under the Apache 2.0 license. See [LICENSE.txt](https://github.com/spf13/cobra/blob/master/LICENSE.txt)
diff --git a/vendor/github.com/spf13/cobra/args.go b/vendor/github.com/spf13/cobra/args.go
new file mode 100644
index 0000000..c4d820b
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/args.go
@@ -0,0 +1,101 @@
+package cobra
+
+import (
+	"fmt"
+)
+
+type PositionalArgs func(cmd *Command, args []string) error
+
+// Legacy arg validation has the following behaviour:
+// - root commands with no subcommands can take arbitrary arguments
+// - root commands with subcommands will do subcommand validity checking
+// - subcommands will always accept arbitrary arguments
+func legacyArgs(cmd *Command, args []string) error {
+	// no subcommand, always take args
+	if !cmd.HasSubCommands() {
+		return nil
+	}
+
+	// root command with subcommands, do subcommand checking.
+	if !cmd.HasParent() && len(args) > 0 {
+		return fmt.Errorf("unknown command %q for %q%s", args[0], cmd.CommandPath(), cmd.findSuggestions(args[0]))
+	}
+	return nil
+}
+
+// NoArgs returns an error if any args are included.
+func NoArgs(cmd *Command, args []string) error {
+	if len(args) > 0 {
+		return fmt.Errorf("unknown command %q for %q", args[0], cmd.CommandPath())
+	}
+	return nil
+}
+
+// OnlyValidArgs returns an error if any args are not in the list of ValidArgs.
+func OnlyValidArgs(cmd *Command, args []string) error {
+	if len(cmd.ValidArgs) > 0 {
+		for _, v := range args {
+			if !stringInSlice(v, cmd.ValidArgs) {
+				return fmt.Errorf("invalid argument %q for %q%s", v, cmd.CommandPath(), cmd.findSuggestions(args[0]))
+			}
+		}
+	}
+	return nil
+}
+
+// ArbitraryArgs never returns an error.
+func ArbitraryArgs(cmd *Command, args []string) error {
+	return nil
+}
+
+// MinimumNArgs returns an error if there is not at least N args.
+func MinimumNArgs(n int) PositionalArgs {
+	return func(cmd *Command, args []string) error {
+		if len(args) < n {
+			return fmt.Errorf("requires at least %d arg(s), only received %d", n, len(args))
+		}
+		return nil
+	}
+}
+
+// MaximumNArgs returns an error if there are more than N args.
+func MaximumNArgs(n int) PositionalArgs {
+	return func(cmd *Command, args []string) error {
+		if len(args) > n {
+			return fmt.Errorf("accepts at most %d arg(s), received %d", n, len(args))
+		}
+		return nil
+	}
+}
+
+// ExactArgs returns an error if there are not exactly n args.
+func ExactArgs(n int) PositionalArgs {
+	return func(cmd *Command, args []string) error {
+		if len(args) != n {
+			return fmt.Errorf("accepts %d arg(s), received %d", n, len(args))
+		}
+		return nil
+	}
+}
+
+// ExactValidArgs returns an error if
+// there are not exactly N positional args OR
+// there are any positional args that are not in the `ValidArgs` field of `Command`
+func ExactValidArgs(n int) PositionalArgs {
+	return func(cmd *Command, args []string) error {
+		if err := ExactArgs(n)(cmd, args); err != nil {
+			return err
+		}
+		return OnlyValidArgs(cmd, args)
+	}
+}
+
+// RangeArgs returns an error if the number of args is not within the expected range.
+func RangeArgs(min int, max int) PositionalArgs {
+	return func(cmd *Command, args []string) error {
+		if len(args) < min || len(args) > max {
+			return fmt.Errorf("accepts between %d and %d arg(s), received %d", min, max, len(args))
+		}
+		return nil
+	}
+}
diff --git a/vendor/github.com/spf13/cobra/bash_completions.go b/vendor/github.com/spf13/cobra/bash_completions.go
new file mode 100644
index 0000000..57bb8e1
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/bash_completions.go
@@ -0,0 +1,547 @@
+package cobra
+
+import (
+	"bytes"
+	"fmt"
+	"io"
+	"os"
+	"sort"
+	"strings"
+
+	"github.com/spf13/pflag"
+)
+
+// Annotations for Bash completion.
+const (
+	BashCompFilenameExt     = "cobra_annotation_bash_completion_filename_extensions"
+	BashCompCustom          = "cobra_annotation_bash_completion_custom"
+	BashCompOneRequiredFlag = "cobra_annotation_bash_completion_one_required_flag"
+	BashCompSubdirsInDir    = "cobra_annotation_bash_completion_subdirs_in_dir"
+)
+
+func writePreamble(buf *bytes.Buffer, name string) {
+	buf.WriteString(fmt.Sprintf("# bash completion for %-36s -*- shell-script -*-\n", name))
+	buf.WriteString(fmt.Sprintf(`
+__%[1]s_debug()
+{
+    if [[ -n ${BASH_COMP_DEBUG_FILE} ]]; then
+        echo "$*" >> "${BASH_COMP_DEBUG_FILE}"
+    fi
+}
+
+# Homebrew on Macs have version 1.3 of bash-completion which doesn't include
+# _init_completion. This is a very minimal version of that function.
+__%[1]s_init_completion()
+{
+    COMPREPLY=()
+    _get_comp_words_by_ref "$@" cur prev words cword
+}
+
+__%[1]s_index_of_word()
+{
+    local w word=$1
+    shift
+    index=0
+    for w in "$@"; do
+        [[ $w = "$word" ]] && return
+        index=$((index+1))
+    done
+    index=-1
+}
+
+__%[1]s_contains_word()
+{
+    local w word=$1; shift
+    for w in "$@"; do
+        [[ $w = "$word" ]] && return
+    done
+    return 1
+}
+
+__%[1]s_handle_reply()
+{
+    __%[1]s_debug "${FUNCNAME[0]}"
+    case $cur in
+        -*)
+            if [[ $(type -t compopt) = "builtin" ]]; then
+                compopt -o nospace
+            fi
+            local allflags
+            if [ ${#must_have_one_flag[@]} -ne 0 ]; then
+                allflags=("${must_have_one_flag[@]}")
+            else
+                allflags=("${flags[*]} ${two_word_flags[*]}")
+            fi
+            COMPREPLY=( $(compgen -W "${allflags[*]}" -- "$cur") )
+            if [[ $(type -t compopt) = "builtin" ]]; then
+                [[ "${COMPREPLY[0]}" == *= ]] || compopt +o nospace
+            fi
+
+            # complete after --flag=abc
+            if [[ $cur == *=* ]]; then
+                if [[ $(type -t compopt) = "builtin" ]]; then
+                    compopt +o nospace
+                fi
+
+                local index flag
+                flag="${cur%%=*}"
+                __%[1]s_index_of_word "${flag}" "${flags_with_completion[@]}"
+                COMPREPLY=()
+                if [[ ${index} -ge 0 ]]; then
+                    PREFIX=""
+                    cur="${cur#*=}"
+                    ${flags_completion[${index}]}
+                    if [ -n "${ZSH_VERSION}" ]; then
+                        # zsh completion needs --flag= prefix
+                        eval "COMPREPLY=( \"\${COMPREPLY[@]/#/${flag}=}\" )"
+                    fi
+                fi
+            fi
+            return 0;
+            ;;
+    esac
+
+    # check if we are handling a flag with special work handling
+    local index
+    __%[1]s_index_of_word "${prev}" "${flags_with_completion[@]}"
+    if [[ ${index} -ge 0 ]]; then
+        ${flags_completion[${index}]}
+        return
+    fi
+
+    # we are parsing a flag and don't have a special handler, no completion
+    if [[ ${cur} != "${words[cword]}" ]]; then
+        return
+    fi
+
+    local completions
+    completions=("${commands[@]}")
+    if [[ ${#must_have_one_noun[@]} -ne 0 ]]; then
+        completions=("${must_have_one_noun[@]}")
+    fi
+    if [[ ${#must_have_one_flag[@]} -ne 0 ]]; then
+        completions+=("${must_have_one_flag[@]}")
+    fi
+    COMPREPLY=( $(compgen -W "${completions[*]}" -- "$cur") )
+
+    if [[ ${#COMPREPLY[@]} -eq 0 && ${#noun_aliases[@]} -gt 0 && ${#must_have_one_noun[@]} -ne 0 ]]; then
+        COMPREPLY=( $(compgen -W "${noun_aliases[*]}" -- "$cur") )
+    fi
+
+    if [[ ${#COMPREPLY[@]} -eq 0 ]]; then
+		if declare -F __%[1]s_custom_func >/dev/null; then
+			# try command name qualified custom func
+			__%[1]s_custom_func
+		else
+			# otherwise fall back to unqualified for compatibility
+			declare -F __custom_func >/dev/null && __custom_func
+		fi
+    fi
+
+    # available in bash-completion >= 2, not always present on macOS
+    if declare -F __ltrim_colon_completions >/dev/null; then
+        __ltrim_colon_completions "$cur"
+    fi
+
+    # If there is only 1 completion and it is a flag with an = it will be completed
+    # but we don't want a space after the =
+    if [[ "${#COMPREPLY[@]}" -eq "1" ]] && [[ $(type -t compopt) = "builtin" ]] && [[ "${COMPREPLY[0]}" == --*= ]]; then
+       compopt -o nospace
+    fi
+}
+
+# The arguments should be in the form "ext1|ext2|extn"
+__%[1]s_handle_filename_extension_flag()
+{
+    local ext="$1"
+    _filedir "@(${ext})"
+}
+
+__%[1]s_handle_subdirs_in_dir_flag()
+{
+    local dir="$1"
+    pushd "${dir}" >/dev/null 2>&1 && _filedir -d && popd >/dev/null 2>&1
+}
+
+__%[1]s_handle_flag()
+{
+    __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}"
+
+    # if a command required a flag, and we found it, unset must_have_one_flag()
+    local flagname=${words[c]}
+    local flagvalue
+    # if the word contained an =
+    if [[ ${words[c]} == *"="* ]]; then
+        flagvalue=${flagname#*=} # take in as flagvalue after the =
+        flagname=${flagname%%=*} # strip everything after the =
+        flagname="${flagname}=" # but put the = back
+    fi
+    __%[1]s_debug "${FUNCNAME[0]}: looking for ${flagname}"
+    if __%[1]s_contains_word "${flagname}" "${must_have_one_flag[@]}"; then
+        must_have_one_flag=()
+    fi
+
+    # if you set a flag which only applies to this command, don't show subcommands
+    if __%[1]s_contains_word "${flagname}" "${local_nonpersistent_flags[@]}"; then
+      commands=()
+    fi
+
+    # keep flag value with flagname as flaghash
+    # flaghash variable is an associative array which is only supported in bash > 3.
+    if [[ -z "${BASH_VERSION}" || "${BASH_VERSINFO[0]}" -gt 3 ]]; then
+        if [ -n "${flagvalue}" ] ; then
+            flaghash[${flagname}]=${flagvalue}
+        elif [ -n "${words[ $((c+1)) ]}" ] ; then
+            flaghash[${flagname}]=${words[ $((c+1)) ]}
+        else
+            flaghash[${flagname}]="true" # pad "true" for bool flag
+        fi
+    fi
+
+    # skip the argument to a two word flag
+    if [[ ${words[c]} != *"="* ]] && __%[1]s_contains_word "${words[c]}" "${two_word_flags[@]}"; then
+			  __%[1]s_debug "${FUNCNAME[0]}: found a flag ${words[c]}, skip the next argument"
+        c=$((c+1))
+        # if we are looking for a flags value, don't show commands
+        if [[ $c -eq $cword ]]; then
+            commands=()
+        fi
+    fi
+
+    c=$((c+1))
+
+}
+
+__%[1]s_handle_noun()
+{
+    __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}"
+
+    if __%[1]s_contains_word "${words[c]}" "${must_have_one_noun[@]}"; then
+        must_have_one_noun=()
+    elif __%[1]s_contains_word "${words[c]}" "${noun_aliases[@]}"; then
+        must_have_one_noun=()
+    fi
+
+    nouns+=("${words[c]}")
+    c=$((c+1))
+}
+
+__%[1]s_handle_command()
+{
+    __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}"
+
+    local next_command
+    if [[ -n ${last_command} ]]; then
+        next_command="_${last_command}_${words[c]//:/__}"
+    else
+        if [[ $c -eq 0 ]]; then
+            next_command="_%[1]s_root_command"
+        else
+            next_command="_${words[c]//:/__}"
+        fi
+    fi
+    c=$((c+1))
+    __%[1]s_debug "${FUNCNAME[0]}: looking for ${next_command}"
+    declare -F "$next_command" >/dev/null && $next_command
+}
+
+__%[1]s_handle_word()
+{
+    if [[ $c -ge $cword ]]; then
+        __%[1]s_handle_reply
+        return
+    fi
+    __%[1]s_debug "${FUNCNAME[0]}: c is $c words[c] is ${words[c]}"
+    if [[ "${words[c]}" == -* ]]; then
+        __%[1]s_handle_flag
+    elif __%[1]s_contains_word "${words[c]}" "${commands[@]}"; then
+        __%[1]s_handle_command
+    elif [[ $c -eq 0 ]]; then
+        __%[1]s_handle_command
+    elif __%[1]s_contains_word "${words[c]}" "${command_aliases[@]}"; then
+        # aliashash variable is an associative array which is only supported in bash > 3.
+        if [[ -z "${BASH_VERSION}" || "${BASH_VERSINFO[0]}" -gt 3 ]]; then
+            words[c]=${aliashash[${words[c]}]}
+            __%[1]s_handle_command
+        else
+            __%[1]s_handle_noun
+        fi
+    else
+        __%[1]s_handle_noun
+    fi
+    __%[1]s_handle_word
+}
+
+`, name))
+}
+
+func writePostscript(buf *bytes.Buffer, name string) {
+	name = strings.Replace(name, ":", "__", -1)
+	buf.WriteString(fmt.Sprintf("__start_%s()\n", name))
+	buf.WriteString(fmt.Sprintf(`{
+    local cur prev words cword
+    declare -A flaghash 2>/dev/null || :
+    declare -A aliashash 2>/dev/null || :
+    if declare -F _init_completion >/dev/null 2>&1; then
+        _init_completion -s || return
+    else
+        __%[1]s_init_completion -n "=" || return
+    fi
+
+    local c=0
+    local flags=()
+    local two_word_flags=()
+    local local_nonpersistent_flags=()
+    local flags_with_completion=()
+    local flags_completion=()
+    local commands=("%[1]s")
+    local must_have_one_flag=()
+    local must_have_one_noun=()
+    local last_command
+    local nouns=()
+
+    __%[1]s_handle_word
+}
+
+`, name))
+	buf.WriteString(fmt.Sprintf(`if [[ $(type -t compopt) = "builtin" ]]; then
+    complete -o default -F __start_%s %s
+else
+    complete -o default -o nospace -F __start_%s %s
+fi
+
+`, name, name, name, name))
+	buf.WriteString("# ex: ts=4 sw=4 et filetype=sh\n")
+}
+
+func writeCommands(buf *bytes.Buffer, cmd *Command) {
+	buf.WriteString("    commands=()\n")
+	for _, c := range cmd.Commands() {
+		if !c.IsAvailableCommand() || c == cmd.helpCommand {
+			continue
+		}
+		buf.WriteString(fmt.Sprintf("    commands+=(%q)\n", c.Name()))
+		writeCmdAliases(buf, c)
+	}
+	buf.WriteString("\n")
+}
+
+func writeFlagHandler(buf *bytes.Buffer, name string, annotations map[string][]string, cmd *Command) {
+	for key, value := range annotations {
+		switch key {
+		case BashCompFilenameExt:
+			buf.WriteString(fmt.Sprintf("    flags_with_completion+=(%q)\n", name))
+
+			var ext string
+			if len(value) > 0 {
+				ext = fmt.Sprintf("__%s_handle_filename_extension_flag ", cmd.Root().Name()) + strings.Join(value, "|")
+			} else {
+				ext = "_filedir"
+			}
+			buf.WriteString(fmt.Sprintf("    flags_completion+=(%q)\n", ext))
+		case BashCompCustom:
+			buf.WriteString(fmt.Sprintf("    flags_with_completion+=(%q)\n", name))
+			if len(value) > 0 {
+				handlers := strings.Join(value, "; ")
+				buf.WriteString(fmt.Sprintf("    flags_completion+=(%q)\n", handlers))
+			} else {
+				buf.WriteString("    flags_completion+=(:)\n")
+			}
+		case BashCompSubdirsInDir:
+			buf.WriteString(fmt.Sprintf("    flags_with_completion+=(%q)\n", name))
+
+			var ext string
+			if len(value) == 1 {
+				ext = fmt.Sprintf("__%s_handle_subdirs_in_dir_flag ", cmd.Root().Name()) + value[0]
+			} else {
+				ext = "_filedir -d"
+			}
+			buf.WriteString(fmt.Sprintf("    flags_completion+=(%q)\n", ext))
+		}
+	}
+}
+
+func writeShortFlag(buf *bytes.Buffer, flag *pflag.Flag, cmd *Command) {
+	name := flag.Shorthand
+	format := "    "
+	if len(flag.NoOptDefVal) == 0 {
+		format += "two_word_"
+	}
+	format += "flags+=(\"-%s\")\n"
+	buf.WriteString(fmt.Sprintf(format, name))
+	writeFlagHandler(buf, "-"+name, flag.Annotations, cmd)
+}
+
+func writeFlag(buf *bytes.Buffer, flag *pflag.Flag, cmd *Command) {
+	name := flag.Name
+	format := "    flags+=(\"--%s"
+	if len(flag.NoOptDefVal) == 0 {
+		format += "="
+	}
+	format += "\")\n"
+	buf.WriteString(fmt.Sprintf(format, name))
+	if len(flag.NoOptDefVal) == 0 {
+		format = "    two_word_flags+=(\"--%s\")\n"
+		buf.WriteString(fmt.Sprintf(format, name))
+	}
+	writeFlagHandler(buf, "--"+name, flag.Annotations, cmd)
+}
+
+func writeLocalNonPersistentFlag(buf *bytes.Buffer, flag *pflag.Flag) {
+	name := flag.Name
+	format := "    local_nonpersistent_flags+=(\"--%s"
+	if len(flag.NoOptDefVal) == 0 {
+		format += "="
+	}
+	format += "\")\n"
+	buf.WriteString(fmt.Sprintf(format, name))
+}
+
+func writeFlags(buf *bytes.Buffer, cmd *Command) {
+	buf.WriteString(`    flags=()
+    two_word_flags=()
+    local_nonpersistent_flags=()
+    flags_with_completion=()
+    flags_completion=()
+
+`)
+	localNonPersistentFlags := cmd.LocalNonPersistentFlags()
+	cmd.NonInheritedFlags().VisitAll(func(flag *pflag.Flag) {
+		if nonCompletableFlag(flag) {
+			return
+		}
+		writeFlag(buf, flag, cmd)
+		if len(flag.Shorthand) > 0 {
+			writeShortFlag(buf, flag, cmd)
+		}
+		if localNonPersistentFlags.Lookup(flag.Name) != nil {
+			writeLocalNonPersistentFlag(buf, flag)
+		}
+	})
+	cmd.InheritedFlags().VisitAll(func(flag *pflag.Flag) {
+		if nonCompletableFlag(flag) {
+			return
+		}
+		writeFlag(buf, flag, cmd)
+		if len(flag.Shorthand) > 0 {
+			writeShortFlag(buf, flag, cmd)
+		}
+	})
+
+	buf.WriteString("\n")
+}
+
+func writeRequiredFlag(buf *bytes.Buffer, cmd *Command) {
+	buf.WriteString("    must_have_one_flag=()\n")
+	flags := cmd.NonInheritedFlags()
+	flags.VisitAll(func(flag *pflag.Flag) {
+		if nonCompletableFlag(flag) {
+			return
+		}
+		for key := range flag.Annotations {
+			switch key {
+			case BashCompOneRequiredFlag:
+				format := "    must_have_one_flag+=(\"--%s"
+				if flag.Value.Type() != "bool" {
+					format += "="
+				}
+				format += "\")\n"
+				buf.WriteString(fmt.Sprintf(format, flag.Name))
+
+				if len(flag.Shorthand) > 0 {
+					buf.WriteString(fmt.Sprintf("    must_have_one_flag+=(\"-%s\")\n", flag.Shorthand))
+				}
+			}
+		}
+	})
+}
+
+func writeRequiredNouns(buf *bytes.Buffer, cmd *Command) {
+	buf.WriteString("    must_have_one_noun=()\n")
+	sort.Sort(sort.StringSlice(cmd.ValidArgs))
+	for _, value := range cmd.ValidArgs {
+		buf.WriteString(fmt.Sprintf("    must_have_one_noun+=(%q)\n", value))
+	}
+}
+
+func writeCmdAliases(buf *bytes.Buffer, cmd *Command) {
+	if len(cmd.Aliases) == 0 {
+		return
+	}
+
+	sort.Sort(sort.StringSlice(cmd.Aliases))
+
+	buf.WriteString(fmt.Sprint(`    if [[ -z "${BASH_VERSION}" || "${BASH_VERSINFO[0]}" -gt 3 ]]; then`, "\n"))
+	for _, value := range cmd.Aliases {
+		buf.WriteString(fmt.Sprintf("        command_aliases+=(%q)\n", value))
+		buf.WriteString(fmt.Sprintf("        aliashash[%q]=%q\n", value, cmd.Name()))
+	}
+	buf.WriteString(`    fi`)
+	buf.WriteString("\n")
+}
+func writeArgAliases(buf *bytes.Buffer, cmd *Command) {
+	buf.WriteString("    noun_aliases=()\n")
+	sort.Sort(sort.StringSlice(cmd.ArgAliases))
+	for _, value := range cmd.ArgAliases {
+		buf.WriteString(fmt.Sprintf("    noun_aliases+=(%q)\n", value))
+	}
+}
+
+func gen(buf *bytes.Buffer, cmd *Command) {
+	for _, c := range cmd.Commands() {
+		if !c.IsAvailableCommand() || c == cmd.helpCommand {
+			continue
+		}
+		gen(buf, c)
+	}
+	commandName := cmd.CommandPath()
+	commandName = strings.Replace(commandName, " ", "_", -1)
+	commandName = strings.Replace(commandName, ":", "__", -1)
+
+	if cmd.Root() == cmd {
+		buf.WriteString(fmt.Sprintf("_%s_root_command()\n{\n", commandName))
+	} else {
+		buf.WriteString(fmt.Sprintf("_%s()\n{\n", commandName))
+	}
+
+	buf.WriteString(fmt.Sprintf("    last_command=%q\n", commandName))
+	buf.WriteString("\n")
+	buf.WriteString("    command_aliases=()\n")
+	buf.WriteString("\n")
+
+	writeCommands(buf, cmd)
+	writeFlags(buf, cmd)
+	writeRequiredFlag(buf, cmd)
+	writeRequiredNouns(buf, cmd)
+	writeArgAliases(buf, cmd)
+	buf.WriteString("}\n\n")
+}
+
+// GenBashCompletion generates bash completion file and writes to the passed writer.
+func (c *Command) GenBashCompletion(w io.Writer) error {
+	buf := new(bytes.Buffer)
+	writePreamble(buf, c.Name())
+	if len(c.BashCompletionFunction) > 0 {
+		buf.WriteString(c.BashCompletionFunction + "\n")
+	}
+	gen(buf, c)
+	writePostscript(buf, c.Name())
+
+	_, err := buf.WriteTo(w)
+	return err
+}
+
+func nonCompletableFlag(flag *pflag.Flag) bool {
+	return flag.Hidden || len(flag.Deprecated) > 0
+}
+
+// GenBashCompletionFile generates bash completion file.
+func (c *Command) GenBashCompletionFile(filename string) error {
+	outFile, err := os.Create(filename)
+	if err != nil {
+		return err
+	}
+	defer outFile.Close()
+
+	return c.GenBashCompletion(outFile)
+}
diff --git a/vendor/github.com/spf13/cobra/bash_completions.md b/vendor/github.com/spf13/cobra/bash_completions.md
new file mode 100644
index 0000000..4ac61ee
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/bash_completions.md
@@ -0,0 +1,256 @@
+# Generating Bash Completions For Your Own cobra.Command
+
+If you are using the generator you can create a completion command by running
+
+```bash
+cobra add completion
+```
+
+Update the help text show how to install the bash_completion Linux show here [Kubectl docs show mac options](https://kubernetes.io/docs/tasks/tools/install-kubectl/#enabling-shell-autocompletion)
+
+Writing the shell script to stdout allows the most flexible use.
+
+```go
+// completionCmd represents the completion command
+var completionCmd = &cobra.Command{
+	Use:   "completion",
+	Short: "Generates bash completion scripts",
+	Long: `To load completion run
+
+. <(bitbucket completion)
+
+To configure your bash shell to load completions for each session add to your bashrc
+
+# ~/.bashrc or ~/.profile
+. <(bitbucket completion)
+`,
+	Run: func(cmd *cobra.Command, args []string) {
+		rootCmd.GenBashCompletion(os.Stdout);
+	},
+}
+```
+
+**Note:** The cobra generator may include messages printed to stdout for example if the config file is loaded, this will break the auto complete script
+
+
+## Example from kubectl
+
+Generating bash completions from a cobra command is incredibly easy. An actual program which does so for the kubernetes kubectl binary is as follows:
+
+```go
+package main
+
+import (
+	"io/ioutil"
+	"os"
+
+	"k8s.io/kubernetes/pkg/kubectl/cmd"
+	"k8s.io/kubernetes/pkg/kubectl/cmd/util"
+)
+
+func main() {
+	kubectl := cmd.NewKubectlCommand(util.NewFactory(nil), os.Stdin, ioutil.Discard, ioutil.Discard)
+	kubectl.GenBashCompletionFile("out.sh")
+}
+```
+
+`out.sh` will get you completions of subcommands and flags. Copy it to `/etc/bash_completion.d/` as described [here](https://debian-administration.org/article/316/An_introduction_to_bash_completion_part_1) and reset your terminal to use autocompletion. If you make additional annotations to your code, you can get even more intelligent and flexible behavior.
+
+## Creating your own custom functions
+
+Some more actual code that works in kubernetes:
+
+```bash
+const (
+        bash_completion_func = `__kubectl_parse_get()
+{
+    local kubectl_output out
+    if kubectl_output=$(kubectl get --no-headers "$1" 2>/dev/null); then
+        out=($(echo "${kubectl_output}" | awk '{print $1}'))
+        COMPREPLY=( $( compgen -W "${out[*]}" -- "$cur" ) )
+    fi
+}
+
+__kubectl_get_resource()
+{
+    if [[ ${#nouns[@]} -eq 0 ]]; then
+        return 1
+    fi
+    __kubectl_parse_get ${nouns[${#nouns[@]} -1]}
+    if [[ $? -eq 0 ]]; then
+        return 0
+    fi
+}
+
+__kubectl_custom_func() {
+    case ${last_command} in
+        kubectl_get | kubectl_describe | kubectl_delete | kubectl_stop)
+            __kubectl_get_resource
+            return
+            ;;
+        *)
+            ;;
+    esac
+}
+`)
+```
+
+And then I set that in my command definition:
+
+```go
+cmds := &cobra.Command{
+	Use:   "kubectl",
+	Short: "kubectl controls the Kubernetes cluster manager",
+	Long: `kubectl controls the Kubernetes cluster manager.
+
+Find more information at https://github.com/GoogleCloudPlatform/kubernetes.`,
+	Run: runHelp,
+	BashCompletionFunction: bash_completion_func,
+}
+```
+
+The `BashCompletionFunction` option is really only valid/useful on the root command. Doing the above will cause `__kubectl_custom_func()` (`__<command-use>_custom_func()`) to be called when the built in processor was unable to find a solution. In the case of kubernetes a valid command might look something like `kubectl get pod [mypod]`. If you type `kubectl get pod [tab][tab]` the `__kubectl_customc_func()` will run because the cobra.Command only understood "kubectl" and "get." `__kubectl_custom_func()` will see that the cobra.Command is "kubectl_get" and will thus call another helper `__kubectl_get_resource()`.  `__kubectl_get_resource` will look at the 'nouns' collected. In our example the only noun will be `pod`.  So it will call `__kubectl_parse_get pod`.  `__kubectl_parse_get` will actually call out to kubernetes and get any pods.  It will then set `COMPREPLY` to valid pods!
+
+## Have the completions code complete your 'nouns'
+
+In the above example "pod" was assumed to already be typed. But if you want `kubectl get [tab][tab]` to show a list of valid "nouns" you have to set them. Simplified code from `kubectl get` looks like:
+
+```go
+validArgs []string = { "pod", "node", "service", "replicationcontroller" }
+
+cmd := &cobra.Command{
+	Use:     "get [(-o|--output=)json|yaml|template|...] (RESOURCE [NAME] | RESOURCE/NAME ...)",
+	Short:   "Display one or many resources",
+	Long:    get_long,
+	Example: get_example,
+	Run: func(cmd *cobra.Command, args []string) {
+		err := RunGet(f, out, cmd, args)
+		util.CheckErr(err)
+	},
+	ValidArgs: validArgs,
+}
+```
+
+Notice we put the "ValidArgs" on the "get" subcommand. Doing so will give results like
+
+```bash
+# kubectl get [tab][tab]
+node                 pod                    replicationcontroller  service
+```
+
+## Plural form and shortcuts for nouns
+
+If your nouns have a number of aliases, you can define them alongside `ValidArgs` using `ArgAliases`:
+
+```go
+argAliases []string = { "pods", "nodes", "services", "svc", "replicationcontrollers", "rc" }
+
+cmd := &cobra.Command{
+    ...
+	ValidArgs:  validArgs,
+	ArgAliases: argAliases
+}
+```
+
+The aliases are not shown to the user on tab completion, but they are accepted as valid nouns by
+the completion algorithm if entered manually, e.g. in:
+
+```bash
+# kubectl get rc [tab][tab]
+backend        frontend       database 
+```
+
+Note that without declaring `rc` as an alias, the completion algorithm would show the list of nouns
+in this example again instead of the replication controllers.
+
+## Mark flags as required
+
+Most of the time completions will only show subcommands. But if a flag is required to make a subcommand work, you probably want it to show up when the user types [tab][tab].  Marking a flag as 'Required' is incredibly easy.
+
+```go
+cmd.MarkFlagRequired("pod")
+cmd.MarkFlagRequired("container")
+```
+
+and you'll get something like
+
+```bash
+# kubectl exec [tab][tab][tab]
+-c            --container=  -p            --pod=  
+```
+
+# Specify valid filename extensions for flags that take a filename
+
+In this example we use --filename= and expect to get a json or yaml file as the argument. To make this easier we annotate the --filename flag with valid filename extensions.
+
+```go
+	annotations := []string{"json", "yaml", "yml"}
+	annotation := make(map[string][]string)
+	annotation[cobra.BashCompFilenameExt] = annotations
+
+	flag := &pflag.Flag{
+		Name:        "filename",
+		Shorthand:   "f",
+		Usage:       usage,
+		Value:       value,
+		DefValue:    value.String(),
+		Annotations: annotation,
+	}
+	cmd.Flags().AddFlag(flag)
+```
+
+Now when you run a command with this filename flag you'll get something like
+
+```bash
+# kubectl create -f 
+test/                         example/                      rpmbuild/
+hello.yml                     test.json
+```
+
+So while there are many other files in the CWD it only shows me subdirs and those with valid extensions.
+
+# Specify custom flag completion
+
+Similar to the filename completion and filtering using cobra.BashCompFilenameExt, you can specify
+a custom flag completion function with cobra.BashCompCustom:
+
+```go
+	annotation := make(map[string][]string)
+	annotation[cobra.BashCompCustom] = []string{"__kubectl_get_namespaces"}
+
+	flag := &pflag.Flag{
+		Name:        "namespace",
+		Usage:       usage,
+		Annotations: annotation,
+	}
+	cmd.Flags().AddFlag(flag)
+```
+
+In addition add the `__handle_namespace_flag` implementation in the `BashCompletionFunction`
+value, e.g.:
+
+```bash
+__kubectl_get_namespaces()
+{
+    local template
+    template="{{ range .items  }}{{ .metadata.name }} {{ end }}"
+    local kubectl_out
+    if kubectl_out=$(kubectl get -o template --template="${template}" namespace 2>/dev/null); then
+        COMPREPLY=( $( compgen -W "${kubectl_out}[*]" -- "$cur" ) )
+    fi
+}
+```
+# Using bash aliases for commands
+
+You can also configure the `bash aliases` for the commands and they will also support completions.
+
+```bash
+alias aliasname=origcommand
+complete -o default -F __start_origcommand aliasname
+
+# and now when you run `aliasname` completion will make
+# suggestions as it did for `origcommand`.
+
+$) aliasname <tab><tab>
+completion     firstcommand   secondcommand
+```
diff --git a/vendor/github.com/spf13/cobra/cobra.go b/vendor/github.com/spf13/cobra/cobra.go
new file mode 100644
index 0000000..6505c07
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/cobra.go
@@ -0,0 +1,207 @@
+// Copyright © 2013 Steve Francia <spf@spf13.com>.
+//
+// Licensed under the Apache License, Version 2.0 (the "License");
+// you may not use this file except in compliance with the License.
+// You may obtain a copy of the License at
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS,
+// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+// See the License for the specific language governing permissions and
+// limitations under the License.
+
+// Commands similar to git, go tools and other modern CLI tools
+// inspired by go, go-Commander, gh and subcommand
+
+package cobra
+
+import (
+	"fmt"
+	"io"
+	"reflect"
+	"strconv"
+	"strings"
+	"text/template"
+	"time"
+	"unicode"
+)
+
+var templateFuncs = template.FuncMap{
+	"trim":                    strings.TrimSpace,
+	"trimRightSpace":          trimRightSpace,
+	"trimTrailingWhitespaces": trimRightSpace,
+	"appendIfNotPresent":      appendIfNotPresent,
+	"rpad":                    rpad,
+	"gt":                      Gt,
+	"eq":                      Eq,
+}
+
+var initializers []func()
+
+// EnablePrefixMatching allows to set automatic prefix matching. Automatic prefix matching can be a dangerous thing
+// to automatically enable in CLI tools.
+// Set this to true to enable it.
+var EnablePrefixMatching = false
+
+// EnableCommandSorting controls sorting of the slice of commands, which is turned on by default.
+// To disable sorting, set it to false.
+var EnableCommandSorting = true
+
+// MousetrapHelpText enables an information splash screen on Windows
+// if the CLI is started from explorer.exe.
+// To disable the mousetrap, just set this variable to blank string ("").
+// Works only on Microsoft Windows.
+var MousetrapHelpText string = `This is a command line tool.
+
+You need to open cmd.exe and run it from there.
+`
+
+// MousetrapDisplayDuration controls how long the MousetrapHelpText message is displayed on Windows
+// if the CLI is started from explorer.exe. Set to 0 to wait for the return key to be pressed.
+// To disable the mousetrap, just set MousetrapHelpText to blank string ("").
+// Works only on Microsoft Windows.
+var MousetrapDisplayDuration time.Duration = 5 * time.Second
+
+// AddTemplateFunc adds a template function that's available to Usage and Help
+// template generation.
+func AddTemplateFunc(name string, tmplFunc interface{}) {
+	templateFuncs[name] = tmplFunc
+}
+
+// AddTemplateFuncs adds multiple template functions that are available to Usage and
+// Help template generation.
+func AddTemplateFuncs(tmplFuncs template.FuncMap) {
+	for k, v := range tmplFuncs {
+		templateFuncs[k] = v
+	}
+}
+
+// OnInitialize sets the passed functions to be run when each command's
+// Execute method is called.
+func OnInitialize(y ...func()) {
+	initializers = append(initializers, y...)
+}
+
+// FIXME Gt is unused by cobra and should be removed in a version 2. It exists only for compatibility with users of cobra.
+
+// Gt takes two types and checks whether the first type is greater than the second. In case of types Arrays, Chans,
+// Maps and Slices, Gt will compare their lengths. Ints are compared directly while strings are first parsed as
+// ints and then compared.
+func Gt(a interface{}, b interface{}) bool {
+	var left, right int64
+	av := reflect.ValueOf(a)
+
+	switch av.Kind() {
+	case reflect.Array, reflect.Chan, reflect.Map, reflect.Slice:
+		left = int64(av.Len())
+	case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+		left = av.Int()
+	case reflect.String:
+		left, _ = strconv.ParseInt(av.String(), 10, 64)
+	}
+
+	bv := reflect.ValueOf(b)
+
+	switch bv.Kind() {
+	case reflect.Array, reflect.Chan, reflect.Map, reflect.Slice:
+		right = int64(bv.Len())
+	case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+		right = bv.Int()
+	case reflect.String:
+		right, _ = strconv.ParseInt(bv.String(), 10, 64)
+	}
+
+	return left > right
+}
+
+// FIXME Eq is unused by cobra and should be removed in a version 2. It exists only for compatibility with users of cobra.
+
+// Eq takes two types and checks whether they are equal. Supported types are int and string. Unsupported types will panic.
+func Eq(a interface{}, b interface{}) bool {
+	av := reflect.ValueOf(a)
+	bv := reflect.ValueOf(b)
+
+	switch av.Kind() {
+	case reflect.Array, reflect.Chan, reflect.Map, reflect.Slice:
+		panic("Eq called on unsupported type")
+	case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+		return av.Int() == bv.Int()
+	case reflect.String:
+		return av.String() == bv.String()
+	}
+	return false
+}
+
+func trimRightSpace(s string) string {
+	return strings.TrimRightFunc(s, unicode.IsSpace)
+}
+
+// FIXME appendIfNotPresent is unused by cobra and should be removed in a version 2. It exists only for compatibility with users of cobra.
+
+// appendIfNotPresent will append stringToAppend to the end of s, but only if it's not yet present in s.
+func appendIfNotPresent(s, stringToAppend string) string {
+	if strings.Contains(s, stringToAppend) {
+		return s
+	}
+	return s + " " + stringToAppend
+}
+
+// rpad adds padding to the right of a string.
+func rpad(s string, padding int) string {
+	template := fmt.Sprintf("%%-%ds", padding)
+	return fmt.Sprintf(template, s)
+}
+
+// tmpl executes the given template text on data, writing the result to w.
+func tmpl(w io.Writer, text string, data interface{}) error {
+	t := template.New("top")
+	t.Funcs(templateFuncs)
+	template.Must(t.Parse(text))
+	return t.Execute(w, data)
+}
+
+// ld compares two strings and returns the levenshtein distance between them.
+func ld(s, t string, ignoreCase bool) int {
+	if ignoreCase {
+		s = strings.ToLower(s)
+		t = strings.ToLower(t)
+	}
+	d := make([][]int, len(s)+1)
+	for i := range d {
+		d[i] = make([]int, len(t)+1)
+	}
+	for i := range d {
+		d[i][0] = i
+	}
+	for j := range d[0] {
+		d[0][j] = j
+	}
+	for j := 1; j <= len(t); j++ {
+		for i := 1; i <= len(s); i++ {
+			if s[i-1] == t[j-1] {
+				d[i][j] = d[i-1][j-1]
+			} else {
+				min := d[i-1][j]
+				if d[i][j-1] < min {
+					min = d[i][j-1]
+				}
+				if d[i-1][j-1] < min {
+					min = d[i-1][j-1]
+				}
+				d[i][j] = min + 1
+			}
+		}
+
+	}
+	return d[len(s)][len(t)]
+}
+
+func stringInSlice(a string, list []string) bool {
+	for _, b := range list {
+		if b == a {
+			return true
+		}
+	}
+	return false
+}
diff --git a/vendor/github.com/spf13/cobra/command.go b/vendor/github.com/spf13/cobra/command.go
new file mode 100644
index 0000000..c7e8983
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/command.go
@@ -0,0 +1,1594 @@
+// Copyright © 2013 Steve Francia <spf@spf13.com>.
+//
+// Licensed under the Apache License, Version 2.0 (the "License");
+// you may not use this file except in compliance with the License.
+// You may obtain a copy of the License at
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS,
+// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+// See the License for the specific language governing permissions and
+// limitations under the License.
+
+// Package cobra is a commander providing a simple interface to create powerful modern CLI interfaces.
+// In addition to providing an interface, Cobra simultaneously provides a controller to organize your application code.
+package cobra
+
+import (
+	"bytes"
+	"fmt"
+	"io"
+	"os"
+	"path/filepath"
+	"sort"
+	"strings"
+
+	flag "github.com/spf13/pflag"
+)
+
+// FParseErrWhitelist configures Flag parse errors to be ignored
+type FParseErrWhitelist flag.ParseErrorsWhitelist
+
+// Command is just that, a command for your application.
+// E.g.  'go run ...' - 'run' is the command. Cobra requires
+// you to define the usage and description as part of your command
+// definition to ensure usability.
+type Command struct {
+	// Use is the one-line usage message.
+	Use string
+
+	// Aliases is an array of aliases that can be used instead of the first word in Use.
+	Aliases []string
+
+	// SuggestFor is an array of command names for which this command will be suggested -
+	// similar to aliases but only suggests.
+	SuggestFor []string
+
+	// Short is the short description shown in the 'help' output.
+	Short string
+
+	// Long is the long message shown in the 'help <this-command>' output.
+	Long string
+
+	// Example is examples of how to use the command.
+	Example string
+
+	// ValidArgs is list of all valid non-flag arguments that are accepted in bash completions
+	ValidArgs []string
+
+	// Expected arguments
+	Args PositionalArgs
+
+	// ArgAliases is List of aliases for ValidArgs.
+	// These are not suggested to the user in the bash completion,
+	// but accepted if entered manually.
+	ArgAliases []string
+
+	// BashCompletionFunction is custom functions used by the bash autocompletion generator.
+	BashCompletionFunction string
+
+	// Deprecated defines, if this command is deprecated and should print this string when used.
+	Deprecated string
+
+	// Hidden defines, if this command is hidden and should NOT show up in the list of available commands.
+	Hidden bool
+
+	// Annotations are key/value pairs that can be used by applications to identify or
+	// group commands.
+	Annotations map[string]string
+
+	// Version defines the version for this command. If this value is non-empty and the command does not
+	// define a "version" flag, a "version" boolean flag will be added to the command and, if specified,
+	// will print content of the "Version" variable.
+	Version string
+
+	// The *Run functions are executed in the following order:
+	//   * PersistentPreRun()
+	//   * PreRun()
+	//   * Run()
+	//   * PostRun()
+	//   * PersistentPostRun()
+	// All functions get the same args, the arguments after the command name.
+	//
+	// PersistentPreRun: children of this command will inherit and execute.
+	PersistentPreRun func(cmd *Command, args []string)
+	// PersistentPreRunE: PersistentPreRun but returns an error.
+	PersistentPreRunE func(cmd *Command, args []string) error
+	// PreRun: children of this command will not inherit.
+	PreRun func(cmd *Command, args []string)
+	// PreRunE: PreRun but returns an error.
+	PreRunE func(cmd *Command, args []string) error
+	// Run: Typically the actual work function. Most commands will only implement this.
+	Run func(cmd *Command, args []string)
+	// RunE: Run but returns an error.
+	RunE func(cmd *Command, args []string) error
+	// PostRun: run after the Run command.
+	PostRun func(cmd *Command, args []string)
+	// PostRunE: PostRun but returns an error.
+	PostRunE func(cmd *Command, args []string) error
+	// PersistentPostRun: children of this command will inherit and execute after PostRun.
+	PersistentPostRun func(cmd *Command, args []string)
+	// PersistentPostRunE: PersistentPostRun but returns an error.
+	PersistentPostRunE func(cmd *Command, args []string) error
+
+	// SilenceErrors is an option to quiet errors down stream.
+	SilenceErrors bool
+
+	// SilenceUsage is an option to silence usage when an error occurs.
+	SilenceUsage bool
+
+	// DisableFlagParsing disables the flag parsing.
+	// If this is true all flags will be passed to the command as arguments.
+	DisableFlagParsing bool
+
+	// DisableAutoGenTag defines, if gen tag ("Auto generated by spf13/cobra...")
+	// will be printed by generating docs for this command.
+	DisableAutoGenTag bool
+
+	// DisableFlagsInUseLine will disable the addition of [flags] to the usage
+	// line of a command when printing help or generating docs
+	DisableFlagsInUseLine bool
+
+	// DisableSuggestions disables the suggestions based on Levenshtein distance
+	// that go along with 'unknown command' messages.
+	DisableSuggestions bool
+	// SuggestionsMinimumDistance defines minimum levenshtein distance to display suggestions.
+	// Must be > 0.
+	SuggestionsMinimumDistance int
+
+	// TraverseChildren parses flags on all parents before executing child command.
+	TraverseChildren bool
+
+	//FParseErrWhitelist flag parse errors to be ignored
+	FParseErrWhitelist FParseErrWhitelist
+
+	// commands is the list of commands supported by this program.
+	commands []*Command
+	// parent is a parent command for this command.
+	parent *Command
+	// Max lengths of commands' string lengths for use in padding.
+	commandsMaxUseLen         int
+	commandsMaxCommandPathLen int
+	commandsMaxNameLen        int
+	// commandsAreSorted defines, if command slice are sorted or not.
+	commandsAreSorted bool
+	// commandCalledAs is the name or alias value used to call this command.
+	commandCalledAs struct {
+		name   string
+		called bool
+	}
+
+	// args is actual args parsed from flags.
+	args []string
+	// flagErrorBuf contains all error messages from pflag.
+	flagErrorBuf *bytes.Buffer
+	// flags is full set of flags.
+	flags *flag.FlagSet
+	// pflags contains persistent flags.
+	pflags *flag.FlagSet
+	// lflags contains local flags.
+	lflags *flag.FlagSet
+	// iflags contains inherited flags.
+	iflags *flag.FlagSet
+	// parentsPflags is all persistent flags of cmd's parents.
+	parentsPflags *flag.FlagSet
+	// globNormFunc is the global normalization function
+	// that we can use on every pflag set and children commands
+	globNormFunc func(f *flag.FlagSet, name string) flag.NormalizedName
+
+	// usageFunc is usage func defined by user.
+	usageFunc func(*Command) error
+	// usageTemplate is usage template defined by user.
+	usageTemplate string
+	// flagErrorFunc is func defined by user and it's called when the parsing of
+	// flags returns an error.
+	flagErrorFunc func(*Command, error) error
+	// helpTemplate is help template defined by user.
+	helpTemplate string
+	// helpFunc is help func defined by user.
+	helpFunc func(*Command, []string)
+	// helpCommand is command with usage 'help'. If it's not defined by user,
+	// cobra uses default help command.
+	helpCommand *Command
+	// versionTemplate is the version template defined by user.
+	versionTemplate string
+
+	// inReader is a reader defined by the user that replaces stdin
+	inReader io.Reader
+	// outWriter is a writer defined by the user that replaces stdout
+	outWriter io.Writer
+	// errWriter is a writer defined by the user that replaces stderr
+	errWriter io.Writer
+}
+
+// SetArgs sets arguments for the command. It is set to os.Args[1:] by default, if desired, can be overridden
+// particularly useful when testing.
+func (c *Command) SetArgs(a []string) {
+	c.args = a
+}
+
+// SetOutput sets the destination for usage and error messages.
+// If output is nil, os.Stderr is used.
+// Deprecated: Use SetOut and/or SetErr instead
+func (c *Command) SetOutput(output io.Writer) {
+	c.outWriter = output
+	c.errWriter = output
+}
+
+// SetOut sets the destination for usage messages.
+// If newOut is nil, os.Stdout is used.
+func (c *Command) SetOut(newOut io.Writer) {
+	c.outWriter = newOut
+}
+
+// SetErr sets the destination for error messages.
+// If newErr is nil, os.Stderr is used.
+func (c *Command) SetErr(newErr io.Writer) {
+	c.errWriter = newErr
+}
+
+// SetOut sets the source for input data
+// If newIn is nil, os.Stdin is used.
+func (c *Command) SetIn(newIn io.Reader) {
+	c.inReader = newIn
+}
+
+// SetUsageFunc sets usage function. Usage can be defined by application.
+func (c *Command) SetUsageFunc(f func(*Command) error) {
+	c.usageFunc = f
+}
+
+// SetUsageTemplate sets usage template. Can be defined by Application.
+func (c *Command) SetUsageTemplate(s string) {
+	c.usageTemplate = s
+}
+
+// SetFlagErrorFunc sets a function to generate an error when flag parsing
+// fails.
+func (c *Command) SetFlagErrorFunc(f func(*Command, error) error) {
+	c.flagErrorFunc = f
+}
+
+// SetHelpFunc sets help function. Can be defined by Application.
+func (c *Command) SetHelpFunc(f func(*Command, []string)) {
+	c.helpFunc = f
+}
+
+// SetHelpCommand sets help command.
+func (c *Command) SetHelpCommand(cmd *Command) {
+	c.helpCommand = cmd
+}
+
+// SetHelpTemplate sets help template to be used. Application can use it to set custom template.
+func (c *Command) SetHelpTemplate(s string) {
+	c.helpTemplate = s
+}
+
+// SetVersionTemplate sets version template to be used. Application can use it to set custom template.
+func (c *Command) SetVersionTemplate(s string) {
+	c.versionTemplate = s
+}
+
+// SetGlobalNormalizationFunc sets a normalization function to all flag sets and also to child commands.
+// The user should not have a cyclic dependency on commands.
+func (c *Command) SetGlobalNormalizationFunc(n func(f *flag.FlagSet, name string) flag.NormalizedName) {
+	c.Flags().SetNormalizeFunc(n)
+	c.PersistentFlags().SetNormalizeFunc(n)
+	c.globNormFunc = n
+
+	for _, command := range c.commands {
+		command.SetGlobalNormalizationFunc(n)
+	}
+}
+
+// OutOrStdout returns output to stdout.
+func (c *Command) OutOrStdout() io.Writer {
+	return c.getOut(os.Stdout)
+}
+
+// OutOrStderr returns output to stderr
+func (c *Command) OutOrStderr() io.Writer {
+	return c.getOut(os.Stderr)
+}
+
+// ErrOrStderr returns output to stderr
+func (c *Command) ErrOrStderr() io.Writer {
+	return c.getErr(os.Stderr)
+}
+
+// ErrOrStderr returns output to stderr
+func (c *Command) InOrStdin() io.Reader {
+	return c.getIn(os.Stdin)
+}
+
+func (c *Command) getOut(def io.Writer) io.Writer {
+	if c.outWriter != nil {
+		return c.outWriter
+	}
+	if c.HasParent() {
+		return c.parent.getOut(def)
+	}
+	return def
+}
+
+func (c *Command) getErr(def io.Writer) io.Writer {
+	if c.errWriter != nil {
+		return c.errWriter
+	}
+	if c.HasParent() {
+		return c.parent.getErr(def)
+	}
+	return def
+}
+
+func (c *Command) getIn(def io.Reader) io.Reader {
+	if c.inReader != nil {
+		return c.inReader
+	}
+	if c.HasParent() {
+		return c.parent.getIn(def)
+	}
+	return def
+}
+
+// UsageFunc returns either the function set by SetUsageFunc for this command
+// or a parent, or it returns a default usage function.
+func (c *Command) UsageFunc() (f func(*Command) error) {
+	if c.usageFunc != nil {
+		return c.usageFunc
+	}
+	if c.HasParent() {
+		return c.Parent().UsageFunc()
+	}
+	return func(c *Command) error {
+		c.mergePersistentFlags()
+		err := tmpl(c.OutOrStderr(), c.UsageTemplate(), c)
+		if err != nil {
+			c.Println(err)
+		}
+		return err
+	}
+}
+
+// Usage puts out the usage for the command.
+// Used when a user provides invalid input.
+// Can be defined by user by overriding UsageFunc.
+func (c *Command) Usage() error {
+	return c.UsageFunc()(c)
+}
+
+// HelpFunc returns either the function set by SetHelpFunc for this command
+// or a parent, or it returns a function with default help behavior.
+func (c *Command) HelpFunc() func(*Command, []string) {
+	if c.helpFunc != nil {
+		return c.helpFunc
+	}
+	if c.HasParent() {
+		return c.Parent().HelpFunc()
+	}
+	return func(c *Command, a []string) {
+		c.mergePersistentFlags()
+		err := tmpl(c.OutOrStdout(), c.HelpTemplate(), c)
+		if err != nil {
+			c.Println(err)
+		}
+	}
+}
+
+// Help puts out the help for the command.
+// Used when a user calls help [command].
+// Can be defined by user by overriding HelpFunc.
+func (c *Command) Help() error {
+	c.HelpFunc()(c, []string{})
+	return nil
+}
+
+// UsageString returns usage string.
+func (c *Command) UsageString() string {
+	// Storing normal writers
+	tmpOutput := c.outWriter
+	tmpErr := c.errWriter
+
+	bb := new(bytes.Buffer)
+	c.outWriter = bb
+	c.errWriter = bb
+
+	c.Usage()
+
+	// Setting things back to normal
+	c.outWriter = tmpOutput
+	c.errWriter = tmpErr
+
+	return bb.String()
+}
+
+// FlagErrorFunc returns either the function set by SetFlagErrorFunc for this
+// command or a parent, or it returns a function which returns the original
+// error.
+func (c *Command) FlagErrorFunc() (f func(*Command, error) error) {
+	if c.flagErrorFunc != nil {
+		return c.flagErrorFunc
+	}
+
+	if c.HasParent() {
+		return c.parent.FlagErrorFunc()
+	}
+	return func(c *Command, err error) error {
+		return err
+	}
+}
+
+var minUsagePadding = 25
+
+// UsagePadding return padding for the usage.
+func (c *Command) UsagePadding() int {
+	if c.parent == nil || minUsagePadding > c.parent.commandsMaxUseLen {
+		return minUsagePadding
+	}
+	return c.parent.commandsMaxUseLen
+}
+
+var minCommandPathPadding = 11
+
+// CommandPathPadding return padding for the command path.
+func (c *Command) CommandPathPadding() int {
+	if c.parent == nil || minCommandPathPadding > c.parent.commandsMaxCommandPathLen {
+		return minCommandPathPadding
+	}
+	return c.parent.commandsMaxCommandPathLen
+}
+
+var minNamePadding = 11
+
+// NamePadding returns padding for the name.
+func (c *Command) NamePadding() int {
+	if c.parent == nil || minNamePadding > c.parent.commandsMaxNameLen {
+		return minNamePadding
+	}
+	return c.parent.commandsMaxNameLen
+}
+
+// UsageTemplate returns usage template for the command.
+func (c *Command) UsageTemplate() string {
+	if c.usageTemplate != "" {
+		return c.usageTemplate
+	}
+
+	if c.HasParent() {
+		return c.parent.UsageTemplate()
+	}
+	return `Usage:{{if .Runnable}}
+  {{.UseLine}}{{end}}{{if .HasAvailableSubCommands}}
+  {{.CommandPath}} [command]{{end}}{{if gt (len .Aliases) 0}}
+
+Aliases:
+  {{.NameAndAliases}}{{end}}{{if .HasExample}}
+
+Examples:
+{{.Example}}{{end}}{{if .HasAvailableSubCommands}}
+
+Available Commands:{{range .Commands}}{{if (or .IsAvailableCommand (eq .Name "help"))}}
+  {{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableLocalFlags}}
+
+Flags:
+{{.LocalFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasAvailableInheritedFlags}}
+
+Global Flags:
+{{.InheritedFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasHelpSubCommands}}
+
+Additional help topics:{{range .Commands}}{{if .IsAdditionalHelpTopicCommand}}
+  {{rpad .CommandPath .CommandPathPadding}} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableSubCommands}}
+
+Use "{{.CommandPath}} [command] --help" for more information about a command.{{end}}
+`
+}
+
+// HelpTemplate return help template for the command.
+func (c *Command) HelpTemplate() string {
+	if c.helpTemplate != "" {
+		return c.helpTemplate
+	}
+
+	if c.HasParent() {
+		return c.parent.HelpTemplate()
+	}
+	return `{{with (or .Long .Short)}}{{. | trimTrailingWhitespaces}}
+
+{{end}}{{if or .Runnable .HasSubCommands}}{{.UsageString}}{{end}}`
+}
+
+// VersionTemplate return version template for the command.
+func (c *Command) VersionTemplate() string {
+	if c.versionTemplate != "" {
+		return c.versionTemplate
+	}
+
+	if c.HasParent() {
+		return c.parent.VersionTemplate()
+	}
+	return `{{with .Name}}{{printf "%s " .}}{{end}}{{printf "version %s" .Version}}
+`
+}
+
+func hasNoOptDefVal(name string, fs *flag.FlagSet) bool {
+	flag := fs.Lookup(name)
+	if flag == nil {
+		return false
+	}
+	return flag.NoOptDefVal != ""
+}
+
+func shortHasNoOptDefVal(name string, fs *flag.FlagSet) bool {
+	if len(name) == 0 {
+		return false
+	}
+
+	flag := fs.ShorthandLookup(name[:1])
+	if flag == nil {
+		return false
+	}
+	return flag.NoOptDefVal != ""
+}
+
+func stripFlags(args []string, c *Command) []string {
+	if len(args) == 0 {
+		return args
+	}
+	c.mergePersistentFlags()
+
+	commands := []string{}
+	flags := c.Flags()
+
+Loop:
+	for len(args) > 0 {
+		s := args[0]
+		args = args[1:]
+		switch {
+		case s == "--":
+			// "--" terminates the flags
+			break Loop
+		case strings.HasPrefix(s, "--") && !strings.Contains(s, "=") && !hasNoOptDefVal(s[2:], flags):
+			// If '--flag arg' then
+			// delete arg from args.
+			fallthrough // (do the same as below)
+		case strings.HasPrefix(s, "-") && !strings.Contains(s, "=") && len(s) == 2 && !shortHasNoOptDefVal(s[1:], flags):
+			// If '-f arg' then
+			// delete 'arg' from args or break the loop if len(args) <= 1.
+			if len(args) <= 1 {
+				break Loop
+			} else {
+				args = args[1:]
+				continue
+			}
+		case s != "" && !strings.HasPrefix(s, "-"):
+			commands = append(commands, s)
+		}
+	}
+
+	return commands
+}
+
+// argsMinusFirstX removes only the first x from args.  Otherwise, commands that look like
+// openshift admin policy add-role-to-user admin my-user, lose the admin argument (arg[4]).
+func argsMinusFirstX(args []string, x string) []string {
+	for i, y := range args {
+		if x == y {
+			ret := []string{}
+			ret = append(ret, args[:i]...)
+			ret = append(ret, args[i+1:]...)
+			return ret
+		}
+	}
+	return args
+}
+
+func isFlagArg(arg string) bool {
+	return ((len(arg) >= 3 && arg[1] == '-') ||
+		(len(arg) >= 2 && arg[0] == '-' && arg[1] != '-'))
+}
+
+// Find the target command given the args and command tree
+// Meant to be run on the highest node. Only searches down.
+func (c *Command) Find(args []string) (*Command, []string, error) {
+	var innerfind func(*Command, []string) (*Command, []string)
+
+	innerfind = func(c *Command, innerArgs []string) (*Command, []string) {
+		argsWOflags := stripFlags(innerArgs, c)
+		if len(argsWOflags) == 0 {
+			return c, innerArgs
+		}
+		nextSubCmd := argsWOflags[0]
+
+		cmd := c.findNext(nextSubCmd)
+		if cmd != nil {
+			return innerfind(cmd, argsMinusFirstX(innerArgs, nextSubCmd))
+		}
+		return c, innerArgs
+	}
+
+	commandFound, a := innerfind(c, args)
+	if commandFound.Args == nil {
+		return commandFound, a, legacyArgs(commandFound, stripFlags(a, commandFound))
+	}
+	return commandFound, a, nil
+}
+
+func (c *Command) findSuggestions(arg string) string {
+	if c.DisableSuggestions {
+		return ""
+	}
+	if c.SuggestionsMinimumDistance <= 0 {
+		c.SuggestionsMinimumDistance = 2
+	}
+	suggestionsString := ""
+	if suggestions := c.SuggestionsFor(arg); len(suggestions) > 0 {
+		suggestionsString += "\n\nDid you mean this?\n"
+		for _, s := range suggestions {
+			suggestionsString += fmt.Sprintf("\t%v\n", s)
+		}
+	}
+	return suggestionsString
+}
+
+func (c *Command) findNext(next string) *Command {
+	matches := make([]*Command, 0)
+	for _, cmd := range c.commands {
+		if cmd.Name() == next || cmd.HasAlias(next) {
+			cmd.commandCalledAs.name = next
+			return cmd
+		}
+		if EnablePrefixMatching && cmd.hasNameOrAliasPrefix(next) {
+			matches = append(matches, cmd)
+		}
+	}
+
+	if len(matches) == 1 {
+		return matches[0]
+	}
+
+	return nil
+}
+
+// Traverse the command tree to find the command, and parse args for
+// each parent.
+func (c *Command) Traverse(args []string) (*Command, []string, error) {
+	flags := []string{}
+	inFlag := false
+
+	for i, arg := range args {
+		switch {
+		// A long flag with a space separated value
+		case strings.HasPrefix(arg, "--") && !strings.Contains(arg, "="):
+			// TODO: this isn't quite right, we should really check ahead for 'true' or 'false'
+			inFlag = !hasNoOptDefVal(arg[2:], c.Flags())
+			flags = append(flags, arg)
+			continue
+		// A short flag with a space separated value
+		case strings.HasPrefix(arg, "-") && !strings.Contains(arg, "=") && len(arg) == 2 && !shortHasNoOptDefVal(arg[1:], c.Flags()):
+			inFlag = true
+			flags = append(flags, arg)
+			continue
+		// The value for a flag
+		case inFlag:
+			inFlag = false
+			flags = append(flags, arg)
+			continue
+		// A flag without a value, or with an `=` separated value
+		case isFlagArg(arg):
+			flags = append(flags, arg)
+			continue
+		}
+
+		cmd := c.findNext(arg)
+		if cmd == nil {
+			return c, args, nil
+		}
+
+		if err := c.ParseFlags(flags); err != nil {
+			return nil, args, err
+		}
+		return cmd.Traverse(args[i+1:])
+	}
+	return c, args, nil
+}
+
+// SuggestionsFor provides suggestions for the typedName.
+func (c *Command) SuggestionsFor(typedName string) []string {
+	suggestions := []string{}
+	for _, cmd := range c.commands {
+		if cmd.IsAvailableCommand() {
+			levenshteinDistance := ld(typedName, cmd.Name(), true)
+			suggestByLevenshtein := levenshteinDistance <= c.SuggestionsMinimumDistance
+			suggestByPrefix := strings.HasPrefix(strings.ToLower(cmd.Name()), strings.ToLower(typedName))
+			if suggestByLevenshtein || suggestByPrefix {
+				suggestions = append(suggestions, cmd.Name())
+			}
+			for _, explicitSuggestion := range cmd.SuggestFor {
+				if strings.EqualFold(typedName, explicitSuggestion) {
+					suggestions = append(suggestions, cmd.Name())
+				}
+			}
+		}
+	}
+	return suggestions
+}
+
+// VisitParents visits all parents of the command and invokes fn on each parent.
+func (c *Command) VisitParents(fn func(*Command)) {
+	if c.HasParent() {
+		fn(c.Parent())
+		c.Parent().VisitParents(fn)
+	}
+}
+
+// Root finds root command.
+func (c *Command) Root() *Command {
+	if c.HasParent() {
+		return c.Parent().Root()
+	}
+	return c
+}
+
+// ArgsLenAtDash will return the length of c.Flags().Args at the moment
+// when a -- was found during args parsing.
+func (c *Command) ArgsLenAtDash() int {
+	return c.Flags().ArgsLenAtDash()
+}
+
+func (c *Command) execute(a []string) (err error) {
+	if c == nil {
+		return fmt.Errorf("Called Execute() on a nil Command")
+	}
+
+	if len(c.Deprecated) > 0 {
+		c.Printf("Command %q is deprecated, %s\n", c.Name(), c.Deprecated)
+	}
+
+	// initialize help and version flag at the last point possible to allow for user
+	// overriding
+	c.InitDefaultHelpFlag()
+	c.InitDefaultVersionFlag()
+
+	err = c.ParseFlags(a)
+	if err != nil {
+		return c.FlagErrorFunc()(c, err)
+	}
+
+	// If help is called, regardless of other flags, return we want help.
+	// Also say we need help if the command isn't runnable.
+	helpVal, err := c.Flags().GetBool("help")
+	if err != nil {
+		// should be impossible to get here as we always declare a help
+		// flag in InitDefaultHelpFlag()
+		c.Println("\"help\" flag declared as non-bool. Please correct your code")
+		return err
+	}
+
+	if helpVal {
+		return flag.ErrHelp
+	}
+
+	// for back-compat, only add version flag behavior if version is defined
+	if c.Version != "" {
+		versionVal, err := c.Flags().GetBool("version")
+		if err != nil {
+			c.Println("\"version\" flag declared as non-bool. Please correct your code")
+			return err
+		}
+		if versionVal {
+			err := tmpl(c.OutOrStdout(), c.VersionTemplate(), c)
+			if err != nil {
+				c.Println(err)
+			}
+			return err
+		}
+	}
+
+	if !c.Runnable() {
+		return flag.ErrHelp
+	}
+
+	c.preRun()
+
+	argWoFlags := c.Flags().Args()
+	if c.DisableFlagParsing {
+		argWoFlags = a
+	}
+
+	if err := c.ValidateArgs(argWoFlags); err != nil {
+		return err
+	}
+
+	for p := c; p != nil; p = p.Parent() {
+		if p.PersistentPreRunE != nil {
+			if err := p.PersistentPreRunE(c, argWoFlags); err != nil {
+				return err
+			}
+			break
+		} else if p.PersistentPreRun != nil {
+			p.PersistentPreRun(c, argWoFlags)
+			break
+		}
+	}
+	if c.PreRunE != nil {
+		if err := c.PreRunE(c, argWoFlags); err != nil {
+			return err
+		}
+	} else if c.PreRun != nil {
+		c.PreRun(c, argWoFlags)
+	}
+
+	if err := c.validateRequiredFlags(); err != nil {
+		return err
+	}
+	if c.RunE != nil {
+		if err := c.RunE(c, argWoFlags); err != nil {
+			return err
+		}
+	} else {
+		c.Run(c, argWoFlags)
+	}
+	if c.PostRunE != nil {
+		if err := c.PostRunE(c, argWoFlags); err != nil {
+			return err
+		}
+	} else if c.PostRun != nil {
+		c.PostRun(c, argWoFlags)
+	}
+	for p := c; p != nil; p = p.Parent() {
+		if p.PersistentPostRunE != nil {
+			if err := p.PersistentPostRunE(c, argWoFlags); err != nil {
+				return err
+			}
+			break
+		} else if p.PersistentPostRun != nil {
+			p.PersistentPostRun(c, argWoFlags)
+			break
+		}
+	}
+
+	return nil
+}
+
+func (c *Command) preRun() {
+	for _, x := range initializers {
+		x()
+	}
+}
+
+// Execute uses the args (os.Args[1:] by default)
+// and run through the command tree finding appropriate matches
+// for commands and then corresponding flags.
+func (c *Command) Execute() error {
+	_, err := c.ExecuteC()
+	return err
+}
+
+// ExecuteC executes the command.
+func (c *Command) ExecuteC() (cmd *Command, err error) {
+	// Regardless of what command execute is called on, run on Root only
+	if c.HasParent() {
+		return c.Root().ExecuteC()
+	}
+
+	// windows hook
+	if preExecHookFn != nil {
+		preExecHookFn(c)
+	}
+
+	// initialize help as the last point possible to allow for user
+	// overriding
+	c.InitDefaultHelpCmd()
+
+	args := c.args
+
+	// Workaround FAIL with "go test -v" or "cobra.test -test.v", see #155
+	if c.args == nil && filepath.Base(os.Args[0]) != "cobra.test" {
+		args = os.Args[1:]
+	}
+
+	var flags []string
+	if c.TraverseChildren {
+		cmd, flags, err = c.Traverse(args)
+	} else {
+		cmd, flags, err = c.Find(args)
+	}
+	if err != nil {
+		// If found parse to a subcommand and then failed, talk about the subcommand
+		if cmd != nil {
+			c = cmd
+		}
+		if !c.SilenceErrors {
+			c.Println("Error:", err.Error())
+			c.Printf("Run '%v --help' for usage.\n", c.CommandPath())
+		}
+		return c, err
+	}
+
+	cmd.commandCalledAs.called = true
+	if cmd.commandCalledAs.name == "" {
+		cmd.commandCalledAs.name = cmd.Name()
+	}
+
+	err = cmd.execute(flags)
+	if err != nil {
+		// Always show help if requested, even if SilenceErrors is in
+		// effect
+		if err == flag.ErrHelp {
+			cmd.HelpFunc()(cmd, args)
+			return cmd, nil
+		}
+
+		// If root command has SilentErrors flagged,
+		// all subcommands should respect it
+		if !cmd.SilenceErrors && !c.SilenceErrors {
+			c.Println("Error:", err.Error())
+		}
+
+		// If root command has SilentUsage flagged,
+		// all subcommands should respect it
+		if !cmd.SilenceUsage && !c.SilenceUsage {
+			c.Println(cmd.UsageString())
+		}
+	}
+	return cmd, err
+}
+
+func (c *Command) ValidateArgs(args []string) error {
+	if c.Args == nil {
+		return nil
+	}
+	return c.Args(c, args)
+}
+
+func (c *Command) validateRequiredFlags() error {
+	flags := c.Flags()
+	missingFlagNames := []string{}
+	flags.VisitAll(func(pflag *flag.Flag) {
+		requiredAnnotation, found := pflag.Annotations[BashCompOneRequiredFlag]
+		if !found {
+			return
+		}
+		if (requiredAnnotation[0] == "true") && !pflag.Changed {
+			missingFlagNames = append(missingFlagNames, pflag.Name)
+		}
+	})
+
+	if len(missingFlagNames) > 0 {
+		return fmt.Errorf(`required flag(s) "%s" not set`, strings.Join(missingFlagNames, `", "`))
+	}
+	return nil
+}
+
+// InitDefaultHelpFlag adds default help flag to c.
+// It is called automatically by executing the c or by calling help and usage.
+// If c already has help flag, it will do nothing.
+func (c *Command) InitDefaultHelpFlag() {
+	c.mergePersistentFlags()
+	if c.Flags().Lookup("help") == nil {
+		usage := "help for "
+		if c.Name() == "" {
+			usage += "this command"
+		} else {
+			usage += c.Name()
+		}
+		c.Flags().BoolP("help", "h", false, usage)
+	}
+}
+
+// InitDefaultVersionFlag adds default version flag to c.
+// It is called automatically by executing the c.
+// If c already has a version flag, it will do nothing.
+// If c.Version is empty, it will do nothing.
+func (c *Command) InitDefaultVersionFlag() {
+	if c.Version == "" {
+		return
+	}
+
+	c.mergePersistentFlags()
+	if c.Flags().Lookup("version") == nil {
+		usage := "version for "
+		if c.Name() == "" {
+			usage += "this command"
+		} else {
+			usage += c.Name()
+		}
+		c.Flags().Bool("version", false, usage)
+	}
+}
+
+// InitDefaultHelpCmd adds default help command to c.
+// It is called automatically by executing the c or by calling help and usage.
+// If c already has help command or c has no subcommands, it will do nothing.
+func (c *Command) InitDefaultHelpCmd() {
+	if !c.HasSubCommands() {
+		return
+	}
+
+	if c.helpCommand == nil {
+		c.helpCommand = &Command{
+			Use:   "help [command]",
+			Short: "Help about any command",
+			Long: `Help provides help for any command in the application.
+Simply type ` + c.Name() + ` help [path to command] for full details.`,
+
+			Run: func(c *Command, args []string) {
+				cmd, _, e := c.Root().Find(args)
+				if cmd == nil || e != nil {
+					c.Printf("Unknown help topic %#q\n", args)
+					c.Root().Usage()
+				} else {
+					cmd.InitDefaultHelpFlag() // make possible 'help' flag to be shown
+					cmd.Help()
+				}
+			},
+		}
+	}
+	c.RemoveCommand(c.helpCommand)
+	c.AddCommand(c.helpCommand)
+}
+
+// ResetCommands delete parent, subcommand and help command from c.
+func (c *Command) ResetCommands() {
+	c.parent = nil
+	c.commands = nil
+	c.helpCommand = nil
+	c.parentsPflags = nil
+}
+
+// Sorts commands by their names.
+type commandSorterByName []*Command
+
+func (c commandSorterByName) Len() int           { return len(c) }
+func (c commandSorterByName) Swap(i, j int)      { c[i], c[j] = c[j], c[i] }
+func (c commandSorterByName) Less(i, j int) bool { return c[i].Name() < c[j].Name() }
+
+// Commands returns a sorted slice of child commands.
+func (c *Command) Commands() []*Command {
+	// do not sort commands if it already sorted or sorting was disabled
+	if EnableCommandSorting && !c.commandsAreSorted {
+		sort.Sort(commandSorterByName(c.commands))
+		c.commandsAreSorted = true
+	}
+	return c.commands
+}
+
+// AddCommand adds one or more commands to this parent command.
+func (c *Command) AddCommand(cmds ...*Command) {
+	for i, x := range cmds {
+		if cmds[i] == c {
+			panic("Command can't be a child of itself")
+		}
+		cmds[i].parent = c
+		// update max lengths
+		usageLen := len(x.Use)
+		if usageLen > c.commandsMaxUseLen {
+			c.commandsMaxUseLen = usageLen
+		}
+		commandPathLen := len(x.CommandPath())
+		if commandPathLen > c.commandsMaxCommandPathLen {
+			c.commandsMaxCommandPathLen = commandPathLen
+		}
+		nameLen := len(x.Name())
+		if nameLen > c.commandsMaxNameLen {
+			c.commandsMaxNameLen = nameLen
+		}
+		// If global normalization function exists, update all children
+		if c.globNormFunc != nil {
+			x.SetGlobalNormalizationFunc(c.globNormFunc)
+		}
+		c.commands = append(c.commands, x)
+		c.commandsAreSorted = false
+	}
+}
+
+// RemoveCommand removes one or more commands from a parent command.
+func (c *Command) RemoveCommand(cmds ...*Command) {
+	commands := []*Command{}
+main:
+	for _, command := range c.commands {
+		for _, cmd := range cmds {
+			if command == cmd {
+				command.parent = nil
+				continue main
+			}
+		}
+		commands = append(commands, command)
+	}
+	c.commands = commands
+	// recompute all lengths
+	c.commandsMaxUseLen = 0
+	c.commandsMaxCommandPathLen = 0
+	c.commandsMaxNameLen = 0
+	for _, command := range c.commands {
+		usageLen := len(command.Use)
+		if usageLen > c.commandsMaxUseLen {
+			c.commandsMaxUseLen = usageLen
+		}
+		commandPathLen := len(command.CommandPath())
+		if commandPathLen > c.commandsMaxCommandPathLen {
+			c.commandsMaxCommandPathLen = commandPathLen
+		}
+		nameLen := len(command.Name())
+		if nameLen > c.commandsMaxNameLen {
+			c.commandsMaxNameLen = nameLen
+		}
+	}
+}
+
+// Print is a convenience method to Print to the defined output, fallback to Stderr if not set.
+func (c *Command) Print(i ...interface{}) {
+	fmt.Fprint(c.OutOrStderr(), i...)
+}
+
+// Println is a convenience method to Println to the defined output, fallback to Stderr if not set.
+func (c *Command) Println(i ...interface{}) {
+	c.Print(fmt.Sprintln(i...))
+}
+
+// Printf is a convenience method to Printf to the defined output, fallback to Stderr if not set.
+func (c *Command) Printf(format string, i ...interface{}) {
+	c.Print(fmt.Sprintf(format, i...))
+}
+
+// PrintErr is a convenience method to Print to the defined Err output, fallback to Stderr if not set.
+func (c *Command) PrintErr(i ...interface{}) {
+	fmt.Fprint(c.ErrOrStderr(), i...)
+}
+
+// PrintErrln is a convenience method to Println to the defined Err output, fallback to Stderr if not set.
+func (c *Command) PrintErrln(i ...interface{}) {
+	c.Print(fmt.Sprintln(i...))
+}
+
+// PrintErrf is a convenience method to Printf to the defined Err output, fallback to Stderr if not set.
+func (c *Command) PrintErrf(format string, i ...interface{}) {
+	c.Print(fmt.Sprintf(format, i...))
+}
+
+// CommandPath returns the full path to this command.
+func (c *Command) CommandPath() string {
+	if c.HasParent() {
+		return c.Parent().CommandPath() + " " + c.Name()
+	}
+	return c.Name()
+}
+
+// UseLine puts out the full usage for a given command (including parents).
+func (c *Command) UseLine() string {
+	var useline string
+	if c.HasParent() {
+		useline = c.parent.CommandPath() + " " + c.Use
+	} else {
+		useline = c.Use
+	}
+	if c.DisableFlagsInUseLine {
+		return useline
+	}
+	if c.HasAvailableFlags() && !strings.Contains(useline, "[flags]") {
+		useline += " [flags]"
+	}
+	return useline
+}
+
+// DebugFlags used to determine which flags have been assigned to which commands
+// and which persist.
+func (c *Command) DebugFlags() {
+	c.Println("DebugFlags called on", c.Name())
+	var debugflags func(*Command)
+
+	debugflags = func(x *Command) {
+		if x.HasFlags() || x.HasPersistentFlags() {
+			c.Println(x.Name())
+		}
+		if x.HasFlags() {
+			x.flags.VisitAll(func(f *flag.Flag) {
+				if x.HasPersistentFlags() && x.persistentFlag(f.Name) != nil {
+					c.Println("  -"+f.Shorthand+",", "--"+f.Name, "["+f.DefValue+"]", "", f.Value, "  [LP]")
+				} else {
+					c.Println("  -"+f.Shorthand+",", "--"+f.Name, "["+f.DefValue+"]", "", f.Value, "  [L]")
+				}
+			})
+		}
+		if x.HasPersistentFlags() {
+			x.pflags.VisitAll(func(f *flag.Flag) {
+				if x.HasFlags() {
+					if x.flags.Lookup(f.Name) == nil {
+						c.Println("  -"+f.Shorthand+",", "--"+f.Name, "["+f.DefValue+"]", "", f.Value, "  [P]")
+					}
+				} else {
+					c.Println("  -"+f.Shorthand+",", "--"+f.Name, "["+f.DefValue+"]", "", f.Value, "  [P]")
+				}
+			})
+		}
+		c.Println(x.flagErrorBuf)
+		if x.HasSubCommands() {
+			for _, y := range x.commands {
+				debugflags(y)
+			}
+		}
+	}
+
+	debugflags(c)
+}
+
+// Name returns the command's name: the first word in the use line.
+func (c *Command) Name() string {
+	name := c.Use
+	i := strings.Index(name, " ")
+	if i >= 0 {
+		name = name[:i]
+	}
+	return name
+}
+
+// HasAlias determines if a given string is an alias of the command.
+func (c *Command) HasAlias(s string) bool {
+	for _, a := range c.Aliases {
+		if a == s {
+			return true
+		}
+	}
+	return false
+}
+
+// CalledAs returns the command name or alias that was used to invoke
+// this command or an empty string if the command has not been called.
+func (c *Command) CalledAs() string {
+	if c.commandCalledAs.called {
+		return c.commandCalledAs.name
+	}
+	return ""
+}
+
+// hasNameOrAliasPrefix returns true if the Name or any of aliases start
+// with prefix
+func (c *Command) hasNameOrAliasPrefix(prefix string) bool {
+	if strings.HasPrefix(c.Name(), prefix) {
+		c.commandCalledAs.name = c.Name()
+		return true
+	}
+	for _, alias := range c.Aliases {
+		if strings.HasPrefix(alias, prefix) {
+			c.commandCalledAs.name = alias
+			return true
+		}
+	}
+	return false
+}
+
+// NameAndAliases returns a list of the command name and all aliases
+func (c *Command) NameAndAliases() string {
+	return strings.Join(append([]string{c.Name()}, c.Aliases...), ", ")
+}
+
+// HasExample determines if the command has example.
+func (c *Command) HasExample() bool {
+	return len(c.Example) > 0
+}
+
+// Runnable determines if the command is itself runnable.
+func (c *Command) Runnable() bool {
+	return c.Run != nil || c.RunE != nil
+}
+
+// HasSubCommands determines if the command has children commands.
+func (c *Command) HasSubCommands() bool {
+	return len(c.commands) > 0
+}
+
+// IsAvailableCommand determines if a command is available as a non-help command
+// (this includes all non deprecated/hidden commands).
+func (c *Command) IsAvailableCommand() bool {
+	if len(c.Deprecated) != 0 || c.Hidden {
+		return false
+	}
+
+	if c.HasParent() && c.Parent().helpCommand == c {
+		return false
+	}
+
+	if c.Runnable() || c.HasAvailableSubCommands() {
+		return true
+	}
+
+	return false
+}
+
+// IsAdditionalHelpTopicCommand determines if a command is an additional
+// help topic command; additional help topic command is determined by the
+// fact that it is NOT runnable/hidden/deprecated, and has no sub commands that
+// are runnable/hidden/deprecated.
+// Concrete example: https://github.com/spf13/cobra/issues/393#issuecomment-282741924.
+func (c *Command) IsAdditionalHelpTopicCommand() bool {
+	// if a command is runnable, deprecated, or hidden it is not a 'help' command
+	if c.Runnable() || len(c.Deprecated) != 0 || c.Hidden {
+		return false
+	}
+
+	// if any non-help sub commands are found, the command is not a 'help' command
+	for _, sub := range c.commands {
+		if !sub.IsAdditionalHelpTopicCommand() {
+			return false
+		}
+	}
+
+	// the command either has no sub commands, or no non-help sub commands
+	return true
+}
+
+// HasHelpSubCommands determines if a command has any available 'help' sub commands
+// that need to be shown in the usage/help default template under 'additional help
+// topics'.
+func (c *Command) HasHelpSubCommands() bool {
+	// return true on the first found available 'help' sub command
+	for _, sub := range c.commands {
+		if sub.IsAdditionalHelpTopicCommand() {
+			return true
+		}
+	}
+
+	// the command either has no sub commands, or no available 'help' sub commands
+	return false
+}
+
+// HasAvailableSubCommands determines if a command has available sub commands that
+// need to be shown in the usage/help default template under 'available commands'.
+func (c *Command) HasAvailableSubCommands() bool {
+	// return true on the first found available (non deprecated/help/hidden)
+	// sub command
+	for _, sub := range c.commands {
+		if sub.IsAvailableCommand() {
+			return true
+		}
+	}
+
+	// the command either has no sub commands, or no available (non deprecated/help/hidden)
+	// sub commands
+	return false
+}
+
+// HasParent determines if the command is a child command.
+func (c *Command) HasParent() bool {
+	return c.parent != nil
+}
+
+// GlobalNormalizationFunc returns the global normalization function or nil if it doesn't exist.
+func (c *Command) GlobalNormalizationFunc() func(f *flag.FlagSet, name string) flag.NormalizedName {
+	return c.globNormFunc
+}
+
+// Flags returns the complete FlagSet that applies
+// to this command (local and persistent declared here and by all parents).
+func (c *Command) Flags() *flag.FlagSet {
+	if c.flags == nil {
+		c.flags = flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+		if c.flagErrorBuf == nil {
+			c.flagErrorBuf = new(bytes.Buffer)
+		}
+		c.flags.SetOutput(c.flagErrorBuf)
+	}
+
+	return c.flags
+}
+
+// LocalNonPersistentFlags are flags specific to this command which will NOT persist to subcommands.
+func (c *Command) LocalNonPersistentFlags() *flag.FlagSet {
+	persistentFlags := c.PersistentFlags()
+
+	out := flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+	c.LocalFlags().VisitAll(func(f *flag.Flag) {
+		if persistentFlags.Lookup(f.Name) == nil {
+			out.AddFlag(f)
+		}
+	})
+	return out
+}
+
+// LocalFlags returns the local FlagSet specifically set in the current command.
+func (c *Command) LocalFlags() *flag.FlagSet {
+	c.mergePersistentFlags()
+
+	if c.lflags == nil {
+		c.lflags = flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+		if c.flagErrorBuf == nil {
+			c.flagErrorBuf = new(bytes.Buffer)
+		}
+		c.lflags.SetOutput(c.flagErrorBuf)
+	}
+	c.lflags.SortFlags = c.Flags().SortFlags
+	if c.globNormFunc != nil {
+		c.lflags.SetNormalizeFunc(c.globNormFunc)
+	}
+
+	addToLocal := func(f *flag.Flag) {
+		if c.lflags.Lookup(f.Name) == nil && c.parentsPflags.Lookup(f.Name) == nil {
+			c.lflags.AddFlag(f)
+		}
+	}
+	c.Flags().VisitAll(addToLocal)
+	c.PersistentFlags().VisitAll(addToLocal)
+	return c.lflags
+}
+
+// InheritedFlags returns all flags which were inherited from parent commands.
+func (c *Command) InheritedFlags() *flag.FlagSet {
+	c.mergePersistentFlags()
+
+	if c.iflags == nil {
+		c.iflags = flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+		if c.flagErrorBuf == nil {
+			c.flagErrorBuf = new(bytes.Buffer)
+		}
+		c.iflags.SetOutput(c.flagErrorBuf)
+	}
+
+	local := c.LocalFlags()
+	if c.globNormFunc != nil {
+		c.iflags.SetNormalizeFunc(c.globNormFunc)
+	}
+
+	c.parentsPflags.VisitAll(func(f *flag.Flag) {
+		if c.iflags.Lookup(f.Name) == nil && local.Lookup(f.Name) == nil {
+			c.iflags.AddFlag(f)
+		}
+	})
+	return c.iflags
+}
+
+// NonInheritedFlags returns all flags which were not inherited from parent commands.
+func (c *Command) NonInheritedFlags() *flag.FlagSet {
+	return c.LocalFlags()
+}
+
+// PersistentFlags returns the persistent FlagSet specifically set in the current command.
+func (c *Command) PersistentFlags() *flag.FlagSet {
+	if c.pflags == nil {
+		c.pflags = flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+		if c.flagErrorBuf == nil {
+			c.flagErrorBuf = new(bytes.Buffer)
+		}
+		c.pflags.SetOutput(c.flagErrorBuf)
+	}
+	return c.pflags
+}
+
+// ResetFlags deletes all flags from command.
+func (c *Command) ResetFlags() {
+	c.flagErrorBuf = new(bytes.Buffer)
+	c.flagErrorBuf.Reset()
+	c.flags = flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+	c.flags.SetOutput(c.flagErrorBuf)
+	c.pflags = flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+	c.pflags.SetOutput(c.flagErrorBuf)
+
+	c.lflags = nil
+	c.iflags = nil
+	c.parentsPflags = nil
+}
+
+// HasFlags checks if the command contains any flags (local plus persistent from the entire structure).
+func (c *Command) HasFlags() bool {
+	return c.Flags().HasFlags()
+}
+
+// HasPersistentFlags checks if the command contains persistent flags.
+func (c *Command) HasPersistentFlags() bool {
+	return c.PersistentFlags().HasFlags()
+}
+
+// HasLocalFlags checks if the command has flags specifically declared locally.
+func (c *Command) HasLocalFlags() bool {
+	return c.LocalFlags().HasFlags()
+}
+
+// HasInheritedFlags checks if the command has flags inherited from its parent command.
+func (c *Command) HasInheritedFlags() bool {
+	return c.InheritedFlags().HasFlags()
+}
+
+// HasAvailableFlags checks if the command contains any flags (local plus persistent from the entire
+// structure) which are not hidden or deprecated.
+func (c *Command) HasAvailableFlags() bool {
+	return c.Flags().HasAvailableFlags()
+}
+
+// HasAvailablePersistentFlags checks if the command contains persistent flags which are not hidden or deprecated.
+func (c *Command) HasAvailablePersistentFlags() bool {
+	return c.PersistentFlags().HasAvailableFlags()
+}
+
+// HasAvailableLocalFlags checks if the command has flags specifically declared locally which are not hidden
+// or deprecated.
+func (c *Command) HasAvailableLocalFlags() bool {
+	return c.LocalFlags().HasAvailableFlags()
+}
+
+// HasAvailableInheritedFlags checks if the command has flags inherited from its parent command which are
+// not hidden or deprecated.
+func (c *Command) HasAvailableInheritedFlags() bool {
+	return c.InheritedFlags().HasAvailableFlags()
+}
+
+// Flag climbs up the command tree looking for matching flag.
+func (c *Command) Flag(name string) (flag *flag.Flag) {
+	flag = c.Flags().Lookup(name)
+
+	if flag == nil {
+		flag = c.persistentFlag(name)
+	}
+
+	return
+}
+
+// Recursively find matching persistent flag.
+func (c *Command) persistentFlag(name string) (flag *flag.Flag) {
+	if c.HasPersistentFlags() {
+		flag = c.PersistentFlags().Lookup(name)
+	}
+
+	if flag == nil {
+		c.updateParentsPflags()
+		flag = c.parentsPflags.Lookup(name)
+	}
+	return
+}
+
+// ParseFlags parses persistent flag tree and local flags.
+func (c *Command) ParseFlags(args []string) error {
+	if c.DisableFlagParsing {
+		return nil
+	}
+
+	if c.flagErrorBuf == nil {
+		c.flagErrorBuf = new(bytes.Buffer)
+	}
+	beforeErrorBufLen := c.flagErrorBuf.Len()
+	c.mergePersistentFlags()
+
+	//do it here after merging all flags and just before parse
+	c.Flags().ParseErrorsWhitelist = flag.ParseErrorsWhitelist(c.FParseErrWhitelist)
+
+	err := c.Flags().Parse(args)
+	// Print warnings if they occurred (e.g. deprecated flag messages).
+	if c.flagErrorBuf.Len()-beforeErrorBufLen > 0 && err == nil {
+		c.Print(c.flagErrorBuf.String())
+	}
+
+	return err
+}
+
+// Parent returns a commands parent command.
+func (c *Command) Parent() *Command {
+	return c.parent
+}
+
+// mergePersistentFlags merges c.PersistentFlags() to c.Flags()
+// and adds missing persistent flags of all parents.
+func (c *Command) mergePersistentFlags() {
+	c.updateParentsPflags()
+	c.Flags().AddFlagSet(c.PersistentFlags())
+	c.Flags().AddFlagSet(c.parentsPflags)
+}
+
+// updateParentsPflags updates c.parentsPflags by adding
+// new persistent flags of all parents.
+// If c.parentsPflags == nil, it makes new.
+func (c *Command) updateParentsPflags() {
+	if c.parentsPflags == nil {
+		c.parentsPflags = flag.NewFlagSet(c.Name(), flag.ContinueOnError)
+		c.parentsPflags.SetOutput(c.flagErrorBuf)
+		c.parentsPflags.SortFlags = false
+	}
+
+	if c.globNormFunc != nil {
+		c.parentsPflags.SetNormalizeFunc(c.globNormFunc)
+	}
+
+	c.Root().PersistentFlags().AddFlagSet(flag.CommandLine)
+
+	c.VisitParents(func(parent *Command) {
+		c.parentsPflags.AddFlagSet(parent.PersistentFlags())
+	})
+}
diff --git a/vendor/github.com/spf13/cobra/command_notwin.go b/vendor/github.com/spf13/cobra/command_notwin.go
new file mode 100644
index 0000000..6159c1c
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/command_notwin.go
@@ -0,0 +1,5 @@
+// +build !windows
+
+package cobra
+
+var preExecHookFn func(*Command)
diff --git a/vendor/github.com/spf13/cobra/command_win.go b/vendor/github.com/spf13/cobra/command_win.go
new file mode 100644
index 0000000..8768b17
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/command_win.go
@@ -0,0 +1,26 @@
+// +build windows
+
+package cobra
+
+import (
+	"fmt"
+	"os"
+	"time"
+
+	"github.com/inconshreveable/mousetrap"
+)
+
+var preExecHookFn = preExecHook
+
+func preExecHook(c *Command) {
+	if MousetrapHelpText != "" && mousetrap.StartedByExplorer() {
+		c.Print(MousetrapHelpText)
+		if MousetrapDisplayDuration > 0 {
+			time.Sleep(MousetrapDisplayDuration)
+		} else {
+			c.Println("Press return to continue...")
+			fmt.Scanln()
+		}
+		os.Exit(1)
+	}
+}
diff --git a/vendor/github.com/spf13/cobra/go.mod b/vendor/github.com/spf13/cobra/go.mod
new file mode 100644
index 0000000..9a9eb65
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/go.mod
@@ -0,0 +1,13 @@
+module github.com/spf13/cobra
+
+go 1.12
+
+require (
+	github.com/BurntSushi/toml v0.3.1 // indirect
+	github.com/cpuguy83/go-md2man v1.0.10
+	github.com/inconshreveable/mousetrap v1.0.0
+	github.com/mitchellh/go-homedir v1.1.0
+	github.com/spf13/pflag v1.0.3
+	github.com/spf13/viper v1.3.2
+	gopkg.in/yaml.v2 v2.2.2
+)
diff --git a/vendor/github.com/spf13/cobra/go.sum b/vendor/github.com/spf13/cobra/go.sum
new file mode 100644
index 0000000..9761f4d
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/go.sum
@@ -0,0 +1,51 @@
+github.com/BurntSushi/toml v0.3.1 h1:WXkYYl6Yr3qBf1K79EBnL4mak0OimBfB0XUf9Vl28OQ=
+github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU=
+github.com/armon/consul-api v0.0.0-20180202201655-eb2c6b5be1b6/go.mod h1:grANhF5doyWs3UAsr3K4I6qtAmlQcZDesFNEHPZAzj8=
+github.com/coreos/etcd v3.3.10+incompatible/go.mod h1:uF7uidLiAD3TWHmW31ZFd/JWoc32PjwdhPthX9715RE=
+github.com/coreos/go-etcd v2.0.0+incompatible/go.mod h1:Jez6KQU2B/sWsbdaef3ED8NzMklzPG4d5KIOhIy30Tk=
+github.com/coreos/go-semver v0.2.0/go.mod h1:nnelYz7RCh+5ahJtPPxZlU+153eP4D4r3EedlOD2RNk=
+github.com/cpuguy83/go-md2man v1.0.10 h1:BSKMNlYxDvnunlTymqtgONjNnaRV1sTpcovwwjF22jk=
+github.com/cpuguy83/go-md2man v1.0.10/go.mod h1:SmD6nW6nTyfqj6ABTjUi3V3JVMnlJmwcJI5acqYI6dE=
+github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
+github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
+github.com/fsnotify/fsnotify v1.4.7 h1:IXs+QLmnXW2CcXuY+8Mzv/fWEsPGWxqefPtCP5CnV9I=
+github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMoQvtojpjFo=
+github.com/hashicorp/hcl v1.0.0 h1:0Anlzjpi4vEasTeNFn2mLJgTSwt0+6sfsiTG8qcWGx4=
+github.com/hashicorp/hcl v1.0.0/go.mod h1:E5yfLk+7swimpb2L/Alb/PJmXilQ/rhwaUYs4T20WEQ=
+github.com/inconshreveable/mousetrap v1.0.0 h1:Z8tu5sraLXCXIcARxBp/8cbvlwVa7Z1NHg9XEKhtSvM=
+github.com/inconshreveable/mousetrap v1.0.0/go.mod h1:PxqpIevigyE2G7u3NXJIT2ANytuPF1OarO4DADm73n8=
+github.com/magiconair/properties v1.8.0 h1:LLgXmsheXeRoUOBOjtwPQCWIYqM/LU1ayDtDePerRcY=
+github.com/magiconair/properties v1.8.0/go.mod h1:PppfXfuXeibc/6YijjN8zIbojt8czPbwD3XqdrwzmxQ=
+github.com/mitchellh/go-homedir v1.1.0 h1:lukF9ziXFxDFPkA1vsr5zpc1XuPDn/wFntq5mG+4E0Y=
+github.com/mitchellh/go-homedir v1.1.0/go.mod h1:SfyaCUpYCn1Vlf4IUYiD9fPX4A5wJrkLzIz1N1q0pr0=
+github.com/mitchellh/mapstructure v1.1.2 h1:fmNYVwqnSfB9mZU6OS2O6GsXM+wcskZDuKQzvN1EDeE=
+github.com/mitchellh/mapstructure v1.1.2/go.mod h1:FVVH3fgwuzCH5S8UJGiWEs2h04kUh9fWfEaFds41c1Y=
+github.com/pelletier/go-toml v1.2.0 h1:T5zMGML61Wp+FlcbWjRDT7yAxhJNAiPPLOFECq181zc=
+github.com/pelletier/go-toml v1.2.0/go.mod h1:5z9KED0ma1S8pY6P1sdut58dfprrGBbd/94hg7ilaic=
+github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
+github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
+github.com/russross/blackfriday v1.5.2 h1:HyvC0ARfnZBqnXwABFeSZHpKvJHJJfPz81GNueLj0oo=
+github.com/russross/blackfriday v1.5.2/go.mod h1:JO/DiYxRf+HjHt06OyowR9PTA263kcR/rfWxYHBV53g=
+github.com/spf13/afero v1.1.2 h1:m8/z1t7/fwjysjQRYbP0RD+bUIF/8tJwPdEZsI83ACI=
+github.com/spf13/afero v1.1.2/go.mod h1:j4pytiNVoe2o6bmDsKpLACNPDBIoEAkihy7loJ1B0CQ=
+github.com/spf13/cast v1.3.0 h1:oget//CVOEoFewqQxwr0Ej5yjygnqGkvggSE/gB35Q8=
+github.com/spf13/cast v1.3.0/go.mod h1:Qx5cxh0v+4UWYiBimWS+eyWzqEqokIECu5etghLkUJE=
+github.com/spf13/jwalterweatherman v1.0.0 h1:XHEdyB+EcvlqZamSM4ZOMGlc93t6AcsBEu9Gc1vn7yk=
+github.com/spf13/jwalterweatherman v1.0.0/go.mod h1:cQK4TGJAtQXfYWX+Ddv3mKDzgVb68N+wFjFa4jdeBTo=
+github.com/spf13/pflag v1.0.3 h1:zPAT6CGy6wXeQ7NtTnaTerfKOsV6V6F8agHXFiazDkg=
+github.com/spf13/pflag v1.0.3/go.mod h1:DYY7MBk1bdzusC3SYhjObp+wFpr4gzcvqqNjLnInEg4=
+github.com/spf13/viper v1.3.2 h1:VUFqw5KcqRf7i70GOzW7N+Q7+gxVBkSSqiXB12+JQ4M=
+github.com/spf13/viper v1.3.2/go.mod h1:ZiWeW+zYFKm7srdB9IoDzzZXaJaI5eL9QjNiN/DMA2s=
+github.com/stretchr/testify v1.2.2 h1:bSDNvY7ZPG5RlJ8otE/7V6gMiyenm9RtJ7IUVIAoJ1w=
+github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
+github.com/ugorji/go/codec v0.0.0-20181204163529-d75b2dcb6bc8/go.mod h1:VFNgLljTbGfSG7qAOspJ7OScBnGdDN/yBr0sguwnwf0=
+github.com/xordataexchange/crypt v0.0.3-0.20170626215501-b2862e3d0a77/go.mod h1:aYKd//L2LvnjZzWKhF00oedf4jCCReLcmhLdhm1A27Q=
+golang.org/x/crypto v0.0.0-20181203042331-505ab145d0a9/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4=
+golang.org/x/sys v0.0.0-20181205085412-a5c9d58dba9a h1:1n5lsVfiQW3yfsRGu98756EH1YthsFqr/5mxHduZW2A=
+golang.org/x/sys v0.0.0-20181205085412-a5c9d58dba9a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
+golang.org/x/text v0.3.0 h1:g61tztE5qeGQ89tm6NTjjM9VPIm088od1l6aSorWRWg=
+golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
+gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM=
+gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
+gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw=
+gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
diff --git a/vendor/github.com/spf13/cobra/powershell_completions.go b/vendor/github.com/spf13/cobra/powershell_completions.go
new file mode 100644
index 0000000..756c61b
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/powershell_completions.go
@@ -0,0 +1,100 @@
+// PowerShell completions are based on the amazing work from clap:
+// https://github.com/clap-rs/clap/blob/3294d18efe5f264d12c9035f404c7d189d4824e1/src/completions/powershell.rs
+//
+// The generated scripts require PowerShell v5.0+ (which comes Windows 10, but
+// can be downloaded separately for windows 7 or 8.1).
+
+package cobra
+
+import (
+	"bytes"
+	"fmt"
+	"io"
+	"os"
+	"strings"
+
+	"github.com/spf13/pflag"
+)
+
+var powerShellCompletionTemplate = `using namespace System.Management.Automation
+using namespace System.Management.Automation.Language
+Register-ArgumentCompleter -Native -CommandName '%s' -ScriptBlock {
+    param($wordToComplete, $commandAst, $cursorPosition)
+    $commandElements = $commandAst.CommandElements
+    $command = @(
+        '%s'
+        for ($i = 1; $i -lt $commandElements.Count; $i++) {
+            $element = $commandElements[$i]
+            if ($element -isnot [StringConstantExpressionAst] -or
+                $element.StringConstantType -ne [StringConstantType]::BareWord -or
+                $element.Value.StartsWith('-')) {
+                break
+            }
+            $element.Value
+        }
+    ) -join ';'
+    $completions = @(switch ($command) {%s
+    })
+    $completions.Where{ $_.CompletionText -like "$wordToComplete*" } |
+        Sort-Object -Property ListItemText
+}`
+
+func generatePowerShellSubcommandCases(out io.Writer, cmd *Command, previousCommandName string) {
+	var cmdName string
+	if previousCommandName == "" {
+		cmdName = cmd.Name()
+	} else {
+		cmdName = fmt.Sprintf("%s;%s", previousCommandName, cmd.Name())
+	}
+
+	fmt.Fprintf(out, "\n        '%s' {", cmdName)
+
+	cmd.Flags().VisitAll(func(flag *pflag.Flag) {
+		if nonCompletableFlag(flag) {
+			return
+		}
+		usage := escapeStringForPowerShell(flag.Usage)
+		if len(flag.Shorthand) > 0 {
+			fmt.Fprintf(out, "\n            [CompletionResult]::new('-%s', '%s', [CompletionResultType]::ParameterName, '%s')", flag.Shorthand, flag.Shorthand, usage)
+		}
+		fmt.Fprintf(out, "\n            [CompletionResult]::new('--%s', '%s', [CompletionResultType]::ParameterName, '%s')", flag.Name, flag.Name, usage)
+	})
+
+	for _, subCmd := range cmd.Commands() {
+		usage := escapeStringForPowerShell(subCmd.Short)
+		fmt.Fprintf(out, "\n            [CompletionResult]::new('%s', '%s', [CompletionResultType]::ParameterValue, '%s')", subCmd.Name(), subCmd.Name(), usage)
+	}
+
+	fmt.Fprint(out, "\n            break\n        }")
+
+	for _, subCmd := range cmd.Commands() {
+		generatePowerShellSubcommandCases(out, subCmd, cmdName)
+	}
+}
+
+func escapeStringForPowerShell(s string) string {
+	return strings.Replace(s, "'", "''", -1)
+}
+
+// GenPowerShellCompletion generates PowerShell completion file and writes to the passed writer.
+func (c *Command) GenPowerShellCompletion(w io.Writer) error {
+	buf := new(bytes.Buffer)
+
+	var subCommandCases bytes.Buffer
+	generatePowerShellSubcommandCases(&subCommandCases, c, "")
+	fmt.Fprintf(buf, powerShellCompletionTemplate, c.Name(), c.Name(), subCommandCases.String())
+
+	_, err := buf.WriteTo(w)
+	return err
+}
+
+// GenPowerShellCompletionFile generates PowerShell completion file.
+func (c *Command) GenPowerShellCompletionFile(filename string) error {
+	outFile, err := os.Create(filename)
+	if err != nil {
+		return err
+	}
+	defer outFile.Close()
+
+	return c.GenPowerShellCompletion(outFile)
+}
diff --git a/vendor/github.com/spf13/cobra/powershell_completions.md b/vendor/github.com/spf13/cobra/powershell_completions.md
new file mode 100644
index 0000000..afed802
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/powershell_completions.md
@@ -0,0 +1,14 @@
+# Generating PowerShell Completions For Your Own cobra.Command
+
+Cobra can generate PowerShell completion scripts. Users need PowerShell version 5.0 or above, which comes with Windows 10 and can be downloaded separately for Windows 7 or 8.1. They can then write the completions to a file and source this file from their PowerShell profile, which is referenced by the `$Profile` environment variable. See `Get-Help about_Profiles` for more info about PowerShell profiles.
+
+# What's supported
+
+- Completion for subcommands using their `.Short` description
+- Completion for non-hidden flags using their `.Name` and `.Shorthand`
+
+# What's not yet supported
+
+- Command aliases
+- Required, filename or custom flags (they will work like normal flags)
+- Custom completion scripts
diff --git a/vendor/github.com/spf13/cobra/shell_completions.go b/vendor/github.com/spf13/cobra/shell_completions.go
new file mode 100644
index 0000000..ba0af9c
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/shell_completions.go
@@ -0,0 +1,85 @@
+package cobra
+
+import (
+	"github.com/spf13/pflag"
+)
+
+// MarkFlagRequired adds the BashCompOneRequiredFlag annotation to the named flag if it exists,
+// and causes your command to report an error if invoked without the flag.
+func (c *Command) MarkFlagRequired(name string) error {
+	return MarkFlagRequired(c.Flags(), name)
+}
+
+// MarkPersistentFlagRequired adds the BashCompOneRequiredFlag annotation to the named persistent flag if it exists,
+// and causes your command to report an error if invoked without the flag.
+func (c *Command) MarkPersistentFlagRequired(name string) error {
+	return MarkFlagRequired(c.PersistentFlags(), name)
+}
+
+// MarkFlagRequired adds the BashCompOneRequiredFlag annotation to the named flag if it exists,
+// and causes your command to report an error if invoked without the flag.
+func MarkFlagRequired(flags *pflag.FlagSet, name string) error {
+	return flags.SetAnnotation(name, BashCompOneRequiredFlag, []string{"true"})
+}
+
+// MarkFlagFilename adds the BashCompFilenameExt annotation to the named flag, if it exists.
+// Generated bash autocompletion will select filenames for the flag, limiting to named extensions if provided.
+func (c *Command) MarkFlagFilename(name string, extensions ...string) error {
+	return MarkFlagFilename(c.Flags(), name, extensions...)
+}
+
+// MarkFlagCustom adds the BashCompCustom annotation to the named flag, if it exists.
+// Generated bash autocompletion will call the bash function f for the flag.
+func (c *Command) MarkFlagCustom(name string, f string) error {
+	return MarkFlagCustom(c.Flags(), name, f)
+}
+
+// MarkPersistentFlagFilename instructs the various shell completion
+// implementations to limit completions for this persistent flag to the
+// specified extensions (patterns).
+//
+// Shell Completion compatibility matrix: bash, zsh
+func (c *Command) MarkPersistentFlagFilename(name string, extensions ...string) error {
+	return MarkFlagFilename(c.PersistentFlags(), name, extensions...)
+}
+
+// MarkFlagFilename instructs the various shell completion implementations to
+// limit completions for this flag to the specified extensions (patterns).
+//
+// Shell Completion compatibility matrix: bash, zsh
+func MarkFlagFilename(flags *pflag.FlagSet, name string, extensions ...string) error {
+	return flags.SetAnnotation(name, BashCompFilenameExt, extensions)
+}
+
+// MarkFlagCustom instructs the various shell completion implementations to
+// limit completions for this flag to the specified extensions (patterns).
+//
+// Shell Completion compatibility matrix: bash, zsh
+func MarkFlagCustom(flags *pflag.FlagSet, name string, f string) error {
+	return flags.SetAnnotation(name, BashCompCustom, []string{f})
+}
+
+// MarkFlagDirname instructs the various shell completion implementations to
+// complete only directories with this named flag.
+//
+// Shell Completion compatibility matrix: zsh
+func (c *Command) MarkFlagDirname(name string) error {
+	return MarkFlagDirname(c.Flags(), name)
+}
+
+// MarkPersistentFlagDirname instructs the various shell completion
+// implementations to complete only directories with this persistent named flag.
+//
+// Shell Completion compatibility matrix: zsh
+func (c *Command) MarkPersistentFlagDirname(name string) error {
+	return MarkFlagDirname(c.PersistentFlags(), name)
+}
+
+// MarkFlagDirname instructs the various shell completion implementations to
+// complete only directories with this specified flag.
+//
+// Shell Completion compatibility matrix: zsh
+func MarkFlagDirname(flags *pflag.FlagSet, name string) error {
+	zshPattern := "-(/)"
+	return flags.SetAnnotation(name, zshCompDirname, []string{zshPattern})
+}
diff --git a/vendor/github.com/spf13/cobra/zsh_completions.go b/vendor/github.com/spf13/cobra/zsh_completions.go
new file mode 100644
index 0000000..1275548
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/zsh_completions.go
@@ -0,0 +1,336 @@
+package cobra
+
+import (
+	"encoding/json"
+	"fmt"
+	"io"
+	"os"
+	"sort"
+	"strings"
+	"text/template"
+
+	"github.com/spf13/pflag"
+)
+
+const (
+	zshCompArgumentAnnotation   = "cobra_annotations_zsh_completion_argument_annotation"
+	zshCompArgumentFilenameComp = "cobra_annotations_zsh_completion_argument_file_completion"
+	zshCompArgumentWordComp     = "cobra_annotations_zsh_completion_argument_word_completion"
+	zshCompDirname              = "cobra_annotations_zsh_dirname"
+)
+
+var (
+	zshCompFuncMap = template.FuncMap{
+		"genZshFuncName":              zshCompGenFuncName,
+		"extractFlags":                zshCompExtractFlag,
+		"genFlagEntryForZshArguments": zshCompGenFlagEntryForArguments,
+		"extractArgsCompletions":      zshCompExtractArgumentCompletionHintsForRendering,
+	}
+	zshCompletionText = `
+{{/* should accept Command (that contains subcommands) as parameter */}}
+{{define "argumentsC" -}}
+{{ $cmdPath := genZshFuncName .}}
+function {{$cmdPath}} {
+  local -a commands
+
+  _arguments -C \{{- range extractFlags .}}
+    {{genFlagEntryForZshArguments .}} \{{- end}}
+    "1: :->cmnds" \
+    "*::arg:->args"
+
+  case $state in
+  cmnds)
+    commands=({{range .Commands}}{{if not .Hidden}}
+      "{{.Name}}:{{.Short}}"{{end}}{{end}}
+    )
+    _describe "command" commands
+    ;;
+  esac
+
+  case "$words[1]" in {{- range .Commands}}{{if not .Hidden}}
+  {{.Name}})
+    {{$cmdPath}}_{{.Name}}
+    ;;{{end}}{{end}}
+  esac
+}
+{{range .Commands}}{{if not .Hidden}}
+{{template "selectCmdTemplate" .}}
+{{- end}}{{end}}
+{{- end}}
+
+{{/* should accept Command without subcommands as parameter */}}
+{{define "arguments" -}}
+function {{genZshFuncName .}} {
+{{"  _arguments"}}{{range extractFlags .}} \
+    {{genFlagEntryForZshArguments . -}}
+{{end}}{{range extractArgsCompletions .}} \
+    {{.}}{{end}}
+}
+{{end}}
+
+{{/* dispatcher for commands with or without subcommands */}}
+{{define "selectCmdTemplate" -}}
+{{if .Hidden}}{{/* ignore hidden*/}}{{else -}}
+{{if .Commands}}{{template "argumentsC" .}}{{else}}{{template "arguments" .}}{{end}}
+{{- end}}
+{{- end}}
+
+{{/* template entry point */}}
+{{define "Main" -}}
+#compdef _{{.Name}} {{.Name}}
+
+{{template "selectCmdTemplate" .}}
+{{end}}
+`
+)
+
+// zshCompArgsAnnotation is used to encode/decode zsh completion for
+// arguments to/from Command.Annotations.
+type zshCompArgsAnnotation map[int]zshCompArgHint
+
+type zshCompArgHint struct {
+	// Indicates the type of the completion to use. One of:
+	// zshCompArgumentFilenameComp or zshCompArgumentWordComp
+	Tipe string `json:"type"`
+
+	// A value for the type above (globs for file completion or words)
+	Options []string `json:"options"`
+}
+
+// GenZshCompletionFile generates zsh completion file.
+func (c *Command) GenZshCompletionFile(filename string) error {
+	outFile, err := os.Create(filename)
+	if err != nil {
+		return err
+	}
+	defer outFile.Close()
+
+	return c.GenZshCompletion(outFile)
+}
+
+// GenZshCompletion generates a zsh completion file and writes to the passed
+// writer. The completion always run on the root command regardless of the
+// command it was called from.
+func (c *Command) GenZshCompletion(w io.Writer) error {
+	tmpl, err := template.New("Main").Funcs(zshCompFuncMap).Parse(zshCompletionText)
+	if err != nil {
+		return fmt.Errorf("error creating zsh completion template: %v", err)
+	}
+	return tmpl.Execute(w, c.Root())
+}
+
+// MarkZshCompPositionalArgumentFile marks the specified argument (first
+// argument is 1) as completed by file selection. patterns (e.g. "*.txt") are
+// optional - if not provided the completion will search for all files.
+func (c *Command) MarkZshCompPositionalArgumentFile(argPosition int, patterns ...string) error {
+	if argPosition < 1 {
+		return fmt.Errorf("Invalid argument position (%d)", argPosition)
+	}
+	annotation, err := c.zshCompGetArgsAnnotations()
+	if err != nil {
+		return err
+	}
+	if c.zshcompArgsAnnotationnIsDuplicatePosition(annotation, argPosition) {
+		return fmt.Errorf("Duplicate annotation for positional argument at index %d", argPosition)
+	}
+	annotation[argPosition] = zshCompArgHint{
+		Tipe:    zshCompArgumentFilenameComp,
+		Options: patterns,
+	}
+	return c.zshCompSetArgsAnnotations(annotation)
+}
+
+// MarkZshCompPositionalArgumentWords marks the specified positional argument
+// (first argument is 1) as completed by the provided words. At east one word
+// must be provided, spaces within words will be offered completion with
+// "word\ word".
+func (c *Command) MarkZshCompPositionalArgumentWords(argPosition int, words ...string) error {
+	if argPosition < 1 {
+		return fmt.Errorf("Invalid argument position (%d)", argPosition)
+	}
+	if len(words) == 0 {
+		return fmt.Errorf("Trying to set empty word list for positional argument %d", argPosition)
+	}
+	annotation, err := c.zshCompGetArgsAnnotations()
+	if err != nil {
+		return err
+	}
+	if c.zshcompArgsAnnotationnIsDuplicatePosition(annotation, argPosition) {
+		return fmt.Errorf("Duplicate annotation for positional argument at index %d", argPosition)
+	}
+	annotation[argPosition] = zshCompArgHint{
+		Tipe:    zshCompArgumentWordComp,
+		Options: words,
+	}
+	return c.zshCompSetArgsAnnotations(annotation)
+}
+
+func zshCompExtractArgumentCompletionHintsForRendering(c *Command) ([]string, error) {
+	var result []string
+	annotation, err := c.zshCompGetArgsAnnotations()
+	if err != nil {
+		return nil, err
+	}
+	for k, v := range annotation {
+		s, err := zshCompRenderZshCompArgHint(k, v)
+		if err != nil {
+			return nil, err
+		}
+		result = append(result, s)
+	}
+	if len(c.ValidArgs) > 0 {
+		if _, positionOneExists := annotation[1]; !positionOneExists {
+			s, err := zshCompRenderZshCompArgHint(1, zshCompArgHint{
+				Tipe:    zshCompArgumentWordComp,
+				Options: c.ValidArgs,
+			})
+			if err != nil {
+				return nil, err
+			}
+			result = append(result, s)
+		}
+	}
+	sort.Strings(result)
+	return result, nil
+}
+
+func zshCompRenderZshCompArgHint(i int, z zshCompArgHint) (string, error) {
+	switch t := z.Tipe; t {
+	case zshCompArgumentFilenameComp:
+		var globs []string
+		for _, g := range z.Options {
+			globs = append(globs, fmt.Sprintf(`-g "%s"`, g))
+		}
+		return fmt.Sprintf(`'%d: :_files %s'`, i, strings.Join(globs, " ")), nil
+	case zshCompArgumentWordComp:
+		var words []string
+		for _, w := range z.Options {
+			words = append(words, fmt.Sprintf("%q", w))
+		}
+		return fmt.Sprintf(`'%d: :(%s)'`, i, strings.Join(words, " ")), nil
+	default:
+		return "", fmt.Errorf("Invalid zsh argument completion annotation: %s", t)
+	}
+}
+
+func (c *Command) zshcompArgsAnnotationnIsDuplicatePosition(annotation zshCompArgsAnnotation, position int) bool {
+	_, dup := annotation[position]
+	return dup
+}
+
+func (c *Command) zshCompGetArgsAnnotations() (zshCompArgsAnnotation, error) {
+	annotation := make(zshCompArgsAnnotation)
+	annotationString, ok := c.Annotations[zshCompArgumentAnnotation]
+	if !ok {
+		return annotation, nil
+	}
+	err := json.Unmarshal([]byte(annotationString), &annotation)
+	if err != nil {
+		return annotation, fmt.Errorf("Error unmarshaling zsh argument annotation: %v", err)
+	}
+	return annotation, nil
+}
+
+func (c *Command) zshCompSetArgsAnnotations(annotation zshCompArgsAnnotation) error {
+	jsn, err := json.Marshal(annotation)
+	if err != nil {
+		return fmt.Errorf("Error marshaling zsh argument annotation: %v", err)
+	}
+	if c.Annotations == nil {
+		c.Annotations = make(map[string]string)
+	}
+	c.Annotations[zshCompArgumentAnnotation] = string(jsn)
+	return nil
+}
+
+func zshCompGenFuncName(c *Command) string {
+	if c.HasParent() {
+		return zshCompGenFuncName(c.Parent()) + "_" + c.Name()
+	}
+	return "_" + c.Name()
+}
+
+func zshCompExtractFlag(c *Command) []*pflag.Flag {
+	var flags []*pflag.Flag
+	c.LocalFlags().VisitAll(func(f *pflag.Flag) {
+		if !f.Hidden {
+			flags = append(flags, f)
+		}
+	})
+	c.InheritedFlags().VisitAll(func(f *pflag.Flag) {
+		if !f.Hidden {
+			flags = append(flags, f)
+		}
+	})
+	return flags
+}
+
+// zshCompGenFlagEntryForArguments returns an entry that matches _arguments
+// zsh-completion parameters. It's too complicated to generate in a template.
+func zshCompGenFlagEntryForArguments(f *pflag.Flag) string {
+	if f.Name == "" || f.Shorthand == "" {
+		return zshCompGenFlagEntryForSingleOptionFlag(f)
+	}
+	return zshCompGenFlagEntryForMultiOptionFlag(f)
+}
+
+func zshCompGenFlagEntryForSingleOptionFlag(f *pflag.Flag) string {
+	var option, multiMark, extras string
+
+	if zshCompFlagCouldBeSpecifiedMoreThenOnce(f) {
+		multiMark = "*"
+	}
+
+	option = "--" + f.Name
+	if option == "--" {
+		option = "-" + f.Shorthand
+	}
+	extras = zshCompGenFlagEntryExtras(f)
+
+	return fmt.Sprintf(`'%s%s[%s]%s'`, multiMark, option, zshCompQuoteFlagDescription(f.Usage), extras)
+}
+
+func zshCompGenFlagEntryForMultiOptionFlag(f *pflag.Flag) string {
+	var options, parenMultiMark, curlyMultiMark, extras string
+
+	if zshCompFlagCouldBeSpecifiedMoreThenOnce(f) {
+		parenMultiMark = "*"
+		curlyMultiMark = "\\*"
+	}
+
+	options = fmt.Sprintf(`'(%s-%s %s--%s)'{%s-%s,%s--%s}`,
+		parenMultiMark, f.Shorthand, parenMultiMark, f.Name, curlyMultiMark, f.Shorthand, curlyMultiMark, f.Name)
+	extras = zshCompGenFlagEntryExtras(f)
+
+	return fmt.Sprintf(`%s'[%s]%s'`, options, zshCompQuoteFlagDescription(f.Usage), extras)
+}
+
+func zshCompGenFlagEntryExtras(f *pflag.Flag) string {
+	if f.NoOptDefVal != "" {
+		return ""
+	}
+
+	extras := ":" // allow options for flag (even without assistance)
+	for key, values := range f.Annotations {
+		switch key {
+		case zshCompDirname:
+			extras = fmt.Sprintf(":filename:_files -g %q", values[0])
+		case BashCompFilenameExt:
+			extras = ":filename:_files"
+			for _, pattern := range values {
+				extras = extras + fmt.Sprintf(` -g "%s"`, pattern)
+			}
+		}
+	}
+
+	return extras
+}
+
+func zshCompFlagCouldBeSpecifiedMoreThenOnce(f *pflag.Flag) bool {
+	return strings.Contains(f.Value.Type(), "Slice") ||
+		strings.Contains(f.Value.Type(), "Array")
+}
+
+func zshCompQuoteFlagDescription(s string) string {
+	return strings.Replace(s, "'", `'\''`, -1)
+}
diff --git a/vendor/github.com/spf13/cobra/zsh_completions.md b/vendor/github.com/spf13/cobra/zsh_completions.md
new file mode 100644
index 0000000..df9c2ea
--- /dev/null
+++ b/vendor/github.com/spf13/cobra/zsh_completions.md
@@ -0,0 +1,39 @@
+## Generating Zsh Completion for your cobra.Command
+
+Cobra supports native Zsh completion generated from the root `cobra.Command`.
+The generated completion script should be put somewhere in your `$fpath` named
+`_<YOUR COMMAND>`.
+
+### What's Supported
+
+* Completion for all non-hidden subcommands using their `.Short` description.
+* Completion for all non-hidden flags using the following rules:
+  * Filename completion works by marking the flag with `cmd.MarkFlagFilename...`
+    family of commands.
+  * The requirement for argument to the flag is decided by the `.NoOptDefVal`
+    flag value - if it's empty then completion will expect an argument.
+  * Flags of one of the various `*Array` and `*Slice` types supports multiple
+    specifications (with or without argument depending on the specific type).
+* Completion of positional arguments using the following rules:
+  * Argument position for all options below starts at `1`. If argument position
+    `0` is requested it will raise an error.
+  * Use `command.MarkZshCompPositionalArgumentFile` to complete filenames. Glob
+    patterns (e.g. `"*.log"`) are optional - if not specified it will offer to
+    complete all file types.
+  * Use `command.MarkZshCompPositionalArgumentWords` to offer specific words for
+    completion. At least one word is required.
+  * It's possible to specify completion for some arguments and leave some
+    unspecified (e.g. offer words for second argument but nothing for first
+    argument). This will cause no completion for first argument but words
+    completion for second argument.
+  * If no argument completion was specified for 1st argument (but optionally was
+    specified for 2nd) and the command has `ValidArgs` it will be used as
+    completion options for 1st argument.
+  * Argument completions only offered for commands with no subcommands.
+
+### What's not yet Supported
+
+* Custom completion scripts are not supported yet (We should probably create zsh
+  specific one, doesn't make sense to re-use the bash one as the functions will
+  be different).
+* Whatever other feature you're looking for and doesn't exist :)
diff --git a/vendor/github.com/spf13/pflag/.gitignore b/vendor/github.com/spf13/pflag/.gitignore
new file mode 100644
index 0000000..c3da290
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/.gitignore
@@ -0,0 +1,2 @@
+.idea/*
+
diff --git a/vendor/github.com/spf13/pflag/.travis.yml b/vendor/github.com/spf13/pflag/.travis.yml
new file mode 100644
index 0000000..f8a63b3
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/.travis.yml
@@ -0,0 +1,21 @@
+sudo: false
+
+language: go
+
+go:
+  - 1.7.3
+  - 1.8.1
+  - tip
+
+matrix:
+  allow_failures:
+    - go: tip
+
+install:
+  - go get github.com/golang/lint/golint
+  - export PATH=$GOPATH/bin:$PATH
+  - go install ./...
+
+script:
+  - verify/all.sh -v
+  - go test ./...
diff --git a/vendor/github.com/spf13/pflag/LICENSE b/vendor/github.com/spf13/pflag/LICENSE
new file mode 100644
index 0000000..63ed1cf
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/LICENSE
@@ -0,0 +1,28 @@
+Copyright (c) 2012 Alex Ogier. All rights reserved.
+Copyright (c) 2012 The Go Authors. All rights reserved.
+
+Redistribution and use in source and binary forms, with or without
+modification, are permitted provided that the following conditions are
+met:
+
+   * Redistributions of source code must retain the above copyright
+notice, this list of conditions and the following disclaimer.
+   * Redistributions in binary form must reproduce the above
+copyright notice, this list of conditions and the following disclaimer
+in the documentation and/or other materials provided with the
+distribution.
+   * Neither the name of Google Inc. nor the names of its
+contributors may be used to endorse or promote products derived from
+this software without specific prior written permission.
+
+THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
+"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
+LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
+A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
+OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
+SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
+LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
+DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
+THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
+(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
+OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/github.com/spf13/pflag/README.md b/vendor/github.com/spf13/pflag/README.md
new file mode 100644
index 0000000..b052414
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/README.md
@@ -0,0 +1,296 @@
+[![Build Status](https://travis-ci.org/spf13/pflag.svg?branch=master)](https://travis-ci.org/spf13/pflag)
+[![Go Report Card](https://goreportcard.com/badge/github.com/spf13/pflag)](https://goreportcard.com/report/github.com/spf13/pflag)
+[![GoDoc](https://godoc.org/github.com/spf13/pflag?status.svg)](https://godoc.org/github.com/spf13/pflag)
+
+## Description
+
+pflag is a drop-in replacement for Go's flag package, implementing
+POSIX/GNU-style --flags.
+
+pflag is compatible with the [GNU extensions to the POSIX recommendations
+for command-line options][1]. For a more precise description, see the
+"Command-line flag syntax" section below.
+
+[1]: http://www.gnu.org/software/libc/manual/html_node/Argument-Syntax.html
+
+pflag is available under the same style of BSD license as the Go language,
+which can be found in the LICENSE file.
+
+## Installation
+
+pflag is available using the standard `go get` command.
+
+Install by running:
+
+    go get github.com/spf13/pflag
+
+Run tests by running:
+
+    go test github.com/spf13/pflag
+
+## Usage
+
+pflag is a drop-in replacement of Go's native flag package. If you import
+pflag under the name "flag" then all code should continue to function
+with no changes.
+
+``` go
+import flag "github.com/spf13/pflag"
+```
+
+There is one exception to this: if you directly instantiate the Flag struct
+there is one more field "Shorthand" that you will need to set.
+Most code never instantiates this struct directly, and instead uses
+functions such as String(), BoolVar(), and Var(), and is therefore
+unaffected.
+
+Define flags using flag.String(), Bool(), Int(), etc.
+
+This declares an integer flag, -flagname, stored in the pointer ip, with type *int.
+
+``` go
+var ip *int = flag.Int("flagname", 1234, "help message for flagname")
+```
+
+If you like, you can bind the flag to a variable using the Var() functions.
+
+``` go
+var flagvar int
+func init() {
+    flag.IntVar(&flagvar, "flagname", 1234, "help message for flagname")
+}
+```
+
+Or you can create custom flags that satisfy the Value interface (with
+pointer receivers) and couple them to flag parsing by
+
+``` go
+flag.Var(&flagVal, "name", "help message for flagname")
+```
+
+For such flags, the default value is just the initial value of the variable.
+
+After all flags are defined, call
+
+``` go
+flag.Parse()
+```
+
+to parse the command line into the defined flags.
+
+Flags may then be used directly. If you're using the flags themselves,
+they are all pointers; if you bind to variables, they're values.
+
+``` go
+fmt.Println("ip has value ", *ip)
+fmt.Println("flagvar has value ", flagvar)
+```
+
+There are helpers function to get values later if you have the FlagSet but
+it was difficult to keep up with all of the flag pointers in your code.
+If you have a pflag.FlagSet with a flag called 'flagname' of type int you
+can use GetInt() to get the int value. But notice that 'flagname' must exist
+and it must be an int. GetString("flagname") will fail.
+
+``` go
+i, err := flagset.GetInt("flagname")
+```
+
+After parsing, the arguments after the flag are available as the
+slice flag.Args() or individually as flag.Arg(i).
+The arguments are indexed from 0 through flag.NArg()-1.
+
+The pflag package also defines some new functions that are not in flag,
+that give one-letter shorthands for flags. You can use these by appending
+'P' to the name of any function that defines a flag.
+
+``` go
+var ip = flag.IntP("flagname", "f", 1234, "help message")
+var flagvar bool
+func init() {
+	flag.BoolVarP(&flagvar, "boolname", "b", true, "help message")
+}
+flag.VarP(&flagVal, "varname", "v", "help message")
+```
+
+Shorthand letters can be used with single dashes on the command line.
+Boolean shorthand flags can be combined with other shorthand flags.
+
+The default set of command-line flags is controlled by
+top-level functions.  The FlagSet type allows one to define
+independent sets of flags, such as to implement subcommands
+in a command-line interface. The methods of FlagSet are
+analogous to the top-level functions for the command-line
+flag set.
+
+## Setting no option default values for flags
+
+After you create a flag it is possible to set the pflag.NoOptDefVal for
+the given flag. Doing this changes the meaning of the flag slightly. If
+a flag has a NoOptDefVal and the flag is set on the command line without
+an option the flag will be set to the NoOptDefVal. For example given:
+
+``` go
+var ip = flag.IntP("flagname", "f", 1234, "help message")
+flag.Lookup("flagname").NoOptDefVal = "4321"
+```
+
+Would result in something like
+
+| Parsed Arguments | Resulting Value |
+| -------------    | -------------   |
+| --flagname=1357  | ip=1357         |
+| --flagname       | ip=4321         |
+| [nothing]        | ip=1234         |
+
+## Command line flag syntax
+
+```
+--flag    // boolean flags, or flags with no option default values
+--flag x  // only on flags without a default value
+--flag=x
+```
+
+Unlike the flag package, a single dash before an option means something
+different than a double dash. Single dashes signify a series of shorthand
+letters for flags. All but the last shorthand letter must be boolean flags
+or a flag with a default value
+
+```
+// boolean or flags where the 'no option default value' is set
+-f
+-f=true
+-abc
+but
+-b true is INVALID
+
+// non-boolean and flags without a 'no option default value'
+-n 1234
+-n=1234
+-n1234
+
+// mixed
+-abcs "hello"
+-absd="hello"
+-abcs1234
+```
+
+Flag parsing stops after the terminator "--". Unlike the flag package,
+flags can be interspersed with arguments anywhere on the command line
+before this terminator.
+
+Integer flags accept 1234, 0664, 0x1234 and may be negative.
+Boolean flags (in their long form) accept 1, 0, t, f, true, false,
+TRUE, FALSE, True, False.
+Duration flags accept any input valid for time.ParseDuration.
+
+## Mutating or "Normalizing" Flag names
+
+It is possible to set a custom flag name 'normalization function.' It allows flag names to be mutated both when created in the code and when used on the command line to some 'normalized' form. The 'normalized' form is used for comparison. Two examples of using the custom normalization func follow.
+
+**Example #1**: You want -, _, and . in flags to compare the same. aka --my-flag == --my_flag == --my.flag
+
+``` go
+func wordSepNormalizeFunc(f *pflag.FlagSet, name string) pflag.NormalizedName {
+	from := []string{"-", "_"}
+	to := "."
+	for _, sep := range from {
+		name = strings.Replace(name, sep, to, -1)
+	}
+	return pflag.NormalizedName(name)
+}
+
+myFlagSet.SetNormalizeFunc(wordSepNormalizeFunc)
+```
+
+**Example #2**: You want to alias two flags. aka --old-flag-name == --new-flag-name
+
+``` go
+func aliasNormalizeFunc(f *pflag.FlagSet, name string) pflag.NormalizedName {
+	switch name {
+	case "old-flag-name":
+		name = "new-flag-name"
+		break
+	}
+	return pflag.NormalizedName(name)
+}
+
+myFlagSet.SetNormalizeFunc(aliasNormalizeFunc)
+```
+
+## Deprecating a flag or its shorthand
+It is possible to deprecate a flag, or just its shorthand. Deprecating a flag/shorthand hides it from help text and prints a usage message when the deprecated flag/shorthand is used.
+
+**Example #1**: You want to deprecate a flag named "badflag" as well as inform the users what flag they should use instead.
+```go
+// deprecate a flag by specifying its name and a usage message
+flags.MarkDeprecated("badflag", "please use --good-flag instead")
+```
+This hides "badflag" from help text, and prints `Flag --badflag has been deprecated, please use --good-flag instead` when "badflag" is used.
+
+**Example #2**: You want to keep a flag name "noshorthandflag" but deprecate its shortname "n".
+```go
+// deprecate a flag shorthand by specifying its flag name and a usage message
+flags.MarkShorthandDeprecated("noshorthandflag", "please use --noshorthandflag only")
+```
+This hides the shortname "n" from help text, and prints `Flag shorthand -n has been deprecated, please use --noshorthandflag only` when the shorthand "n" is used.
+
+Note that usage message is essential here, and it should not be empty.
+
+## Hidden flags
+It is possible to mark a flag as hidden, meaning it will still function as normal, however will not show up in usage/help text.
+
+**Example**: You have a flag named "secretFlag" that you need for internal use only and don't want it showing up in help text, or for its usage text to be available.
+```go
+// hide a flag by specifying its name
+flags.MarkHidden("secretFlag")
+```
+
+## Disable sorting of flags
+`pflag` allows you to disable sorting of flags for help and usage message.
+
+**Example**:
+```go
+flags.BoolP("verbose", "v", false, "verbose output")
+flags.String("coolflag", "yeaah", "it's really cool flag")
+flags.Int("usefulflag", 777, "sometimes it's very useful")
+flags.SortFlags = false
+flags.PrintDefaults()
+```
+**Output**:
+```
+  -v, --verbose           verbose output
+      --coolflag string   it's really cool flag (default "yeaah")
+      --usefulflag int    sometimes it's very useful (default 777)
+```
+
+
+## Supporting Go flags when using pflag
+In order to support flags defined using Go's `flag` package, they must be added to the `pflag` flagset. This is usually necessary
+to support flags defined by third-party dependencies (e.g. `golang/glog`).
+
+**Example**: You want to add the Go flags to the `CommandLine` flagset
+```go
+import (
+	goflag "flag"
+	flag "github.com/spf13/pflag"
+)
+
+var ip *int = flag.Int("flagname", 1234, "help message for flagname")
+
+func main() {
+	flag.CommandLine.AddGoFlagSet(goflag.CommandLine)
+	flag.Parse()
+}
+```
+
+## More info
+
+You can see the full reference documentation of the pflag package
+[at godoc.org][3], or through go's standard documentation system by
+running `godoc -http=:6060` and browsing to
+[http://localhost:6060/pkg/github.com/spf13/pflag][2] after
+installation.
+
+[2]: http://localhost:6060/pkg/github.com/spf13/pflag
+[3]: http://godoc.org/github.com/spf13/pflag
diff --git a/vendor/github.com/spf13/pflag/bool.go b/vendor/github.com/spf13/pflag/bool.go
new file mode 100644
index 0000000..c4c5c0b
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/bool.go
@@ -0,0 +1,94 @@
+package pflag
+
+import "strconv"
+
+// optional interface to indicate boolean flags that can be
+// supplied without "=value" text
+type boolFlag interface {
+	Value
+	IsBoolFlag() bool
+}
+
+// -- bool Value
+type boolValue bool
+
+func newBoolValue(val bool, p *bool) *boolValue {
+	*p = val
+	return (*boolValue)(p)
+}
+
+func (b *boolValue) Set(s string) error {
+	v, err := strconv.ParseBool(s)
+	*b = boolValue(v)
+	return err
+}
+
+func (b *boolValue) Type() string {
+	return "bool"
+}
+
+func (b *boolValue) String() string { return strconv.FormatBool(bool(*b)) }
+
+func (b *boolValue) IsBoolFlag() bool { return true }
+
+func boolConv(sval string) (interface{}, error) {
+	return strconv.ParseBool(sval)
+}
+
+// GetBool return the bool value of a flag with the given name
+func (f *FlagSet) GetBool(name string) (bool, error) {
+	val, err := f.getFlagType(name, "bool", boolConv)
+	if err != nil {
+		return false, err
+	}
+	return val.(bool), nil
+}
+
+// BoolVar defines a bool flag with specified name, default value, and usage string.
+// The argument p points to a bool variable in which to store the value of the flag.
+func (f *FlagSet) BoolVar(p *bool, name string, value bool, usage string) {
+	f.BoolVarP(p, name, "", value, usage)
+}
+
+// BoolVarP is like BoolVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BoolVarP(p *bool, name, shorthand string, value bool, usage string) {
+	flag := f.VarPF(newBoolValue(value, p), name, shorthand, usage)
+	flag.NoOptDefVal = "true"
+}
+
+// BoolVar defines a bool flag with specified name, default value, and usage string.
+// The argument p points to a bool variable in which to store the value of the flag.
+func BoolVar(p *bool, name string, value bool, usage string) {
+	BoolVarP(p, name, "", value, usage)
+}
+
+// BoolVarP is like BoolVar, but accepts a shorthand letter that can be used after a single dash.
+func BoolVarP(p *bool, name, shorthand string, value bool, usage string) {
+	flag := CommandLine.VarPF(newBoolValue(value, p), name, shorthand, usage)
+	flag.NoOptDefVal = "true"
+}
+
+// Bool defines a bool flag with specified name, default value, and usage string.
+// The return value is the address of a bool variable that stores the value of the flag.
+func (f *FlagSet) Bool(name string, value bool, usage string) *bool {
+	return f.BoolP(name, "", value, usage)
+}
+
+// BoolP is like Bool, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BoolP(name, shorthand string, value bool, usage string) *bool {
+	p := new(bool)
+	f.BoolVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Bool defines a bool flag with specified name, default value, and usage string.
+// The return value is the address of a bool variable that stores the value of the flag.
+func Bool(name string, value bool, usage string) *bool {
+	return BoolP(name, "", value, usage)
+}
+
+// BoolP is like Bool, but accepts a shorthand letter that can be used after a single dash.
+func BoolP(name, shorthand string, value bool, usage string) *bool {
+	b := CommandLine.BoolP(name, shorthand, value, usage)
+	return b
+}
diff --git a/vendor/github.com/spf13/pflag/bool_slice.go b/vendor/github.com/spf13/pflag/bool_slice.go
new file mode 100644
index 0000000..5af02f1
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/bool_slice.go
@@ -0,0 +1,147 @@
+package pflag
+
+import (
+	"io"
+	"strconv"
+	"strings"
+)
+
+// -- boolSlice Value
+type boolSliceValue struct {
+	value   *[]bool
+	changed bool
+}
+
+func newBoolSliceValue(val []bool, p *[]bool) *boolSliceValue {
+	bsv := new(boolSliceValue)
+	bsv.value = p
+	*bsv.value = val
+	return bsv
+}
+
+// Set converts, and assigns, the comma-separated boolean argument string representation as the []bool value of this flag.
+// If Set is called on a flag that already has a []bool assigned, the newly converted values will be appended.
+func (s *boolSliceValue) Set(val string) error {
+
+	// remove all quote characters
+	rmQuote := strings.NewReplacer(`"`, "", `'`, "", "`", "")
+
+	// read flag arguments with CSV parser
+	boolStrSlice, err := readAsCSV(rmQuote.Replace(val))
+	if err != nil && err != io.EOF {
+		return err
+	}
+
+	// parse boolean values into slice
+	out := make([]bool, 0, len(boolStrSlice))
+	for _, boolStr := range boolStrSlice {
+		b, err := strconv.ParseBool(strings.TrimSpace(boolStr))
+		if err != nil {
+			return err
+		}
+		out = append(out, b)
+	}
+
+	if !s.changed {
+		*s.value = out
+	} else {
+		*s.value = append(*s.value, out...)
+	}
+
+	s.changed = true
+
+	return nil
+}
+
+// Type returns a string that uniquely represents this flag's type.
+func (s *boolSliceValue) Type() string {
+	return "boolSlice"
+}
+
+// String defines a "native" format for this boolean slice flag value.
+func (s *boolSliceValue) String() string {
+
+	boolStrSlice := make([]string, len(*s.value))
+	for i, b := range *s.value {
+		boolStrSlice[i] = strconv.FormatBool(b)
+	}
+
+	out, _ := writeAsCSV(boolStrSlice)
+
+	return "[" + out + "]"
+}
+
+func boolSliceConv(val string) (interface{}, error) {
+	val = strings.Trim(val, "[]")
+	// Empty string would cause a slice with one (empty) entry
+	if len(val) == 0 {
+		return []bool{}, nil
+	}
+	ss := strings.Split(val, ",")
+	out := make([]bool, len(ss))
+	for i, t := range ss {
+		var err error
+		out[i], err = strconv.ParseBool(t)
+		if err != nil {
+			return nil, err
+		}
+	}
+	return out, nil
+}
+
+// GetBoolSlice returns the []bool value of a flag with the given name.
+func (f *FlagSet) GetBoolSlice(name string) ([]bool, error) {
+	val, err := f.getFlagType(name, "boolSlice", boolSliceConv)
+	if err != nil {
+		return []bool{}, err
+	}
+	return val.([]bool), nil
+}
+
+// BoolSliceVar defines a boolSlice flag with specified name, default value, and usage string.
+// The argument p points to a []bool variable in which to store the value of the flag.
+func (f *FlagSet) BoolSliceVar(p *[]bool, name string, value []bool, usage string) {
+	f.VarP(newBoolSliceValue(value, p), name, "", usage)
+}
+
+// BoolSliceVarP is like BoolSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BoolSliceVarP(p *[]bool, name, shorthand string, value []bool, usage string) {
+	f.VarP(newBoolSliceValue(value, p), name, shorthand, usage)
+}
+
+// BoolSliceVar defines a []bool flag with specified name, default value, and usage string.
+// The argument p points to a []bool variable in which to store the value of the flag.
+func BoolSliceVar(p *[]bool, name string, value []bool, usage string) {
+	CommandLine.VarP(newBoolSliceValue(value, p), name, "", usage)
+}
+
+// BoolSliceVarP is like BoolSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func BoolSliceVarP(p *[]bool, name, shorthand string, value []bool, usage string) {
+	CommandLine.VarP(newBoolSliceValue(value, p), name, shorthand, usage)
+}
+
+// BoolSlice defines a []bool flag with specified name, default value, and usage string.
+// The return value is the address of a []bool variable that stores the value of the flag.
+func (f *FlagSet) BoolSlice(name string, value []bool, usage string) *[]bool {
+	p := []bool{}
+	f.BoolSliceVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// BoolSliceP is like BoolSlice, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BoolSliceP(name, shorthand string, value []bool, usage string) *[]bool {
+	p := []bool{}
+	f.BoolSliceVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// BoolSlice defines a []bool flag with specified name, default value, and usage string.
+// The return value is the address of a []bool variable that stores the value of the flag.
+func BoolSlice(name string, value []bool, usage string) *[]bool {
+	return CommandLine.BoolSliceP(name, "", value, usage)
+}
+
+// BoolSliceP is like BoolSlice, but accepts a shorthand letter that can be used after a single dash.
+func BoolSliceP(name, shorthand string, value []bool, usage string) *[]bool {
+	return CommandLine.BoolSliceP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/bytes.go b/vendor/github.com/spf13/pflag/bytes.go
new file mode 100644
index 0000000..67d5304
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/bytes.go
@@ -0,0 +1,209 @@
+package pflag
+
+import (
+	"encoding/base64"
+	"encoding/hex"
+	"fmt"
+	"strings"
+)
+
+// BytesHex adapts []byte for use as a flag. Value of flag is HEX encoded
+type bytesHexValue []byte
+
+// String implements pflag.Value.String.
+func (bytesHex bytesHexValue) String() string {
+	return fmt.Sprintf("%X", []byte(bytesHex))
+}
+
+// Set implements pflag.Value.Set.
+func (bytesHex *bytesHexValue) Set(value string) error {
+	bin, err := hex.DecodeString(strings.TrimSpace(value))
+
+	if err != nil {
+		return err
+	}
+
+	*bytesHex = bin
+
+	return nil
+}
+
+// Type implements pflag.Value.Type.
+func (*bytesHexValue) Type() string {
+	return "bytesHex"
+}
+
+func newBytesHexValue(val []byte, p *[]byte) *bytesHexValue {
+	*p = val
+	return (*bytesHexValue)(p)
+}
+
+func bytesHexConv(sval string) (interface{}, error) {
+
+	bin, err := hex.DecodeString(sval)
+
+	if err == nil {
+		return bin, nil
+	}
+
+	return nil, fmt.Errorf("invalid string being converted to Bytes: %s %s", sval, err)
+}
+
+// GetBytesHex return the []byte value of a flag with the given name
+func (f *FlagSet) GetBytesHex(name string) ([]byte, error) {
+	val, err := f.getFlagType(name, "bytesHex", bytesHexConv)
+
+	if err != nil {
+		return []byte{}, err
+	}
+
+	return val.([]byte), nil
+}
+
+// BytesHexVar defines an []byte flag with specified name, default value, and usage string.
+// The argument p points to an []byte variable in which to store the value of the flag.
+func (f *FlagSet) BytesHexVar(p *[]byte, name string, value []byte, usage string) {
+	f.VarP(newBytesHexValue(value, p), name, "", usage)
+}
+
+// BytesHexVarP is like BytesHexVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BytesHexVarP(p *[]byte, name, shorthand string, value []byte, usage string) {
+	f.VarP(newBytesHexValue(value, p), name, shorthand, usage)
+}
+
+// BytesHexVar defines an []byte flag with specified name, default value, and usage string.
+// The argument p points to an []byte variable in which to store the value of the flag.
+func BytesHexVar(p *[]byte, name string, value []byte, usage string) {
+	CommandLine.VarP(newBytesHexValue(value, p), name, "", usage)
+}
+
+// BytesHexVarP is like BytesHexVar, but accepts a shorthand letter that can be used after a single dash.
+func BytesHexVarP(p *[]byte, name, shorthand string, value []byte, usage string) {
+	CommandLine.VarP(newBytesHexValue(value, p), name, shorthand, usage)
+}
+
+// BytesHex defines an []byte flag with specified name, default value, and usage string.
+// The return value is the address of an []byte variable that stores the value of the flag.
+func (f *FlagSet) BytesHex(name string, value []byte, usage string) *[]byte {
+	p := new([]byte)
+	f.BytesHexVarP(p, name, "", value, usage)
+	return p
+}
+
+// BytesHexP is like BytesHex, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BytesHexP(name, shorthand string, value []byte, usage string) *[]byte {
+	p := new([]byte)
+	f.BytesHexVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// BytesHex defines an []byte flag with specified name, default value, and usage string.
+// The return value is the address of an []byte variable that stores the value of the flag.
+func BytesHex(name string, value []byte, usage string) *[]byte {
+	return CommandLine.BytesHexP(name, "", value, usage)
+}
+
+// BytesHexP is like BytesHex, but accepts a shorthand letter that can be used after a single dash.
+func BytesHexP(name, shorthand string, value []byte, usage string) *[]byte {
+	return CommandLine.BytesHexP(name, shorthand, value, usage)
+}
+
+// BytesBase64 adapts []byte for use as a flag. Value of flag is Base64 encoded
+type bytesBase64Value []byte
+
+// String implements pflag.Value.String.
+func (bytesBase64 bytesBase64Value) String() string {
+	return base64.StdEncoding.EncodeToString([]byte(bytesBase64))
+}
+
+// Set implements pflag.Value.Set.
+func (bytesBase64 *bytesBase64Value) Set(value string) error {
+	bin, err := base64.StdEncoding.DecodeString(strings.TrimSpace(value))
+
+	if err != nil {
+		return err
+	}
+
+	*bytesBase64 = bin
+
+	return nil
+}
+
+// Type implements pflag.Value.Type.
+func (*bytesBase64Value) Type() string {
+	return "bytesBase64"
+}
+
+func newBytesBase64Value(val []byte, p *[]byte) *bytesBase64Value {
+	*p = val
+	return (*bytesBase64Value)(p)
+}
+
+func bytesBase64ValueConv(sval string) (interface{}, error) {
+
+	bin, err := base64.StdEncoding.DecodeString(sval)
+	if err == nil {
+		return bin, nil
+	}
+
+	return nil, fmt.Errorf("invalid string being converted to Bytes: %s %s", sval, err)
+}
+
+// GetBytesBase64 return the []byte value of a flag with the given name
+func (f *FlagSet) GetBytesBase64(name string) ([]byte, error) {
+	val, err := f.getFlagType(name, "bytesBase64", bytesBase64ValueConv)
+
+	if err != nil {
+		return []byte{}, err
+	}
+
+	return val.([]byte), nil
+}
+
+// BytesBase64Var defines an []byte flag with specified name, default value, and usage string.
+// The argument p points to an []byte variable in which to store the value of the flag.
+func (f *FlagSet) BytesBase64Var(p *[]byte, name string, value []byte, usage string) {
+	f.VarP(newBytesBase64Value(value, p), name, "", usage)
+}
+
+// BytesBase64VarP is like BytesBase64Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BytesBase64VarP(p *[]byte, name, shorthand string, value []byte, usage string) {
+	f.VarP(newBytesBase64Value(value, p), name, shorthand, usage)
+}
+
+// BytesBase64Var defines an []byte flag with specified name, default value, and usage string.
+// The argument p points to an []byte variable in which to store the value of the flag.
+func BytesBase64Var(p *[]byte, name string, value []byte, usage string) {
+	CommandLine.VarP(newBytesBase64Value(value, p), name, "", usage)
+}
+
+// BytesBase64VarP is like BytesBase64Var, but accepts a shorthand letter that can be used after a single dash.
+func BytesBase64VarP(p *[]byte, name, shorthand string, value []byte, usage string) {
+	CommandLine.VarP(newBytesBase64Value(value, p), name, shorthand, usage)
+}
+
+// BytesBase64 defines an []byte flag with specified name, default value, and usage string.
+// The return value is the address of an []byte variable that stores the value of the flag.
+func (f *FlagSet) BytesBase64(name string, value []byte, usage string) *[]byte {
+	p := new([]byte)
+	f.BytesBase64VarP(p, name, "", value, usage)
+	return p
+}
+
+// BytesBase64P is like BytesBase64, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) BytesBase64P(name, shorthand string, value []byte, usage string) *[]byte {
+	p := new([]byte)
+	f.BytesBase64VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// BytesBase64 defines an []byte flag with specified name, default value, and usage string.
+// The return value is the address of an []byte variable that stores the value of the flag.
+func BytesBase64(name string, value []byte, usage string) *[]byte {
+	return CommandLine.BytesBase64P(name, "", value, usage)
+}
+
+// BytesBase64P is like BytesBase64, but accepts a shorthand letter that can be used after a single dash.
+func BytesBase64P(name, shorthand string, value []byte, usage string) *[]byte {
+	return CommandLine.BytesBase64P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/count.go b/vendor/github.com/spf13/pflag/count.go
new file mode 100644
index 0000000..aa126e4
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/count.go
@@ -0,0 +1,96 @@
+package pflag
+
+import "strconv"
+
+// -- count Value
+type countValue int
+
+func newCountValue(val int, p *int) *countValue {
+	*p = val
+	return (*countValue)(p)
+}
+
+func (i *countValue) Set(s string) error {
+	// "+1" means that no specific value was passed, so increment
+	if s == "+1" {
+		*i = countValue(*i + 1)
+		return nil
+	}
+	v, err := strconv.ParseInt(s, 0, 0)
+	*i = countValue(v)
+	return err
+}
+
+func (i *countValue) Type() string {
+	return "count"
+}
+
+func (i *countValue) String() string { return strconv.Itoa(int(*i)) }
+
+func countConv(sval string) (interface{}, error) {
+	i, err := strconv.Atoi(sval)
+	if err != nil {
+		return nil, err
+	}
+	return i, nil
+}
+
+// GetCount return the int value of a flag with the given name
+func (f *FlagSet) GetCount(name string) (int, error) {
+	val, err := f.getFlagType(name, "count", countConv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(int), nil
+}
+
+// CountVar defines a count flag with specified name, default value, and usage string.
+// The argument p points to an int variable in which to store the value of the flag.
+// A count flag will add 1 to its value evey time it is found on the command line
+func (f *FlagSet) CountVar(p *int, name string, usage string) {
+	f.CountVarP(p, name, "", usage)
+}
+
+// CountVarP is like CountVar only take a shorthand for the flag name.
+func (f *FlagSet) CountVarP(p *int, name, shorthand string, usage string) {
+	flag := f.VarPF(newCountValue(0, p), name, shorthand, usage)
+	flag.NoOptDefVal = "+1"
+}
+
+// CountVar like CountVar only the flag is placed on the CommandLine instead of a given flag set
+func CountVar(p *int, name string, usage string) {
+	CommandLine.CountVar(p, name, usage)
+}
+
+// CountVarP is like CountVar only take a shorthand for the flag name.
+func CountVarP(p *int, name, shorthand string, usage string) {
+	CommandLine.CountVarP(p, name, shorthand, usage)
+}
+
+// Count defines a count flag with specified name, default value, and usage string.
+// The return value is the address of an int variable that stores the value of the flag.
+// A count flag will add 1 to its value evey time it is found on the command line
+func (f *FlagSet) Count(name string, usage string) *int {
+	p := new(int)
+	f.CountVarP(p, name, "", usage)
+	return p
+}
+
+// CountP is like Count only takes a shorthand for the flag name.
+func (f *FlagSet) CountP(name, shorthand string, usage string) *int {
+	p := new(int)
+	f.CountVarP(p, name, shorthand, usage)
+	return p
+}
+
+// Count defines a count flag with specified name, default value, and usage string.
+// The return value is the address of an int variable that stores the value of the flag.
+// A count flag will add 1 to its value evey time it is found on the command line
+func Count(name string, usage string) *int {
+	return CommandLine.CountP(name, "", usage)
+}
+
+// CountP is like Count only takes a shorthand for the flag name.
+func CountP(name, shorthand string, usage string) *int {
+	return CommandLine.CountP(name, shorthand, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/duration.go b/vendor/github.com/spf13/pflag/duration.go
new file mode 100644
index 0000000..e9debef
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/duration.go
@@ -0,0 +1,86 @@
+package pflag
+
+import (
+	"time"
+)
+
+// -- time.Duration Value
+type durationValue time.Duration
+
+func newDurationValue(val time.Duration, p *time.Duration) *durationValue {
+	*p = val
+	return (*durationValue)(p)
+}
+
+func (d *durationValue) Set(s string) error {
+	v, err := time.ParseDuration(s)
+	*d = durationValue(v)
+	return err
+}
+
+func (d *durationValue) Type() string {
+	return "duration"
+}
+
+func (d *durationValue) String() string { return (*time.Duration)(d).String() }
+
+func durationConv(sval string) (interface{}, error) {
+	return time.ParseDuration(sval)
+}
+
+// GetDuration return the duration value of a flag with the given name
+func (f *FlagSet) GetDuration(name string) (time.Duration, error) {
+	val, err := f.getFlagType(name, "duration", durationConv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(time.Duration), nil
+}
+
+// DurationVar defines a time.Duration flag with specified name, default value, and usage string.
+// The argument p points to a time.Duration variable in which to store the value of the flag.
+func (f *FlagSet) DurationVar(p *time.Duration, name string, value time.Duration, usage string) {
+	f.VarP(newDurationValue(value, p), name, "", usage)
+}
+
+// DurationVarP is like DurationVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) DurationVarP(p *time.Duration, name, shorthand string, value time.Duration, usage string) {
+	f.VarP(newDurationValue(value, p), name, shorthand, usage)
+}
+
+// DurationVar defines a time.Duration flag with specified name, default value, and usage string.
+// The argument p points to a time.Duration variable in which to store the value of the flag.
+func DurationVar(p *time.Duration, name string, value time.Duration, usage string) {
+	CommandLine.VarP(newDurationValue(value, p), name, "", usage)
+}
+
+// DurationVarP is like DurationVar, but accepts a shorthand letter that can be used after a single dash.
+func DurationVarP(p *time.Duration, name, shorthand string, value time.Duration, usage string) {
+	CommandLine.VarP(newDurationValue(value, p), name, shorthand, usage)
+}
+
+// Duration defines a time.Duration flag with specified name, default value, and usage string.
+// The return value is the address of a time.Duration variable that stores the value of the flag.
+func (f *FlagSet) Duration(name string, value time.Duration, usage string) *time.Duration {
+	p := new(time.Duration)
+	f.DurationVarP(p, name, "", value, usage)
+	return p
+}
+
+// DurationP is like Duration, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) DurationP(name, shorthand string, value time.Duration, usage string) *time.Duration {
+	p := new(time.Duration)
+	f.DurationVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Duration defines a time.Duration flag with specified name, default value, and usage string.
+// The return value is the address of a time.Duration variable that stores the value of the flag.
+func Duration(name string, value time.Duration, usage string) *time.Duration {
+	return CommandLine.DurationP(name, "", value, usage)
+}
+
+// DurationP is like Duration, but accepts a shorthand letter that can be used after a single dash.
+func DurationP(name, shorthand string, value time.Duration, usage string) *time.Duration {
+	return CommandLine.DurationP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/duration_slice.go b/vendor/github.com/spf13/pflag/duration_slice.go
new file mode 100644
index 0000000..52c6b6d
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/duration_slice.go
@@ -0,0 +1,128 @@
+package pflag
+
+import (
+	"fmt"
+	"strings"
+	"time"
+)
+
+// -- durationSlice Value
+type durationSliceValue struct {
+	value   *[]time.Duration
+	changed bool
+}
+
+func newDurationSliceValue(val []time.Duration, p *[]time.Duration) *durationSliceValue {
+	dsv := new(durationSliceValue)
+	dsv.value = p
+	*dsv.value = val
+	return dsv
+}
+
+func (s *durationSliceValue) Set(val string) error {
+	ss := strings.Split(val, ",")
+	out := make([]time.Duration, len(ss))
+	for i, d := range ss {
+		var err error
+		out[i], err = time.ParseDuration(d)
+		if err != nil {
+			return err
+		}
+
+	}
+	if !s.changed {
+		*s.value = out
+	} else {
+		*s.value = append(*s.value, out...)
+	}
+	s.changed = true
+	return nil
+}
+
+func (s *durationSliceValue) Type() string {
+	return "durationSlice"
+}
+
+func (s *durationSliceValue) String() string {
+	out := make([]string, len(*s.value))
+	for i, d := range *s.value {
+		out[i] = fmt.Sprintf("%s", d)
+	}
+	return "[" + strings.Join(out, ",") + "]"
+}
+
+func durationSliceConv(val string) (interface{}, error) {
+	val = strings.Trim(val, "[]")
+	// Empty string would cause a slice with one (empty) entry
+	if len(val) == 0 {
+		return []time.Duration{}, nil
+	}
+	ss := strings.Split(val, ",")
+	out := make([]time.Duration, len(ss))
+	for i, d := range ss {
+		var err error
+		out[i], err = time.ParseDuration(d)
+		if err != nil {
+			return nil, err
+		}
+
+	}
+	return out, nil
+}
+
+// GetDurationSlice returns the []time.Duration value of a flag with the given name
+func (f *FlagSet) GetDurationSlice(name string) ([]time.Duration, error) {
+	val, err := f.getFlagType(name, "durationSlice", durationSliceConv)
+	if err != nil {
+		return []time.Duration{}, err
+	}
+	return val.([]time.Duration), nil
+}
+
+// DurationSliceVar defines a durationSlice flag with specified name, default value, and usage string.
+// The argument p points to a []time.Duration variable in which to store the value of the flag.
+func (f *FlagSet) DurationSliceVar(p *[]time.Duration, name string, value []time.Duration, usage string) {
+	f.VarP(newDurationSliceValue(value, p), name, "", usage)
+}
+
+// DurationSliceVarP is like DurationSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) DurationSliceVarP(p *[]time.Duration, name, shorthand string, value []time.Duration, usage string) {
+	f.VarP(newDurationSliceValue(value, p), name, shorthand, usage)
+}
+
+// DurationSliceVar defines a duration[] flag with specified name, default value, and usage string.
+// The argument p points to a duration[] variable in which to store the value of the flag.
+func DurationSliceVar(p *[]time.Duration, name string, value []time.Duration, usage string) {
+	CommandLine.VarP(newDurationSliceValue(value, p), name, "", usage)
+}
+
+// DurationSliceVarP is like DurationSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func DurationSliceVarP(p *[]time.Duration, name, shorthand string, value []time.Duration, usage string) {
+	CommandLine.VarP(newDurationSliceValue(value, p), name, shorthand, usage)
+}
+
+// DurationSlice defines a []time.Duration flag with specified name, default value, and usage string.
+// The return value is the address of a []time.Duration variable that stores the value of the flag.
+func (f *FlagSet) DurationSlice(name string, value []time.Duration, usage string) *[]time.Duration {
+	p := []time.Duration{}
+	f.DurationSliceVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// DurationSliceP is like DurationSlice, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) DurationSliceP(name, shorthand string, value []time.Duration, usage string) *[]time.Duration {
+	p := []time.Duration{}
+	f.DurationSliceVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// DurationSlice defines a []time.Duration flag with specified name, default value, and usage string.
+// The return value is the address of a []time.Duration variable that stores the value of the flag.
+func DurationSlice(name string, value []time.Duration, usage string) *[]time.Duration {
+	return CommandLine.DurationSliceP(name, "", value, usage)
+}
+
+// DurationSliceP is like DurationSlice, but accepts a shorthand letter that can be used after a single dash.
+func DurationSliceP(name, shorthand string, value []time.Duration, usage string) *[]time.Duration {
+	return CommandLine.DurationSliceP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/flag.go b/vendor/github.com/spf13/pflag/flag.go
new file mode 100644
index 0000000..9beeda8
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/flag.go
@@ -0,0 +1,1227 @@
+// Copyright 2009 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+/*
+Package pflag is a drop-in replacement for Go's flag package, implementing
+POSIX/GNU-style --flags.
+
+pflag is compatible with the GNU extensions to the POSIX recommendations
+for command-line options. See
+http://www.gnu.org/software/libc/manual/html_node/Argument-Syntax.html
+
+Usage:
+
+pflag is a drop-in replacement of Go's native flag package. If you import
+pflag under the name "flag" then all code should continue to function
+with no changes.
+
+	import flag "github.com/spf13/pflag"
+
+There is one exception to this: if you directly instantiate the Flag struct
+there is one more field "Shorthand" that you will need to set.
+Most code never instantiates this struct directly, and instead uses
+functions such as String(), BoolVar(), and Var(), and is therefore
+unaffected.
+
+Define flags using flag.String(), Bool(), Int(), etc.
+
+This declares an integer flag, -flagname, stored in the pointer ip, with type *int.
+	var ip = flag.Int("flagname", 1234, "help message for flagname")
+If you like, you can bind the flag to a variable using the Var() functions.
+	var flagvar int
+	func init() {
+		flag.IntVar(&flagvar, "flagname", 1234, "help message for flagname")
+	}
+Or you can create custom flags that satisfy the Value interface (with
+pointer receivers) and couple them to flag parsing by
+	flag.Var(&flagVal, "name", "help message for flagname")
+For such flags, the default value is just the initial value of the variable.
+
+After all flags are defined, call
+	flag.Parse()
+to parse the command line into the defined flags.
+
+Flags may then be used directly. If you're using the flags themselves,
+they are all pointers; if you bind to variables, they're values.
+	fmt.Println("ip has value ", *ip)
+	fmt.Println("flagvar has value ", flagvar)
+
+After parsing, the arguments after the flag are available as the
+slice flag.Args() or individually as flag.Arg(i).
+The arguments are indexed from 0 through flag.NArg()-1.
+
+The pflag package also defines some new functions that are not in flag,
+that give one-letter shorthands for flags. You can use these by appending
+'P' to the name of any function that defines a flag.
+	var ip = flag.IntP("flagname", "f", 1234, "help message")
+	var flagvar bool
+	func init() {
+		flag.BoolVarP("boolname", "b", true, "help message")
+	}
+	flag.VarP(&flagVar, "varname", "v", 1234, "help message")
+Shorthand letters can be used with single dashes on the command line.
+Boolean shorthand flags can be combined with other shorthand flags.
+
+Command line flag syntax:
+	--flag    // boolean flags only
+	--flag=x
+
+Unlike the flag package, a single dash before an option means something
+different than a double dash. Single dashes signify a series of shorthand
+letters for flags. All but the last shorthand letter must be boolean flags.
+	// boolean flags
+	-f
+	-abc
+	// non-boolean flags
+	-n 1234
+	-Ifile
+	// mixed
+	-abcs "hello"
+	-abcn1234
+
+Flag parsing stops after the terminator "--". Unlike the flag package,
+flags can be interspersed with arguments anywhere on the command line
+before this terminator.
+
+Integer flags accept 1234, 0664, 0x1234 and may be negative.
+Boolean flags (in their long form) accept 1, 0, t, f, true, false,
+TRUE, FALSE, True, False.
+Duration flags accept any input valid for time.ParseDuration.
+
+The default set of command-line flags is controlled by
+top-level functions.  The FlagSet type allows one to define
+independent sets of flags, such as to implement subcommands
+in a command-line interface. The methods of FlagSet are
+analogous to the top-level functions for the command-line
+flag set.
+*/
+package pflag
+
+import (
+	"bytes"
+	"errors"
+	goflag "flag"
+	"fmt"
+	"io"
+	"os"
+	"sort"
+	"strings"
+)
+
+// ErrHelp is the error returned if the flag -help is invoked but no such flag is defined.
+var ErrHelp = errors.New("pflag: help requested")
+
+// ErrorHandling defines how to handle flag parsing errors.
+type ErrorHandling int
+
+const (
+	// ContinueOnError will return an err from Parse() if an error is found
+	ContinueOnError ErrorHandling = iota
+	// ExitOnError will call os.Exit(2) if an error is found when parsing
+	ExitOnError
+	// PanicOnError will panic() if an error is found when parsing flags
+	PanicOnError
+)
+
+// ParseErrorsWhitelist defines the parsing errors that can be ignored
+type ParseErrorsWhitelist struct {
+	// UnknownFlags will ignore unknown flags errors and continue parsing rest of the flags
+	UnknownFlags bool
+}
+
+// NormalizedName is a flag name that has been normalized according to rules
+// for the FlagSet (e.g. making '-' and '_' equivalent).
+type NormalizedName string
+
+// A FlagSet represents a set of defined flags.
+type FlagSet struct {
+	// Usage is the function called when an error occurs while parsing flags.
+	// The field is a function (not a method) that may be changed to point to
+	// a custom error handler.
+	Usage func()
+
+	// SortFlags is used to indicate, if user wants to have sorted flags in
+	// help/usage messages.
+	SortFlags bool
+
+	// ParseErrorsWhitelist is used to configure a whitelist of errors
+	ParseErrorsWhitelist ParseErrorsWhitelist
+
+	name              string
+	parsed            bool
+	actual            map[NormalizedName]*Flag
+	orderedActual     []*Flag
+	sortedActual      []*Flag
+	formal            map[NormalizedName]*Flag
+	orderedFormal     []*Flag
+	sortedFormal      []*Flag
+	shorthands        map[byte]*Flag
+	args              []string // arguments after flags
+	argsLenAtDash     int      // len(args) when a '--' was located when parsing, or -1 if no --
+	errorHandling     ErrorHandling
+	output            io.Writer // nil means stderr; use out() accessor
+	interspersed      bool      // allow interspersed option/non-option args
+	normalizeNameFunc func(f *FlagSet, name string) NormalizedName
+
+	addedGoFlagSets []*goflag.FlagSet
+}
+
+// A Flag represents the state of a flag.
+type Flag struct {
+	Name                string              // name as it appears on command line
+	Shorthand           string              // one-letter abbreviated flag
+	Usage               string              // help message
+	Value               Value               // value as set
+	DefValue            string              // default value (as text); for usage message
+	Changed             bool                // If the user set the value (or if left to default)
+	NoOptDefVal         string              // default value (as text); if the flag is on the command line without any options
+	Deprecated          string              // If this flag is deprecated, this string is the new or now thing to use
+	Hidden              bool                // used by cobra.Command to allow flags to be hidden from help/usage text
+	ShorthandDeprecated string              // If the shorthand of this flag is deprecated, this string is the new or now thing to use
+	Annotations         map[string][]string // used by cobra.Command bash autocomple code
+}
+
+// Value is the interface to the dynamic value stored in a flag.
+// (The default value is represented as a string.)
+type Value interface {
+	String() string
+	Set(string) error
+	Type() string
+}
+
+// sortFlags returns the flags as a slice in lexicographical sorted order.
+func sortFlags(flags map[NormalizedName]*Flag) []*Flag {
+	list := make(sort.StringSlice, len(flags))
+	i := 0
+	for k := range flags {
+		list[i] = string(k)
+		i++
+	}
+	list.Sort()
+	result := make([]*Flag, len(list))
+	for i, name := range list {
+		result[i] = flags[NormalizedName(name)]
+	}
+	return result
+}
+
+// SetNormalizeFunc allows you to add a function which can translate flag names.
+// Flags added to the FlagSet will be translated and then when anything tries to
+// look up the flag that will also be translated. So it would be possible to create
+// a flag named "getURL" and have it translated to "geturl".  A user could then pass
+// "--getUrl" which may also be translated to "geturl" and everything will work.
+func (f *FlagSet) SetNormalizeFunc(n func(f *FlagSet, name string) NormalizedName) {
+	f.normalizeNameFunc = n
+	f.sortedFormal = f.sortedFormal[:0]
+	for fname, flag := range f.formal {
+		nname := f.normalizeFlagName(flag.Name)
+		if fname == nname {
+			continue
+		}
+		flag.Name = string(nname)
+		delete(f.formal, fname)
+		f.formal[nname] = flag
+		if _, set := f.actual[fname]; set {
+			delete(f.actual, fname)
+			f.actual[nname] = flag
+		}
+	}
+}
+
+// GetNormalizeFunc returns the previously set NormalizeFunc of a function which
+// does no translation, if not set previously.
+func (f *FlagSet) GetNormalizeFunc() func(f *FlagSet, name string) NormalizedName {
+	if f.normalizeNameFunc != nil {
+		return f.normalizeNameFunc
+	}
+	return func(f *FlagSet, name string) NormalizedName { return NormalizedName(name) }
+}
+
+func (f *FlagSet) normalizeFlagName(name string) NormalizedName {
+	n := f.GetNormalizeFunc()
+	return n(f, name)
+}
+
+func (f *FlagSet) out() io.Writer {
+	if f.output == nil {
+		return os.Stderr
+	}
+	return f.output
+}
+
+// SetOutput sets the destination for usage and error messages.
+// If output is nil, os.Stderr is used.
+func (f *FlagSet) SetOutput(output io.Writer) {
+	f.output = output
+}
+
+// VisitAll visits the flags in lexicographical order or
+// in primordial order if f.SortFlags is false, calling fn for each.
+// It visits all flags, even those not set.
+func (f *FlagSet) VisitAll(fn func(*Flag)) {
+	if len(f.formal) == 0 {
+		return
+	}
+
+	var flags []*Flag
+	if f.SortFlags {
+		if len(f.formal) != len(f.sortedFormal) {
+			f.sortedFormal = sortFlags(f.formal)
+		}
+		flags = f.sortedFormal
+	} else {
+		flags = f.orderedFormal
+	}
+
+	for _, flag := range flags {
+		fn(flag)
+	}
+}
+
+// HasFlags returns a bool to indicate if the FlagSet has any flags defined.
+func (f *FlagSet) HasFlags() bool {
+	return len(f.formal) > 0
+}
+
+// HasAvailableFlags returns a bool to indicate if the FlagSet has any flags
+// that are not hidden.
+func (f *FlagSet) HasAvailableFlags() bool {
+	for _, flag := range f.formal {
+		if !flag.Hidden {
+			return true
+		}
+	}
+	return false
+}
+
+// VisitAll visits the command-line flags in lexicographical order or
+// in primordial order if f.SortFlags is false, calling fn for each.
+// It visits all flags, even those not set.
+func VisitAll(fn func(*Flag)) {
+	CommandLine.VisitAll(fn)
+}
+
+// Visit visits the flags in lexicographical order or
+// in primordial order if f.SortFlags is false, calling fn for each.
+// It visits only those flags that have been set.
+func (f *FlagSet) Visit(fn func(*Flag)) {
+	if len(f.actual) == 0 {
+		return
+	}
+
+	var flags []*Flag
+	if f.SortFlags {
+		if len(f.actual) != len(f.sortedActual) {
+			f.sortedActual = sortFlags(f.actual)
+		}
+		flags = f.sortedActual
+	} else {
+		flags = f.orderedActual
+	}
+
+	for _, flag := range flags {
+		fn(flag)
+	}
+}
+
+// Visit visits the command-line flags in lexicographical order or
+// in primordial order if f.SortFlags is false, calling fn for each.
+// It visits only those flags that have been set.
+func Visit(fn func(*Flag)) {
+	CommandLine.Visit(fn)
+}
+
+// Lookup returns the Flag structure of the named flag, returning nil if none exists.
+func (f *FlagSet) Lookup(name string) *Flag {
+	return f.lookup(f.normalizeFlagName(name))
+}
+
+// ShorthandLookup returns the Flag structure of the short handed flag,
+// returning nil if none exists.
+// It panics, if len(name) > 1.
+func (f *FlagSet) ShorthandLookup(name string) *Flag {
+	if name == "" {
+		return nil
+	}
+	if len(name) > 1 {
+		msg := fmt.Sprintf("can not look up shorthand which is more than one ASCII character: %q", name)
+		fmt.Fprintf(f.out(), msg)
+		panic(msg)
+	}
+	c := name[0]
+	return f.shorthands[c]
+}
+
+// lookup returns the Flag structure of the named flag, returning nil if none exists.
+func (f *FlagSet) lookup(name NormalizedName) *Flag {
+	return f.formal[name]
+}
+
+// func to return a given type for a given flag name
+func (f *FlagSet) getFlagType(name string, ftype string, convFunc func(sval string) (interface{}, error)) (interface{}, error) {
+	flag := f.Lookup(name)
+	if flag == nil {
+		err := fmt.Errorf("flag accessed but not defined: %s", name)
+		return nil, err
+	}
+
+	if flag.Value.Type() != ftype {
+		err := fmt.Errorf("trying to get %s value of flag of type %s", ftype, flag.Value.Type())
+		return nil, err
+	}
+
+	sval := flag.Value.String()
+	result, err := convFunc(sval)
+	if err != nil {
+		return nil, err
+	}
+	return result, nil
+}
+
+// ArgsLenAtDash will return the length of f.Args at the moment when a -- was
+// found during arg parsing. This allows your program to know which args were
+// before the -- and which came after.
+func (f *FlagSet) ArgsLenAtDash() int {
+	return f.argsLenAtDash
+}
+
+// MarkDeprecated indicated that a flag is deprecated in your program. It will
+// continue to function but will not show up in help or usage messages. Using
+// this flag will also print the given usageMessage.
+func (f *FlagSet) MarkDeprecated(name string, usageMessage string) error {
+	flag := f.Lookup(name)
+	if flag == nil {
+		return fmt.Errorf("flag %q does not exist", name)
+	}
+	if usageMessage == "" {
+		return fmt.Errorf("deprecated message for flag %q must be set", name)
+	}
+	flag.Deprecated = usageMessage
+	flag.Hidden = true
+	return nil
+}
+
+// MarkShorthandDeprecated will mark the shorthand of a flag deprecated in your
+// program. It will continue to function but will not show up in help or usage
+// messages. Using this flag will also print the given usageMessage.
+func (f *FlagSet) MarkShorthandDeprecated(name string, usageMessage string) error {
+	flag := f.Lookup(name)
+	if flag == nil {
+		return fmt.Errorf("flag %q does not exist", name)
+	}
+	if usageMessage == "" {
+		return fmt.Errorf("deprecated message for flag %q must be set", name)
+	}
+	flag.ShorthandDeprecated = usageMessage
+	return nil
+}
+
+// MarkHidden sets a flag to 'hidden' in your program. It will continue to
+// function but will not show up in help or usage messages.
+func (f *FlagSet) MarkHidden(name string) error {
+	flag := f.Lookup(name)
+	if flag == nil {
+		return fmt.Errorf("flag %q does not exist", name)
+	}
+	flag.Hidden = true
+	return nil
+}
+
+// Lookup returns the Flag structure of the named command-line flag,
+// returning nil if none exists.
+func Lookup(name string) *Flag {
+	return CommandLine.Lookup(name)
+}
+
+// ShorthandLookup returns the Flag structure of the short handed flag,
+// returning nil if none exists.
+func ShorthandLookup(name string) *Flag {
+	return CommandLine.ShorthandLookup(name)
+}
+
+// Set sets the value of the named flag.
+func (f *FlagSet) Set(name, value string) error {
+	normalName := f.normalizeFlagName(name)
+	flag, ok := f.formal[normalName]
+	if !ok {
+		return fmt.Errorf("no such flag -%v", name)
+	}
+
+	err := flag.Value.Set(value)
+	if err != nil {
+		var flagName string
+		if flag.Shorthand != "" && flag.ShorthandDeprecated == "" {
+			flagName = fmt.Sprintf("-%s, --%s", flag.Shorthand, flag.Name)
+		} else {
+			flagName = fmt.Sprintf("--%s", flag.Name)
+		}
+		return fmt.Errorf("invalid argument %q for %q flag: %v", value, flagName, err)
+	}
+
+	if !flag.Changed {
+		if f.actual == nil {
+			f.actual = make(map[NormalizedName]*Flag)
+		}
+		f.actual[normalName] = flag
+		f.orderedActual = append(f.orderedActual, flag)
+
+		flag.Changed = true
+	}
+
+	if flag.Deprecated != "" {
+		fmt.Fprintf(f.out(), "Flag --%s has been deprecated, %s\n", flag.Name, flag.Deprecated)
+	}
+	return nil
+}
+
+// SetAnnotation allows one to set arbitrary annotations on a flag in the FlagSet.
+// This is sometimes used by spf13/cobra programs which want to generate additional
+// bash completion information.
+func (f *FlagSet) SetAnnotation(name, key string, values []string) error {
+	normalName := f.normalizeFlagName(name)
+	flag, ok := f.formal[normalName]
+	if !ok {
+		return fmt.Errorf("no such flag -%v", name)
+	}
+	if flag.Annotations == nil {
+		flag.Annotations = map[string][]string{}
+	}
+	flag.Annotations[key] = values
+	return nil
+}
+
+// Changed returns true if the flag was explicitly set during Parse() and false
+// otherwise
+func (f *FlagSet) Changed(name string) bool {
+	flag := f.Lookup(name)
+	// If a flag doesn't exist, it wasn't changed....
+	if flag == nil {
+		return false
+	}
+	return flag.Changed
+}
+
+// Set sets the value of the named command-line flag.
+func Set(name, value string) error {
+	return CommandLine.Set(name, value)
+}
+
+// PrintDefaults prints, to standard error unless configured
+// otherwise, the default values of all defined flags in the set.
+func (f *FlagSet) PrintDefaults() {
+	usages := f.FlagUsages()
+	fmt.Fprint(f.out(), usages)
+}
+
+// defaultIsZeroValue returns true if the default value for this flag represents
+// a zero value.
+func (f *Flag) defaultIsZeroValue() bool {
+	switch f.Value.(type) {
+	case boolFlag:
+		return f.DefValue == "false"
+	case *durationValue:
+		// Beginning in Go 1.7, duration zero values are "0s"
+		return f.DefValue == "0" || f.DefValue == "0s"
+	case *intValue, *int8Value, *int32Value, *int64Value, *uintValue, *uint8Value, *uint16Value, *uint32Value, *uint64Value, *countValue, *float32Value, *float64Value:
+		return f.DefValue == "0"
+	case *stringValue:
+		return f.DefValue == ""
+	case *ipValue, *ipMaskValue, *ipNetValue:
+		return f.DefValue == "<nil>"
+	case *intSliceValue, *stringSliceValue, *stringArrayValue:
+		return f.DefValue == "[]"
+	default:
+		switch f.Value.String() {
+		case "false":
+			return true
+		case "<nil>":
+			return true
+		case "":
+			return true
+		case "0":
+			return true
+		}
+		return false
+	}
+}
+
+// UnquoteUsage extracts a back-quoted name from the usage
+// string for a flag and returns it and the un-quoted usage.
+// Given "a `name` to show" it returns ("name", "a name to show").
+// If there are no back quotes, the name is an educated guess of the
+// type of the flag's value, or the empty string if the flag is boolean.
+func UnquoteUsage(flag *Flag) (name string, usage string) {
+	// Look for a back-quoted name, but avoid the strings package.
+	usage = flag.Usage
+	for i := 0; i < len(usage); i++ {
+		if usage[i] == '`' {
+			for j := i + 1; j < len(usage); j++ {
+				if usage[j] == '`' {
+					name = usage[i+1 : j]
+					usage = usage[:i] + name + usage[j+1:]
+					return name, usage
+				}
+			}
+			break // Only one back quote; use type name.
+		}
+	}
+
+	name = flag.Value.Type()
+	switch name {
+	case "bool":
+		name = ""
+	case "float64":
+		name = "float"
+	case "int64":
+		name = "int"
+	case "uint64":
+		name = "uint"
+	case "stringSlice":
+		name = "strings"
+	case "intSlice":
+		name = "ints"
+	case "uintSlice":
+		name = "uints"
+	case "boolSlice":
+		name = "bools"
+	}
+
+	return
+}
+
+// Splits the string `s` on whitespace into an initial substring up to
+// `i` runes in length and the remainder. Will go `slop` over `i` if
+// that encompasses the entire string (which allows the caller to
+// avoid short orphan words on the final line).
+func wrapN(i, slop int, s string) (string, string) {
+	if i+slop > len(s) {
+		return s, ""
+	}
+
+	w := strings.LastIndexAny(s[:i], " \t\n")
+	if w <= 0 {
+		return s, ""
+	}
+	nlPos := strings.LastIndex(s[:i], "\n")
+	if nlPos > 0 && nlPos < w {
+		return s[:nlPos], s[nlPos+1:]
+	}
+	return s[:w], s[w+1:]
+}
+
+// Wraps the string `s` to a maximum width `w` with leading indent
+// `i`. The first line is not indented (this is assumed to be done by
+// caller). Pass `w` == 0 to do no wrapping
+func wrap(i, w int, s string) string {
+	if w == 0 {
+		return strings.Replace(s, "\n", "\n"+strings.Repeat(" ", i), -1)
+	}
+
+	// space between indent i and end of line width w into which
+	// we should wrap the text.
+	wrap := w - i
+
+	var r, l string
+
+	// Not enough space for sensible wrapping. Wrap as a block on
+	// the next line instead.
+	if wrap < 24 {
+		i = 16
+		wrap = w - i
+		r += "\n" + strings.Repeat(" ", i)
+	}
+	// If still not enough space then don't even try to wrap.
+	if wrap < 24 {
+		return strings.Replace(s, "\n", r, -1)
+	}
+
+	// Try to avoid short orphan words on the final line, by
+	// allowing wrapN to go a bit over if that would fit in the
+	// remainder of the line.
+	slop := 5
+	wrap = wrap - slop
+
+	// Handle first line, which is indented by the caller (or the
+	// special case above)
+	l, s = wrapN(wrap, slop, s)
+	r = r + strings.Replace(l, "\n", "\n"+strings.Repeat(" ", i), -1)
+
+	// Now wrap the rest
+	for s != "" {
+		var t string
+
+		t, s = wrapN(wrap, slop, s)
+		r = r + "\n" + strings.Repeat(" ", i) + strings.Replace(t, "\n", "\n"+strings.Repeat(" ", i), -1)
+	}
+
+	return r
+
+}
+
+// FlagUsagesWrapped returns a string containing the usage information
+// for all flags in the FlagSet. Wrapped to `cols` columns (0 for no
+// wrapping)
+func (f *FlagSet) FlagUsagesWrapped(cols int) string {
+	buf := new(bytes.Buffer)
+
+	lines := make([]string, 0, len(f.formal))
+
+	maxlen := 0
+	f.VisitAll(func(flag *Flag) {
+		if flag.Hidden {
+			return
+		}
+
+		line := ""
+		if flag.Shorthand != "" && flag.ShorthandDeprecated == "" {
+			line = fmt.Sprintf("  -%s, --%s", flag.Shorthand, flag.Name)
+		} else {
+			line = fmt.Sprintf("      --%s", flag.Name)
+		}
+
+		varname, usage := UnquoteUsage(flag)
+		if varname != "" {
+			line += " " + varname
+		}
+		if flag.NoOptDefVal != "" {
+			switch flag.Value.Type() {
+			case "string":
+				line += fmt.Sprintf("[=\"%s\"]", flag.NoOptDefVal)
+			case "bool":
+				if flag.NoOptDefVal != "true" {
+					line += fmt.Sprintf("[=%s]", flag.NoOptDefVal)
+				}
+			case "count":
+				if flag.NoOptDefVal != "+1" {
+					line += fmt.Sprintf("[=%s]", flag.NoOptDefVal)
+				}
+			default:
+				line += fmt.Sprintf("[=%s]", flag.NoOptDefVal)
+			}
+		}
+
+		// This special character will be replaced with spacing once the
+		// correct alignment is calculated
+		line += "\x00"
+		if len(line) > maxlen {
+			maxlen = len(line)
+		}
+
+		line += usage
+		if !flag.defaultIsZeroValue() {
+			if flag.Value.Type() == "string" {
+				line += fmt.Sprintf(" (default %q)", flag.DefValue)
+			} else {
+				line += fmt.Sprintf(" (default %s)", flag.DefValue)
+			}
+		}
+		if len(flag.Deprecated) != 0 {
+			line += fmt.Sprintf(" (DEPRECATED: %s)", flag.Deprecated)
+		}
+
+		lines = append(lines, line)
+	})
+
+	for _, line := range lines {
+		sidx := strings.Index(line, "\x00")
+		spacing := strings.Repeat(" ", maxlen-sidx)
+		// maxlen + 2 comes from + 1 for the \x00 and + 1 for the (deliberate) off-by-one in maxlen-sidx
+		fmt.Fprintln(buf, line[:sidx], spacing, wrap(maxlen+2, cols, line[sidx+1:]))
+	}
+
+	return buf.String()
+}
+
+// FlagUsages returns a string containing the usage information for all flags in
+// the FlagSet
+func (f *FlagSet) FlagUsages() string {
+	return f.FlagUsagesWrapped(0)
+}
+
+// PrintDefaults prints to standard error the default values of all defined command-line flags.
+func PrintDefaults() {
+	CommandLine.PrintDefaults()
+}
+
+// defaultUsage is the default function to print a usage message.
+func defaultUsage(f *FlagSet) {
+	fmt.Fprintf(f.out(), "Usage of %s:\n", f.name)
+	f.PrintDefaults()
+}
+
+// NOTE: Usage is not just defaultUsage(CommandLine)
+// because it serves (via godoc flag Usage) as the example
+// for how to write your own usage function.
+
+// Usage prints to standard error a usage message documenting all defined command-line flags.
+// The function is a variable that may be changed to point to a custom function.
+// By default it prints a simple header and calls PrintDefaults; for details about the
+// format of the output and how to control it, see the documentation for PrintDefaults.
+var Usage = func() {
+	fmt.Fprintf(os.Stderr, "Usage of %s:\n", os.Args[0])
+	PrintDefaults()
+}
+
+// NFlag returns the number of flags that have been set.
+func (f *FlagSet) NFlag() int { return len(f.actual) }
+
+// NFlag returns the number of command-line flags that have been set.
+func NFlag() int { return len(CommandLine.actual) }
+
+// Arg returns the i'th argument.  Arg(0) is the first remaining argument
+// after flags have been processed.
+func (f *FlagSet) Arg(i int) string {
+	if i < 0 || i >= len(f.args) {
+		return ""
+	}
+	return f.args[i]
+}
+
+// Arg returns the i'th command-line argument.  Arg(0) is the first remaining argument
+// after flags have been processed.
+func Arg(i int) string {
+	return CommandLine.Arg(i)
+}
+
+// NArg is the number of arguments remaining after flags have been processed.
+func (f *FlagSet) NArg() int { return len(f.args) }
+
+// NArg is the number of arguments remaining after flags have been processed.
+func NArg() int { return len(CommandLine.args) }
+
+// Args returns the non-flag arguments.
+func (f *FlagSet) Args() []string { return f.args }
+
+// Args returns the non-flag command-line arguments.
+func Args() []string { return CommandLine.args }
+
+// Var defines a flag with the specified name and usage string. The type and
+// value of the flag are represented by the first argument, of type Value, which
+// typically holds a user-defined implementation of Value. For instance, the
+// caller could create a flag that turns a comma-separated string into a slice
+// of strings by giving the slice the methods of Value; in particular, Set would
+// decompose the comma-separated string into the slice.
+func (f *FlagSet) Var(value Value, name string, usage string) {
+	f.VarP(value, name, "", usage)
+}
+
+// VarPF is like VarP, but returns the flag created
+func (f *FlagSet) VarPF(value Value, name, shorthand, usage string) *Flag {
+	// Remember the default value as a string; it won't change.
+	flag := &Flag{
+		Name:      name,
+		Shorthand: shorthand,
+		Usage:     usage,
+		Value:     value,
+		DefValue:  value.String(),
+	}
+	f.AddFlag(flag)
+	return flag
+}
+
+// VarP is like Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) VarP(value Value, name, shorthand, usage string) {
+	f.VarPF(value, name, shorthand, usage)
+}
+
+// AddFlag will add the flag to the FlagSet
+func (f *FlagSet) AddFlag(flag *Flag) {
+	normalizedFlagName := f.normalizeFlagName(flag.Name)
+
+	_, alreadyThere := f.formal[normalizedFlagName]
+	if alreadyThere {
+		msg := fmt.Sprintf("%s flag redefined: %s", f.name, flag.Name)
+		fmt.Fprintln(f.out(), msg)
+		panic(msg) // Happens only if flags are declared with identical names
+	}
+	if f.formal == nil {
+		f.formal = make(map[NormalizedName]*Flag)
+	}
+
+	flag.Name = string(normalizedFlagName)
+	f.formal[normalizedFlagName] = flag
+	f.orderedFormal = append(f.orderedFormal, flag)
+
+	if flag.Shorthand == "" {
+		return
+	}
+	if len(flag.Shorthand) > 1 {
+		msg := fmt.Sprintf("%q shorthand is more than one ASCII character", flag.Shorthand)
+		fmt.Fprintf(f.out(), msg)
+		panic(msg)
+	}
+	if f.shorthands == nil {
+		f.shorthands = make(map[byte]*Flag)
+	}
+	c := flag.Shorthand[0]
+	used, alreadyThere := f.shorthands[c]
+	if alreadyThere {
+		msg := fmt.Sprintf("unable to redefine %q shorthand in %q flagset: it's already used for %q flag", c, f.name, used.Name)
+		fmt.Fprintf(f.out(), msg)
+		panic(msg)
+	}
+	f.shorthands[c] = flag
+}
+
+// AddFlagSet adds one FlagSet to another. If a flag is already present in f
+// the flag from newSet will be ignored.
+func (f *FlagSet) AddFlagSet(newSet *FlagSet) {
+	if newSet == nil {
+		return
+	}
+	newSet.VisitAll(func(flag *Flag) {
+		if f.Lookup(flag.Name) == nil {
+			f.AddFlag(flag)
+		}
+	})
+}
+
+// Var defines a flag with the specified name and usage string. The type and
+// value of the flag are represented by the first argument, of type Value, which
+// typically holds a user-defined implementation of Value. For instance, the
+// caller could create a flag that turns a comma-separated string into a slice
+// of strings by giving the slice the methods of Value; in particular, Set would
+// decompose the comma-separated string into the slice.
+func Var(value Value, name string, usage string) {
+	CommandLine.VarP(value, name, "", usage)
+}
+
+// VarP is like Var, but accepts a shorthand letter that can be used after a single dash.
+func VarP(value Value, name, shorthand, usage string) {
+	CommandLine.VarP(value, name, shorthand, usage)
+}
+
+// failf prints to standard error a formatted error and usage message and
+// returns the error.
+func (f *FlagSet) failf(format string, a ...interface{}) error {
+	err := fmt.Errorf(format, a...)
+	if f.errorHandling != ContinueOnError {
+		fmt.Fprintln(f.out(), err)
+		f.usage()
+	}
+	return err
+}
+
+// usage calls the Usage method for the flag set, or the usage function if
+// the flag set is CommandLine.
+func (f *FlagSet) usage() {
+	if f == CommandLine {
+		Usage()
+	} else if f.Usage == nil {
+		defaultUsage(f)
+	} else {
+		f.Usage()
+	}
+}
+
+//--unknown (args will be empty)
+//--unknown --next-flag ... (args will be --next-flag ...)
+//--unknown arg ... (args will be arg ...)
+func stripUnknownFlagValue(args []string) []string {
+	if len(args) == 0 {
+		//--unknown
+		return args
+	}
+
+	first := args[0]
+	if len(first) > 0 && first[0] == '-' {
+		//--unknown --next-flag ...
+		return args
+	}
+
+	//--unknown arg ... (args will be arg ...)
+	if len(args) > 1 {
+		return args[1:]
+	}
+	return nil
+}
+
+func (f *FlagSet) parseLongArg(s string, args []string, fn parseFunc) (a []string, err error) {
+	a = args
+	name := s[2:]
+	if len(name) == 0 || name[0] == '-' || name[0] == '=' {
+		err = f.failf("bad flag syntax: %s", s)
+		return
+	}
+
+	split := strings.SplitN(name, "=", 2)
+	name = split[0]
+	flag, exists := f.formal[f.normalizeFlagName(name)]
+
+	if !exists {
+		switch {
+		case name == "help":
+			f.usage()
+			return a, ErrHelp
+		case f.ParseErrorsWhitelist.UnknownFlags:
+			// --unknown=unknownval arg ...
+			// we do not want to lose arg in this case
+			if len(split) >= 2 {
+				return a, nil
+			}
+
+			return stripUnknownFlagValue(a), nil
+		default:
+			err = f.failf("unknown flag: --%s", name)
+			return
+		}
+	}
+
+	var value string
+	if len(split) == 2 {
+		// '--flag=arg'
+		value = split[1]
+	} else if flag.NoOptDefVal != "" {
+		// '--flag' (arg was optional)
+		value = flag.NoOptDefVal
+	} else if len(a) > 0 {
+		// '--flag arg'
+		value = a[0]
+		a = a[1:]
+	} else {
+		// '--flag' (arg was required)
+		err = f.failf("flag needs an argument: %s", s)
+		return
+	}
+
+	err = fn(flag, value)
+	if err != nil {
+		f.failf(err.Error())
+	}
+	return
+}
+
+func (f *FlagSet) parseSingleShortArg(shorthands string, args []string, fn parseFunc) (outShorts string, outArgs []string, err error) {
+	outArgs = args
+
+	if strings.HasPrefix(shorthands, "test.") {
+		return
+	}
+
+	outShorts = shorthands[1:]
+	c := shorthands[0]
+
+	flag, exists := f.shorthands[c]
+	if !exists {
+		switch {
+		case c == 'h':
+			f.usage()
+			err = ErrHelp
+			return
+		case f.ParseErrorsWhitelist.UnknownFlags:
+			// '-f=arg arg ...'
+			// we do not want to lose arg in this case
+			if len(shorthands) > 2 && shorthands[1] == '=' {
+				outShorts = ""
+				return
+			}
+
+			outArgs = stripUnknownFlagValue(outArgs)
+			return
+		default:
+			err = f.failf("unknown shorthand flag: %q in -%s", c, shorthands)
+			return
+		}
+	}
+
+	var value string
+	if len(shorthands) > 2 && shorthands[1] == '=' {
+		// '-f=arg'
+		value = shorthands[2:]
+		outShorts = ""
+	} else if flag.NoOptDefVal != "" {
+		// '-f' (arg was optional)
+		value = flag.NoOptDefVal
+	} else if len(shorthands) > 1 {
+		// '-farg'
+		value = shorthands[1:]
+		outShorts = ""
+	} else if len(args) > 0 {
+		// '-f arg'
+		value = args[0]
+		outArgs = args[1:]
+	} else {
+		// '-f' (arg was required)
+		err = f.failf("flag needs an argument: %q in -%s", c, shorthands)
+		return
+	}
+
+	if flag.ShorthandDeprecated != "" {
+		fmt.Fprintf(f.out(), "Flag shorthand -%s has been deprecated, %s\n", flag.Shorthand, flag.ShorthandDeprecated)
+	}
+
+	err = fn(flag, value)
+	if err != nil {
+		f.failf(err.Error())
+	}
+	return
+}
+
+func (f *FlagSet) parseShortArg(s string, args []string, fn parseFunc) (a []string, err error) {
+	a = args
+	shorthands := s[1:]
+
+	// "shorthands" can be a series of shorthand letters of flags (e.g. "-vvv").
+	for len(shorthands) > 0 {
+		shorthands, a, err = f.parseSingleShortArg(shorthands, args, fn)
+		if err != nil {
+			return
+		}
+	}
+
+	return
+}
+
+func (f *FlagSet) parseArgs(args []string, fn parseFunc) (err error) {
+	for len(args) > 0 {
+		s := args[0]
+		args = args[1:]
+		if len(s) == 0 || s[0] != '-' || len(s) == 1 {
+			if !f.interspersed {
+				f.args = append(f.args, s)
+				f.args = append(f.args, args...)
+				return nil
+			}
+			f.args = append(f.args, s)
+			continue
+		}
+
+		if s[1] == '-' {
+			if len(s) == 2 { // "--" terminates the flags
+				f.argsLenAtDash = len(f.args)
+				f.args = append(f.args, args...)
+				break
+			}
+			args, err = f.parseLongArg(s, args, fn)
+		} else {
+			args, err = f.parseShortArg(s, args, fn)
+		}
+		if err != nil {
+			return
+		}
+	}
+	return
+}
+
+// Parse parses flag definitions from the argument list, which should not
+// include the command name.  Must be called after all flags in the FlagSet
+// are defined and before flags are accessed by the program.
+// The return value will be ErrHelp if -help was set but not defined.
+func (f *FlagSet) Parse(arguments []string) error {
+	if f.addedGoFlagSets != nil {
+		for _, goFlagSet := range f.addedGoFlagSets {
+			goFlagSet.Parse(nil)
+		}
+	}
+	f.parsed = true
+
+	if len(arguments) < 0 {
+		return nil
+	}
+
+	f.args = make([]string, 0, len(arguments))
+
+	set := func(flag *Flag, value string) error {
+		return f.Set(flag.Name, value)
+	}
+
+	err := f.parseArgs(arguments, set)
+	if err != nil {
+		switch f.errorHandling {
+		case ContinueOnError:
+			return err
+		case ExitOnError:
+			fmt.Println(err)
+			os.Exit(2)
+		case PanicOnError:
+			panic(err)
+		}
+	}
+	return nil
+}
+
+type parseFunc func(flag *Flag, value string) error
+
+// ParseAll parses flag definitions from the argument list, which should not
+// include the command name. The arguments for fn are flag and value. Must be
+// called after all flags in the FlagSet are defined and before flags are
+// accessed by the program. The return value will be ErrHelp if -help was set
+// but not defined.
+func (f *FlagSet) ParseAll(arguments []string, fn func(flag *Flag, value string) error) error {
+	f.parsed = true
+	f.args = make([]string, 0, len(arguments))
+
+	err := f.parseArgs(arguments, fn)
+	if err != nil {
+		switch f.errorHandling {
+		case ContinueOnError:
+			return err
+		case ExitOnError:
+			os.Exit(2)
+		case PanicOnError:
+			panic(err)
+		}
+	}
+	return nil
+}
+
+// Parsed reports whether f.Parse has been called.
+func (f *FlagSet) Parsed() bool {
+	return f.parsed
+}
+
+// Parse parses the command-line flags from os.Args[1:].  Must be called
+// after all flags are defined and before flags are accessed by the program.
+func Parse() {
+	// Ignore errors; CommandLine is set for ExitOnError.
+	CommandLine.Parse(os.Args[1:])
+}
+
+// ParseAll parses the command-line flags from os.Args[1:] and called fn for each.
+// The arguments for fn are flag and value. Must be called after all flags are
+// defined and before flags are accessed by the program.
+func ParseAll(fn func(flag *Flag, value string) error) {
+	// Ignore errors; CommandLine is set for ExitOnError.
+	CommandLine.ParseAll(os.Args[1:], fn)
+}
+
+// SetInterspersed sets whether to support interspersed option/non-option arguments.
+func SetInterspersed(interspersed bool) {
+	CommandLine.SetInterspersed(interspersed)
+}
+
+// Parsed returns true if the command-line flags have been parsed.
+func Parsed() bool {
+	return CommandLine.Parsed()
+}
+
+// CommandLine is the default set of command-line flags, parsed from os.Args.
+var CommandLine = NewFlagSet(os.Args[0], ExitOnError)
+
+// NewFlagSet returns a new, empty flag set with the specified name,
+// error handling property and SortFlags set to true.
+func NewFlagSet(name string, errorHandling ErrorHandling) *FlagSet {
+	f := &FlagSet{
+		name:          name,
+		errorHandling: errorHandling,
+		argsLenAtDash: -1,
+		interspersed:  true,
+		SortFlags:     true,
+	}
+	return f
+}
+
+// SetInterspersed sets whether to support interspersed option/non-option arguments.
+func (f *FlagSet) SetInterspersed(interspersed bool) {
+	f.interspersed = interspersed
+}
+
+// Init sets the name and error handling property for a flag set.
+// By default, the zero FlagSet uses an empty name and the
+// ContinueOnError error handling policy.
+func (f *FlagSet) Init(name string, errorHandling ErrorHandling) {
+	f.name = name
+	f.errorHandling = errorHandling
+	f.argsLenAtDash = -1
+}
diff --git a/vendor/github.com/spf13/pflag/float32.go b/vendor/github.com/spf13/pflag/float32.go
new file mode 100644
index 0000000..a243f81
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/float32.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- float32 Value
+type float32Value float32
+
+func newFloat32Value(val float32, p *float32) *float32Value {
+	*p = val
+	return (*float32Value)(p)
+}
+
+func (f *float32Value) Set(s string) error {
+	v, err := strconv.ParseFloat(s, 32)
+	*f = float32Value(v)
+	return err
+}
+
+func (f *float32Value) Type() string {
+	return "float32"
+}
+
+func (f *float32Value) String() string { return strconv.FormatFloat(float64(*f), 'g', -1, 32) }
+
+func float32Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseFloat(sval, 32)
+	if err != nil {
+		return 0, err
+	}
+	return float32(v), nil
+}
+
+// GetFloat32 return the float32 value of a flag with the given name
+func (f *FlagSet) GetFloat32(name string) (float32, error) {
+	val, err := f.getFlagType(name, "float32", float32Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(float32), nil
+}
+
+// Float32Var defines a float32 flag with specified name, default value, and usage string.
+// The argument p points to a float32 variable in which to store the value of the flag.
+func (f *FlagSet) Float32Var(p *float32, name string, value float32, usage string) {
+	f.VarP(newFloat32Value(value, p), name, "", usage)
+}
+
+// Float32VarP is like Float32Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Float32VarP(p *float32, name, shorthand string, value float32, usage string) {
+	f.VarP(newFloat32Value(value, p), name, shorthand, usage)
+}
+
+// Float32Var defines a float32 flag with specified name, default value, and usage string.
+// The argument p points to a float32 variable in which to store the value of the flag.
+func Float32Var(p *float32, name string, value float32, usage string) {
+	CommandLine.VarP(newFloat32Value(value, p), name, "", usage)
+}
+
+// Float32VarP is like Float32Var, but accepts a shorthand letter that can be used after a single dash.
+func Float32VarP(p *float32, name, shorthand string, value float32, usage string) {
+	CommandLine.VarP(newFloat32Value(value, p), name, shorthand, usage)
+}
+
+// Float32 defines a float32 flag with specified name, default value, and usage string.
+// The return value is the address of a float32 variable that stores the value of the flag.
+func (f *FlagSet) Float32(name string, value float32, usage string) *float32 {
+	p := new(float32)
+	f.Float32VarP(p, name, "", value, usage)
+	return p
+}
+
+// Float32P is like Float32, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Float32P(name, shorthand string, value float32, usage string) *float32 {
+	p := new(float32)
+	f.Float32VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Float32 defines a float32 flag with specified name, default value, and usage string.
+// The return value is the address of a float32 variable that stores the value of the flag.
+func Float32(name string, value float32, usage string) *float32 {
+	return CommandLine.Float32P(name, "", value, usage)
+}
+
+// Float32P is like Float32, but accepts a shorthand letter that can be used after a single dash.
+func Float32P(name, shorthand string, value float32, usage string) *float32 {
+	return CommandLine.Float32P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/float64.go b/vendor/github.com/spf13/pflag/float64.go
new file mode 100644
index 0000000..04b5492
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/float64.go
@@ -0,0 +1,84 @@
+package pflag
+
+import "strconv"
+
+// -- float64 Value
+type float64Value float64
+
+func newFloat64Value(val float64, p *float64) *float64Value {
+	*p = val
+	return (*float64Value)(p)
+}
+
+func (f *float64Value) Set(s string) error {
+	v, err := strconv.ParseFloat(s, 64)
+	*f = float64Value(v)
+	return err
+}
+
+func (f *float64Value) Type() string {
+	return "float64"
+}
+
+func (f *float64Value) String() string { return strconv.FormatFloat(float64(*f), 'g', -1, 64) }
+
+func float64Conv(sval string) (interface{}, error) {
+	return strconv.ParseFloat(sval, 64)
+}
+
+// GetFloat64 return the float64 value of a flag with the given name
+func (f *FlagSet) GetFloat64(name string) (float64, error) {
+	val, err := f.getFlagType(name, "float64", float64Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(float64), nil
+}
+
+// Float64Var defines a float64 flag with specified name, default value, and usage string.
+// The argument p points to a float64 variable in which to store the value of the flag.
+func (f *FlagSet) Float64Var(p *float64, name string, value float64, usage string) {
+	f.VarP(newFloat64Value(value, p), name, "", usage)
+}
+
+// Float64VarP is like Float64Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Float64VarP(p *float64, name, shorthand string, value float64, usage string) {
+	f.VarP(newFloat64Value(value, p), name, shorthand, usage)
+}
+
+// Float64Var defines a float64 flag with specified name, default value, and usage string.
+// The argument p points to a float64 variable in which to store the value of the flag.
+func Float64Var(p *float64, name string, value float64, usage string) {
+	CommandLine.VarP(newFloat64Value(value, p), name, "", usage)
+}
+
+// Float64VarP is like Float64Var, but accepts a shorthand letter that can be used after a single dash.
+func Float64VarP(p *float64, name, shorthand string, value float64, usage string) {
+	CommandLine.VarP(newFloat64Value(value, p), name, shorthand, usage)
+}
+
+// Float64 defines a float64 flag with specified name, default value, and usage string.
+// The return value is the address of a float64 variable that stores the value of the flag.
+func (f *FlagSet) Float64(name string, value float64, usage string) *float64 {
+	p := new(float64)
+	f.Float64VarP(p, name, "", value, usage)
+	return p
+}
+
+// Float64P is like Float64, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Float64P(name, shorthand string, value float64, usage string) *float64 {
+	p := new(float64)
+	f.Float64VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Float64 defines a float64 flag with specified name, default value, and usage string.
+// The return value is the address of a float64 variable that stores the value of the flag.
+func Float64(name string, value float64, usage string) *float64 {
+	return CommandLine.Float64P(name, "", value, usage)
+}
+
+// Float64P is like Float64, but accepts a shorthand letter that can be used after a single dash.
+func Float64P(name, shorthand string, value float64, usage string) *float64 {
+	return CommandLine.Float64P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/golangflag.go b/vendor/github.com/spf13/pflag/golangflag.go
new file mode 100644
index 0000000..d3dd72b
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/golangflag.go
@@ -0,0 +1,105 @@
+// Copyright 2009 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package pflag
+
+import (
+	goflag "flag"
+	"reflect"
+	"strings"
+)
+
+// flagValueWrapper implements pflag.Value around a flag.Value.  The main
+// difference here is the addition of the Type method that returns a string
+// name of the type.  As this is generally unknown, we approximate that with
+// reflection.
+type flagValueWrapper struct {
+	inner    goflag.Value
+	flagType string
+}
+
+// We are just copying the boolFlag interface out of goflag as that is what
+// they use to decide if a flag should get "true" when no arg is given.
+type goBoolFlag interface {
+	goflag.Value
+	IsBoolFlag() bool
+}
+
+func wrapFlagValue(v goflag.Value) Value {
+	// If the flag.Value happens to also be a pflag.Value, just use it directly.
+	if pv, ok := v.(Value); ok {
+		return pv
+	}
+
+	pv := &flagValueWrapper{
+		inner: v,
+	}
+
+	t := reflect.TypeOf(v)
+	if t.Kind() == reflect.Interface || t.Kind() == reflect.Ptr {
+		t = t.Elem()
+	}
+
+	pv.flagType = strings.TrimSuffix(t.Name(), "Value")
+	return pv
+}
+
+func (v *flagValueWrapper) String() string {
+	return v.inner.String()
+}
+
+func (v *flagValueWrapper) Set(s string) error {
+	return v.inner.Set(s)
+}
+
+func (v *flagValueWrapper) Type() string {
+	return v.flagType
+}
+
+// PFlagFromGoFlag will return a *pflag.Flag given a *flag.Flag
+// If the *flag.Flag.Name was a single character (ex: `v`) it will be accessiblei
+// with both `-v` and `--v` in flags. If the golang flag was more than a single
+// character (ex: `verbose`) it will only be accessible via `--verbose`
+func PFlagFromGoFlag(goflag *goflag.Flag) *Flag {
+	// Remember the default value as a string; it won't change.
+	flag := &Flag{
+		Name:  goflag.Name,
+		Usage: goflag.Usage,
+		Value: wrapFlagValue(goflag.Value),
+		// Looks like golang flags don't set DefValue correctly  :-(
+		//DefValue: goflag.DefValue,
+		DefValue: goflag.Value.String(),
+	}
+	// Ex: if the golang flag was -v, allow both -v and --v to work
+	if len(flag.Name) == 1 {
+		flag.Shorthand = flag.Name
+	}
+	if fv, ok := goflag.Value.(goBoolFlag); ok && fv.IsBoolFlag() {
+		flag.NoOptDefVal = "true"
+	}
+	return flag
+}
+
+// AddGoFlag will add the given *flag.Flag to the pflag.FlagSet
+func (f *FlagSet) AddGoFlag(goflag *goflag.Flag) {
+	if f.Lookup(goflag.Name) != nil {
+		return
+	}
+	newflag := PFlagFromGoFlag(goflag)
+	f.AddFlag(newflag)
+}
+
+// AddGoFlagSet will add the given *flag.FlagSet to the pflag.FlagSet
+func (f *FlagSet) AddGoFlagSet(newSet *goflag.FlagSet) {
+	if newSet == nil {
+		return
+	}
+	newSet.VisitAll(func(goflag *goflag.Flag) {
+		f.AddGoFlag(goflag)
+	})
+	if f.addedGoFlagSets == nil {
+		f.addedGoFlagSets = make([]*goflag.FlagSet, 0)
+	}
+	f.addedGoFlagSets = append(f.addedGoFlagSets, newSet)
+}
diff --git a/vendor/github.com/spf13/pflag/int.go b/vendor/github.com/spf13/pflag/int.go
new file mode 100644
index 0000000..1474b89
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/int.go
@@ -0,0 +1,84 @@
+package pflag
+
+import "strconv"
+
+// -- int Value
+type intValue int
+
+func newIntValue(val int, p *int) *intValue {
+	*p = val
+	return (*intValue)(p)
+}
+
+func (i *intValue) Set(s string) error {
+	v, err := strconv.ParseInt(s, 0, 64)
+	*i = intValue(v)
+	return err
+}
+
+func (i *intValue) Type() string {
+	return "int"
+}
+
+func (i *intValue) String() string { return strconv.Itoa(int(*i)) }
+
+func intConv(sval string) (interface{}, error) {
+	return strconv.Atoi(sval)
+}
+
+// GetInt return the int value of a flag with the given name
+func (f *FlagSet) GetInt(name string) (int, error) {
+	val, err := f.getFlagType(name, "int", intConv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(int), nil
+}
+
+// IntVar defines an int flag with specified name, default value, and usage string.
+// The argument p points to an int variable in which to store the value of the flag.
+func (f *FlagSet) IntVar(p *int, name string, value int, usage string) {
+	f.VarP(newIntValue(value, p), name, "", usage)
+}
+
+// IntVarP is like IntVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IntVarP(p *int, name, shorthand string, value int, usage string) {
+	f.VarP(newIntValue(value, p), name, shorthand, usage)
+}
+
+// IntVar defines an int flag with specified name, default value, and usage string.
+// The argument p points to an int variable in which to store the value of the flag.
+func IntVar(p *int, name string, value int, usage string) {
+	CommandLine.VarP(newIntValue(value, p), name, "", usage)
+}
+
+// IntVarP is like IntVar, but accepts a shorthand letter that can be used after a single dash.
+func IntVarP(p *int, name, shorthand string, value int, usage string) {
+	CommandLine.VarP(newIntValue(value, p), name, shorthand, usage)
+}
+
+// Int defines an int flag with specified name, default value, and usage string.
+// The return value is the address of an int variable that stores the value of the flag.
+func (f *FlagSet) Int(name string, value int, usage string) *int {
+	p := new(int)
+	f.IntVarP(p, name, "", value, usage)
+	return p
+}
+
+// IntP is like Int, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IntP(name, shorthand string, value int, usage string) *int {
+	p := new(int)
+	f.IntVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Int defines an int flag with specified name, default value, and usage string.
+// The return value is the address of an int variable that stores the value of the flag.
+func Int(name string, value int, usage string) *int {
+	return CommandLine.IntP(name, "", value, usage)
+}
+
+// IntP is like Int, but accepts a shorthand letter that can be used after a single dash.
+func IntP(name, shorthand string, value int, usage string) *int {
+	return CommandLine.IntP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/int16.go b/vendor/github.com/spf13/pflag/int16.go
new file mode 100644
index 0000000..f1a01d0
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/int16.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- int16 Value
+type int16Value int16
+
+func newInt16Value(val int16, p *int16) *int16Value {
+	*p = val
+	return (*int16Value)(p)
+}
+
+func (i *int16Value) Set(s string) error {
+	v, err := strconv.ParseInt(s, 0, 16)
+	*i = int16Value(v)
+	return err
+}
+
+func (i *int16Value) Type() string {
+	return "int16"
+}
+
+func (i *int16Value) String() string { return strconv.FormatInt(int64(*i), 10) }
+
+func int16Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseInt(sval, 0, 16)
+	if err != nil {
+		return 0, err
+	}
+	return int16(v), nil
+}
+
+// GetInt16 returns the int16 value of a flag with the given name
+func (f *FlagSet) GetInt16(name string) (int16, error) {
+	val, err := f.getFlagType(name, "int16", int16Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(int16), nil
+}
+
+// Int16Var defines an int16 flag with specified name, default value, and usage string.
+// The argument p points to an int16 variable in which to store the value of the flag.
+func (f *FlagSet) Int16Var(p *int16, name string, value int16, usage string) {
+	f.VarP(newInt16Value(value, p), name, "", usage)
+}
+
+// Int16VarP is like Int16Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int16VarP(p *int16, name, shorthand string, value int16, usage string) {
+	f.VarP(newInt16Value(value, p), name, shorthand, usage)
+}
+
+// Int16Var defines an int16 flag with specified name, default value, and usage string.
+// The argument p points to an int16 variable in which to store the value of the flag.
+func Int16Var(p *int16, name string, value int16, usage string) {
+	CommandLine.VarP(newInt16Value(value, p), name, "", usage)
+}
+
+// Int16VarP is like Int16Var, but accepts a shorthand letter that can be used after a single dash.
+func Int16VarP(p *int16, name, shorthand string, value int16, usage string) {
+	CommandLine.VarP(newInt16Value(value, p), name, shorthand, usage)
+}
+
+// Int16 defines an int16 flag with specified name, default value, and usage string.
+// The return value is the address of an int16 variable that stores the value of the flag.
+func (f *FlagSet) Int16(name string, value int16, usage string) *int16 {
+	p := new(int16)
+	f.Int16VarP(p, name, "", value, usage)
+	return p
+}
+
+// Int16P is like Int16, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int16P(name, shorthand string, value int16, usage string) *int16 {
+	p := new(int16)
+	f.Int16VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Int16 defines an int16 flag with specified name, default value, and usage string.
+// The return value is the address of an int16 variable that stores the value of the flag.
+func Int16(name string, value int16, usage string) *int16 {
+	return CommandLine.Int16P(name, "", value, usage)
+}
+
+// Int16P is like Int16, but accepts a shorthand letter that can be used after a single dash.
+func Int16P(name, shorthand string, value int16, usage string) *int16 {
+	return CommandLine.Int16P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/int32.go b/vendor/github.com/spf13/pflag/int32.go
new file mode 100644
index 0000000..9b95944
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/int32.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- int32 Value
+type int32Value int32
+
+func newInt32Value(val int32, p *int32) *int32Value {
+	*p = val
+	return (*int32Value)(p)
+}
+
+func (i *int32Value) Set(s string) error {
+	v, err := strconv.ParseInt(s, 0, 32)
+	*i = int32Value(v)
+	return err
+}
+
+func (i *int32Value) Type() string {
+	return "int32"
+}
+
+func (i *int32Value) String() string { return strconv.FormatInt(int64(*i), 10) }
+
+func int32Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseInt(sval, 0, 32)
+	if err != nil {
+		return 0, err
+	}
+	return int32(v), nil
+}
+
+// GetInt32 return the int32 value of a flag with the given name
+func (f *FlagSet) GetInt32(name string) (int32, error) {
+	val, err := f.getFlagType(name, "int32", int32Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(int32), nil
+}
+
+// Int32Var defines an int32 flag with specified name, default value, and usage string.
+// The argument p points to an int32 variable in which to store the value of the flag.
+func (f *FlagSet) Int32Var(p *int32, name string, value int32, usage string) {
+	f.VarP(newInt32Value(value, p), name, "", usage)
+}
+
+// Int32VarP is like Int32Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int32VarP(p *int32, name, shorthand string, value int32, usage string) {
+	f.VarP(newInt32Value(value, p), name, shorthand, usage)
+}
+
+// Int32Var defines an int32 flag with specified name, default value, and usage string.
+// The argument p points to an int32 variable in which to store the value of the flag.
+func Int32Var(p *int32, name string, value int32, usage string) {
+	CommandLine.VarP(newInt32Value(value, p), name, "", usage)
+}
+
+// Int32VarP is like Int32Var, but accepts a shorthand letter that can be used after a single dash.
+func Int32VarP(p *int32, name, shorthand string, value int32, usage string) {
+	CommandLine.VarP(newInt32Value(value, p), name, shorthand, usage)
+}
+
+// Int32 defines an int32 flag with specified name, default value, and usage string.
+// The return value is the address of an int32 variable that stores the value of the flag.
+func (f *FlagSet) Int32(name string, value int32, usage string) *int32 {
+	p := new(int32)
+	f.Int32VarP(p, name, "", value, usage)
+	return p
+}
+
+// Int32P is like Int32, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int32P(name, shorthand string, value int32, usage string) *int32 {
+	p := new(int32)
+	f.Int32VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Int32 defines an int32 flag with specified name, default value, and usage string.
+// The return value is the address of an int32 variable that stores the value of the flag.
+func Int32(name string, value int32, usage string) *int32 {
+	return CommandLine.Int32P(name, "", value, usage)
+}
+
+// Int32P is like Int32, but accepts a shorthand letter that can be used after a single dash.
+func Int32P(name, shorthand string, value int32, usage string) *int32 {
+	return CommandLine.Int32P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/int64.go b/vendor/github.com/spf13/pflag/int64.go
new file mode 100644
index 0000000..0026d78
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/int64.go
@@ -0,0 +1,84 @@
+package pflag
+
+import "strconv"
+
+// -- int64 Value
+type int64Value int64
+
+func newInt64Value(val int64, p *int64) *int64Value {
+	*p = val
+	return (*int64Value)(p)
+}
+
+func (i *int64Value) Set(s string) error {
+	v, err := strconv.ParseInt(s, 0, 64)
+	*i = int64Value(v)
+	return err
+}
+
+func (i *int64Value) Type() string {
+	return "int64"
+}
+
+func (i *int64Value) String() string { return strconv.FormatInt(int64(*i), 10) }
+
+func int64Conv(sval string) (interface{}, error) {
+	return strconv.ParseInt(sval, 0, 64)
+}
+
+// GetInt64 return the int64 value of a flag with the given name
+func (f *FlagSet) GetInt64(name string) (int64, error) {
+	val, err := f.getFlagType(name, "int64", int64Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(int64), nil
+}
+
+// Int64Var defines an int64 flag with specified name, default value, and usage string.
+// The argument p points to an int64 variable in which to store the value of the flag.
+func (f *FlagSet) Int64Var(p *int64, name string, value int64, usage string) {
+	f.VarP(newInt64Value(value, p), name, "", usage)
+}
+
+// Int64VarP is like Int64Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int64VarP(p *int64, name, shorthand string, value int64, usage string) {
+	f.VarP(newInt64Value(value, p), name, shorthand, usage)
+}
+
+// Int64Var defines an int64 flag with specified name, default value, and usage string.
+// The argument p points to an int64 variable in which to store the value of the flag.
+func Int64Var(p *int64, name string, value int64, usage string) {
+	CommandLine.VarP(newInt64Value(value, p), name, "", usage)
+}
+
+// Int64VarP is like Int64Var, but accepts a shorthand letter that can be used after a single dash.
+func Int64VarP(p *int64, name, shorthand string, value int64, usage string) {
+	CommandLine.VarP(newInt64Value(value, p), name, shorthand, usage)
+}
+
+// Int64 defines an int64 flag with specified name, default value, and usage string.
+// The return value is the address of an int64 variable that stores the value of the flag.
+func (f *FlagSet) Int64(name string, value int64, usage string) *int64 {
+	p := new(int64)
+	f.Int64VarP(p, name, "", value, usage)
+	return p
+}
+
+// Int64P is like Int64, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int64P(name, shorthand string, value int64, usage string) *int64 {
+	p := new(int64)
+	f.Int64VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Int64 defines an int64 flag with specified name, default value, and usage string.
+// The return value is the address of an int64 variable that stores the value of the flag.
+func Int64(name string, value int64, usage string) *int64 {
+	return CommandLine.Int64P(name, "", value, usage)
+}
+
+// Int64P is like Int64, but accepts a shorthand letter that can be used after a single dash.
+func Int64P(name, shorthand string, value int64, usage string) *int64 {
+	return CommandLine.Int64P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/int8.go b/vendor/github.com/spf13/pflag/int8.go
new file mode 100644
index 0000000..4da9222
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/int8.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- int8 Value
+type int8Value int8
+
+func newInt8Value(val int8, p *int8) *int8Value {
+	*p = val
+	return (*int8Value)(p)
+}
+
+func (i *int8Value) Set(s string) error {
+	v, err := strconv.ParseInt(s, 0, 8)
+	*i = int8Value(v)
+	return err
+}
+
+func (i *int8Value) Type() string {
+	return "int8"
+}
+
+func (i *int8Value) String() string { return strconv.FormatInt(int64(*i), 10) }
+
+func int8Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseInt(sval, 0, 8)
+	if err != nil {
+		return 0, err
+	}
+	return int8(v), nil
+}
+
+// GetInt8 return the int8 value of a flag with the given name
+func (f *FlagSet) GetInt8(name string) (int8, error) {
+	val, err := f.getFlagType(name, "int8", int8Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(int8), nil
+}
+
+// Int8Var defines an int8 flag with specified name, default value, and usage string.
+// The argument p points to an int8 variable in which to store the value of the flag.
+func (f *FlagSet) Int8Var(p *int8, name string, value int8, usage string) {
+	f.VarP(newInt8Value(value, p), name, "", usage)
+}
+
+// Int8VarP is like Int8Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int8VarP(p *int8, name, shorthand string, value int8, usage string) {
+	f.VarP(newInt8Value(value, p), name, shorthand, usage)
+}
+
+// Int8Var defines an int8 flag with specified name, default value, and usage string.
+// The argument p points to an int8 variable in which to store the value of the flag.
+func Int8Var(p *int8, name string, value int8, usage string) {
+	CommandLine.VarP(newInt8Value(value, p), name, "", usage)
+}
+
+// Int8VarP is like Int8Var, but accepts a shorthand letter that can be used after a single dash.
+func Int8VarP(p *int8, name, shorthand string, value int8, usage string) {
+	CommandLine.VarP(newInt8Value(value, p), name, shorthand, usage)
+}
+
+// Int8 defines an int8 flag with specified name, default value, and usage string.
+// The return value is the address of an int8 variable that stores the value of the flag.
+func (f *FlagSet) Int8(name string, value int8, usage string) *int8 {
+	p := new(int8)
+	f.Int8VarP(p, name, "", value, usage)
+	return p
+}
+
+// Int8P is like Int8, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Int8P(name, shorthand string, value int8, usage string) *int8 {
+	p := new(int8)
+	f.Int8VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Int8 defines an int8 flag with specified name, default value, and usage string.
+// The return value is the address of an int8 variable that stores the value of the flag.
+func Int8(name string, value int8, usage string) *int8 {
+	return CommandLine.Int8P(name, "", value, usage)
+}
+
+// Int8P is like Int8, but accepts a shorthand letter that can be used after a single dash.
+func Int8P(name, shorthand string, value int8, usage string) *int8 {
+	return CommandLine.Int8P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/int_slice.go b/vendor/github.com/spf13/pflag/int_slice.go
new file mode 100644
index 0000000..1e7c9ed
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/int_slice.go
@@ -0,0 +1,128 @@
+package pflag
+
+import (
+	"fmt"
+	"strconv"
+	"strings"
+)
+
+// -- intSlice Value
+type intSliceValue struct {
+	value   *[]int
+	changed bool
+}
+
+func newIntSliceValue(val []int, p *[]int) *intSliceValue {
+	isv := new(intSliceValue)
+	isv.value = p
+	*isv.value = val
+	return isv
+}
+
+func (s *intSliceValue) Set(val string) error {
+	ss := strings.Split(val, ",")
+	out := make([]int, len(ss))
+	for i, d := range ss {
+		var err error
+		out[i], err = strconv.Atoi(d)
+		if err != nil {
+			return err
+		}
+
+	}
+	if !s.changed {
+		*s.value = out
+	} else {
+		*s.value = append(*s.value, out...)
+	}
+	s.changed = true
+	return nil
+}
+
+func (s *intSliceValue) Type() string {
+	return "intSlice"
+}
+
+func (s *intSliceValue) String() string {
+	out := make([]string, len(*s.value))
+	for i, d := range *s.value {
+		out[i] = fmt.Sprintf("%d", d)
+	}
+	return "[" + strings.Join(out, ",") + "]"
+}
+
+func intSliceConv(val string) (interface{}, error) {
+	val = strings.Trim(val, "[]")
+	// Empty string would cause a slice with one (empty) entry
+	if len(val) == 0 {
+		return []int{}, nil
+	}
+	ss := strings.Split(val, ",")
+	out := make([]int, len(ss))
+	for i, d := range ss {
+		var err error
+		out[i], err = strconv.Atoi(d)
+		if err != nil {
+			return nil, err
+		}
+
+	}
+	return out, nil
+}
+
+// GetIntSlice return the []int value of a flag with the given name
+func (f *FlagSet) GetIntSlice(name string) ([]int, error) {
+	val, err := f.getFlagType(name, "intSlice", intSliceConv)
+	if err != nil {
+		return []int{}, err
+	}
+	return val.([]int), nil
+}
+
+// IntSliceVar defines a intSlice flag with specified name, default value, and usage string.
+// The argument p points to a []int variable in which to store the value of the flag.
+func (f *FlagSet) IntSliceVar(p *[]int, name string, value []int, usage string) {
+	f.VarP(newIntSliceValue(value, p), name, "", usage)
+}
+
+// IntSliceVarP is like IntSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IntSliceVarP(p *[]int, name, shorthand string, value []int, usage string) {
+	f.VarP(newIntSliceValue(value, p), name, shorthand, usage)
+}
+
+// IntSliceVar defines a int[] flag with specified name, default value, and usage string.
+// The argument p points to a int[] variable in which to store the value of the flag.
+func IntSliceVar(p *[]int, name string, value []int, usage string) {
+	CommandLine.VarP(newIntSliceValue(value, p), name, "", usage)
+}
+
+// IntSliceVarP is like IntSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func IntSliceVarP(p *[]int, name, shorthand string, value []int, usage string) {
+	CommandLine.VarP(newIntSliceValue(value, p), name, shorthand, usage)
+}
+
+// IntSlice defines a []int flag with specified name, default value, and usage string.
+// The return value is the address of a []int variable that stores the value of the flag.
+func (f *FlagSet) IntSlice(name string, value []int, usage string) *[]int {
+	p := []int{}
+	f.IntSliceVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// IntSliceP is like IntSlice, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IntSliceP(name, shorthand string, value []int, usage string) *[]int {
+	p := []int{}
+	f.IntSliceVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// IntSlice defines a []int flag with specified name, default value, and usage string.
+// The return value is the address of a []int variable that stores the value of the flag.
+func IntSlice(name string, value []int, usage string) *[]int {
+	return CommandLine.IntSliceP(name, "", value, usage)
+}
+
+// IntSliceP is like IntSlice, but accepts a shorthand letter that can be used after a single dash.
+func IntSliceP(name, shorthand string, value []int, usage string) *[]int {
+	return CommandLine.IntSliceP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/ip.go b/vendor/github.com/spf13/pflag/ip.go
new file mode 100644
index 0000000..3d414ba
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/ip.go
@@ -0,0 +1,94 @@
+package pflag
+
+import (
+	"fmt"
+	"net"
+	"strings"
+)
+
+// -- net.IP value
+type ipValue net.IP
+
+func newIPValue(val net.IP, p *net.IP) *ipValue {
+	*p = val
+	return (*ipValue)(p)
+}
+
+func (i *ipValue) String() string { return net.IP(*i).String() }
+func (i *ipValue) Set(s string) error {
+	ip := net.ParseIP(strings.TrimSpace(s))
+	if ip == nil {
+		return fmt.Errorf("failed to parse IP: %q", s)
+	}
+	*i = ipValue(ip)
+	return nil
+}
+
+func (i *ipValue) Type() string {
+	return "ip"
+}
+
+func ipConv(sval string) (interface{}, error) {
+	ip := net.ParseIP(sval)
+	if ip != nil {
+		return ip, nil
+	}
+	return nil, fmt.Errorf("invalid string being converted to IP address: %s", sval)
+}
+
+// GetIP return the net.IP value of a flag with the given name
+func (f *FlagSet) GetIP(name string) (net.IP, error) {
+	val, err := f.getFlagType(name, "ip", ipConv)
+	if err != nil {
+		return nil, err
+	}
+	return val.(net.IP), nil
+}
+
+// IPVar defines an net.IP flag with specified name, default value, and usage string.
+// The argument p points to an net.IP variable in which to store the value of the flag.
+func (f *FlagSet) IPVar(p *net.IP, name string, value net.IP, usage string) {
+	f.VarP(newIPValue(value, p), name, "", usage)
+}
+
+// IPVarP is like IPVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPVarP(p *net.IP, name, shorthand string, value net.IP, usage string) {
+	f.VarP(newIPValue(value, p), name, shorthand, usage)
+}
+
+// IPVar defines an net.IP flag with specified name, default value, and usage string.
+// The argument p points to an net.IP variable in which to store the value of the flag.
+func IPVar(p *net.IP, name string, value net.IP, usage string) {
+	CommandLine.VarP(newIPValue(value, p), name, "", usage)
+}
+
+// IPVarP is like IPVar, but accepts a shorthand letter that can be used after a single dash.
+func IPVarP(p *net.IP, name, shorthand string, value net.IP, usage string) {
+	CommandLine.VarP(newIPValue(value, p), name, shorthand, usage)
+}
+
+// IP defines an net.IP flag with specified name, default value, and usage string.
+// The return value is the address of an net.IP variable that stores the value of the flag.
+func (f *FlagSet) IP(name string, value net.IP, usage string) *net.IP {
+	p := new(net.IP)
+	f.IPVarP(p, name, "", value, usage)
+	return p
+}
+
+// IPP is like IP, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPP(name, shorthand string, value net.IP, usage string) *net.IP {
+	p := new(net.IP)
+	f.IPVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// IP defines an net.IP flag with specified name, default value, and usage string.
+// The return value is the address of an net.IP variable that stores the value of the flag.
+func IP(name string, value net.IP, usage string) *net.IP {
+	return CommandLine.IPP(name, "", value, usage)
+}
+
+// IPP is like IP, but accepts a shorthand letter that can be used after a single dash.
+func IPP(name, shorthand string, value net.IP, usage string) *net.IP {
+	return CommandLine.IPP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/ip_slice.go b/vendor/github.com/spf13/pflag/ip_slice.go
new file mode 100644
index 0000000..7dd196f
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/ip_slice.go
@@ -0,0 +1,148 @@
+package pflag
+
+import (
+	"fmt"
+	"io"
+	"net"
+	"strings"
+)
+
+// -- ipSlice Value
+type ipSliceValue struct {
+	value   *[]net.IP
+	changed bool
+}
+
+func newIPSliceValue(val []net.IP, p *[]net.IP) *ipSliceValue {
+	ipsv := new(ipSliceValue)
+	ipsv.value = p
+	*ipsv.value = val
+	return ipsv
+}
+
+// Set converts, and assigns, the comma-separated IP argument string representation as the []net.IP value of this flag.
+// If Set is called on a flag that already has a []net.IP assigned, the newly converted values will be appended.
+func (s *ipSliceValue) Set(val string) error {
+
+	// remove all quote characters
+	rmQuote := strings.NewReplacer(`"`, "", `'`, "", "`", "")
+
+	// read flag arguments with CSV parser
+	ipStrSlice, err := readAsCSV(rmQuote.Replace(val))
+	if err != nil && err != io.EOF {
+		return err
+	}
+
+	// parse ip values into slice
+	out := make([]net.IP, 0, len(ipStrSlice))
+	for _, ipStr := range ipStrSlice {
+		ip := net.ParseIP(strings.TrimSpace(ipStr))
+		if ip == nil {
+			return fmt.Errorf("invalid string being converted to IP address: %s", ipStr)
+		}
+		out = append(out, ip)
+	}
+
+	if !s.changed {
+		*s.value = out
+	} else {
+		*s.value = append(*s.value, out...)
+	}
+
+	s.changed = true
+
+	return nil
+}
+
+// Type returns a string that uniquely represents this flag's type.
+func (s *ipSliceValue) Type() string {
+	return "ipSlice"
+}
+
+// String defines a "native" format for this net.IP slice flag value.
+func (s *ipSliceValue) String() string {
+
+	ipStrSlice := make([]string, len(*s.value))
+	for i, ip := range *s.value {
+		ipStrSlice[i] = ip.String()
+	}
+
+	out, _ := writeAsCSV(ipStrSlice)
+
+	return "[" + out + "]"
+}
+
+func ipSliceConv(val string) (interface{}, error) {
+	val = strings.Trim(val, "[]")
+	// Emtpy string would cause a slice with one (empty) entry
+	if len(val) == 0 {
+		return []net.IP{}, nil
+	}
+	ss := strings.Split(val, ",")
+	out := make([]net.IP, len(ss))
+	for i, sval := range ss {
+		ip := net.ParseIP(strings.TrimSpace(sval))
+		if ip == nil {
+			return nil, fmt.Errorf("invalid string being converted to IP address: %s", sval)
+		}
+		out[i] = ip
+	}
+	return out, nil
+}
+
+// GetIPSlice returns the []net.IP value of a flag with the given name
+func (f *FlagSet) GetIPSlice(name string) ([]net.IP, error) {
+	val, err := f.getFlagType(name, "ipSlice", ipSliceConv)
+	if err != nil {
+		return []net.IP{}, err
+	}
+	return val.([]net.IP), nil
+}
+
+// IPSliceVar defines a ipSlice flag with specified name, default value, and usage string.
+// The argument p points to a []net.IP variable in which to store the value of the flag.
+func (f *FlagSet) IPSliceVar(p *[]net.IP, name string, value []net.IP, usage string) {
+	f.VarP(newIPSliceValue(value, p), name, "", usage)
+}
+
+// IPSliceVarP is like IPSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPSliceVarP(p *[]net.IP, name, shorthand string, value []net.IP, usage string) {
+	f.VarP(newIPSliceValue(value, p), name, shorthand, usage)
+}
+
+// IPSliceVar defines a []net.IP flag with specified name, default value, and usage string.
+// The argument p points to a []net.IP variable in which to store the value of the flag.
+func IPSliceVar(p *[]net.IP, name string, value []net.IP, usage string) {
+	CommandLine.VarP(newIPSliceValue(value, p), name, "", usage)
+}
+
+// IPSliceVarP is like IPSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func IPSliceVarP(p *[]net.IP, name, shorthand string, value []net.IP, usage string) {
+	CommandLine.VarP(newIPSliceValue(value, p), name, shorthand, usage)
+}
+
+// IPSlice defines a []net.IP flag with specified name, default value, and usage string.
+// The return value is the address of a []net.IP variable that stores the value of that flag.
+func (f *FlagSet) IPSlice(name string, value []net.IP, usage string) *[]net.IP {
+	p := []net.IP{}
+	f.IPSliceVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// IPSliceP is like IPSlice, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPSliceP(name, shorthand string, value []net.IP, usage string) *[]net.IP {
+	p := []net.IP{}
+	f.IPSliceVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// IPSlice defines a []net.IP flag with specified name, default value, and usage string.
+// The return value is the address of a []net.IP variable that stores the value of the flag.
+func IPSlice(name string, value []net.IP, usage string) *[]net.IP {
+	return CommandLine.IPSliceP(name, "", value, usage)
+}
+
+// IPSliceP is like IPSlice, but accepts a shorthand letter that can be used after a single dash.
+func IPSliceP(name, shorthand string, value []net.IP, usage string) *[]net.IP {
+	return CommandLine.IPSliceP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/ipmask.go b/vendor/github.com/spf13/pflag/ipmask.go
new file mode 100644
index 0000000..5bd44bd
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/ipmask.go
@@ -0,0 +1,122 @@
+package pflag
+
+import (
+	"fmt"
+	"net"
+	"strconv"
+)
+
+// -- net.IPMask value
+type ipMaskValue net.IPMask
+
+func newIPMaskValue(val net.IPMask, p *net.IPMask) *ipMaskValue {
+	*p = val
+	return (*ipMaskValue)(p)
+}
+
+func (i *ipMaskValue) String() string { return net.IPMask(*i).String() }
+func (i *ipMaskValue) Set(s string) error {
+	ip := ParseIPv4Mask(s)
+	if ip == nil {
+		return fmt.Errorf("failed to parse IP mask: %q", s)
+	}
+	*i = ipMaskValue(ip)
+	return nil
+}
+
+func (i *ipMaskValue) Type() string {
+	return "ipMask"
+}
+
+// ParseIPv4Mask written in IP form (e.g. 255.255.255.0).
+// This function should really belong to the net package.
+func ParseIPv4Mask(s string) net.IPMask {
+	mask := net.ParseIP(s)
+	if mask == nil {
+		if len(s) != 8 {
+			return nil
+		}
+		// net.IPMask.String() actually outputs things like ffffff00
+		// so write a horrible parser for that as well  :-(
+		m := []int{}
+		for i := 0; i < 4; i++ {
+			b := "0x" + s[2*i:2*i+2]
+			d, err := strconv.ParseInt(b, 0, 0)
+			if err != nil {
+				return nil
+			}
+			m = append(m, int(d))
+		}
+		s := fmt.Sprintf("%d.%d.%d.%d", m[0], m[1], m[2], m[3])
+		mask = net.ParseIP(s)
+		if mask == nil {
+			return nil
+		}
+	}
+	return net.IPv4Mask(mask[12], mask[13], mask[14], mask[15])
+}
+
+func parseIPv4Mask(sval string) (interface{}, error) {
+	mask := ParseIPv4Mask(sval)
+	if mask == nil {
+		return nil, fmt.Errorf("unable to parse %s as net.IPMask", sval)
+	}
+	return mask, nil
+}
+
+// GetIPv4Mask return the net.IPv4Mask value of a flag with the given name
+func (f *FlagSet) GetIPv4Mask(name string) (net.IPMask, error) {
+	val, err := f.getFlagType(name, "ipMask", parseIPv4Mask)
+	if err != nil {
+		return nil, err
+	}
+	return val.(net.IPMask), nil
+}
+
+// IPMaskVar defines an net.IPMask flag with specified name, default value, and usage string.
+// The argument p points to an net.IPMask variable in which to store the value of the flag.
+func (f *FlagSet) IPMaskVar(p *net.IPMask, name string, value net.IPMask, usage string) {
+	f.VarP(newIPMaskValue(value, p), name, "", usage)
+}
+
+// IPMaskVarP is like IPMaskVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPMaskVarP(p *net.IPMask, name, shorthand string, value net.IPMask, usage string) {
+	f.VarP(newIPMaskValue(value, p), name, shorthand, usage)
+}
+
+// IPMaskVar defines an net.IPMask flag with specified name, default value, and usage string.
+// The argument p points to an net.IPMask variable in which to store the value of the flag.
+func IPMaskVar(p *net.IPMask, name string, value net.IPMask, usage string) {
+	CommandLine.VarP(newIPMaskValue(value, p), name, "", usage)
+}
+
+// IPMaskVarP is like IPMaskVar, but accepts a shorthand letter that can be used after a single dash.
+func IPMaskVarP(p *net.IPMask, name, shorthand string, value net.IPMask, usage string) {
+	CommandLine.VarP(newIPMaskValue(value, p), name, shorthand, usage)
+}
+
+// IPMask defines an net.IPMask flag with specified name, default value, and usage string.
+// The return value is the address of an net.IPMask variable that stores the value of the flag.
+func (f *FlagSet) IPMask(name string, value net.IPMask, usage string) *net.IPMask {
+	p := new(net.IPMask)
+	f.IPMaskVarP(p, name, "", value, usage)
+	return p
+}
+
+// IPMaskP is like IPMask, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPMaskP(name, shorthand string, value net.IPMask, usage string) *net.IPMask {
+	p := new(net.IPMask)
+	f.IPMaskVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// IPMask defines an net.IPMask flag with specified name, default value, and usage string.
+// The return value is the address of an net.IPMask variable that stores the value of the flag.
+func IPMask(name string, value net.IPMask, usage string) *net.IPMask {
+	return CommandLine.IPMaskP(name, "", value, usage)
+}
+
+// IPMaskP is like IP, but accepts a shorthand letter that can be used after a single dash.
+func IPMaskP(name, shorthand string, value net.IPMask, usage string) *net.IPMask {
+	return CommandLine.IPMaskP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/ipnet.go b/vendor/github.com/spf13/pflag/ipnet.go
new file mode 100644
index 0000000..e2c1b8b
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/ipnet.go
@@ -0,0 +1,98 @@
+package pflag
+
+import (
+	"fmt"
+	"net"
+	"strings"
+)
+
+// IPNet adapts net.IPNet for use as a flag.
+type ipNetValue net.IPNet
+
+func (ipnet ipNetValue) String() string {
+	n := net.IPNet(ipnet)
+	return n.String()
+}
+
+func (ipnet *ipNetValue) Set(value string) error {
+	_, n, err := net.ParseCIDR(strings.TrimSpace(value))
+	if err != nil {
+		return err
+	}
+	*ipnet = ipNetValue(*n)
+	return nil
+}
+
+func (*ipNetValue) Type() string {
+	return "ipNet"
+}
+
+func newIPNetValue(val net.IPNet, p *net.IPNet) *ipNetValue {
+	*p = val
+	return (*ipNetValue)(p)
+}
+
+func ipNetConv(sval string) (interface{}, error) {
+	_, n, err := net.ParseCIDR(strings.TrimSpace(sval))
+	if err == nil {
+		return *n, nil
+	}
+	return nil, fmt.Errorf("invalid string being converted to IPNet: %s", sval)
+}
+
+// GetIPNet return the net.IPNet value of a flag with the given name
+func (f *FlagSet) GetIPNet(name string) (net.IPNet, error) {
+	val, err := f.getFlagType(name, "ipNet", ipNetConv)
+	if err != nil {
+		return net.IPNet{}, err
+	}
+	return val.(net.IPNet), nil
+}
+
+// IPNetVar defines an net.IPNet flag with specified name, default value, and usage string.
+// The argument p points to an net.IPNet variable in which to store the value of the flag.
+func (f *FlagSet) IPNetVar(p *net.IPNet, name string, value net.IPNet, usage string) {
+	f.VarP(newIPNetValue(value, p), name, "", usage)
+}
+
+// IPNetVarP is like IPNetVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPNetVarP(p *net.IPNet, name, shorthand string, value net.IPNet, usage string) {
+	f.VarP(newIPNetValue(value, p), name, shorthand, usage)
+}
+
+// IPNetVar defines an net.IPNet flag with specified name, default value, and usage string.
+// The argument p points to an net.IPNet variable in which to store the value of the flag.
+func IPNetVar(p *net.IPNet, name string, value net.IPNet, usage string) {
+	CommandLine.VarP(newIPNetValue(value, p), name, "", usage)
+}
+
+// IPNetVarP is like IPNetVar, but accepts a shorthand letter that can be used after a single dash.
+func IPNetVarP(p *net.IPNet, name, shorthand string, value net.IPNet, usage string) {
+	CommandLine.VarP(newIPNetValue(value, p), name, shorthand, usage)
+}
+
+// IPNet defines an net.IPNet flag with specified name, default value, and usage string.
+// The return value is the address of an net.IPNet variable that stores the value of the flag.
+func (f *FlagSet) IPNet(name string, value net.IPNet, usage string) *net.IPNet {
+	p := new(net.IPNet)
+	f.IPNetVarP(p, name, "", value, usage)
+	return p
+}
+
+// IPNetP is like IPNet, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) IPNetP(name, shorthand string, value net.IPNet, usage string) *net.IPNet {
+	p := new(net.IPNet)
+	f.IPNetVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// IPNet defines an net.IPNet flag with specified name, default value, and usage string.
+// The return value is the address of an net.IPNet variable that stores the value of the flag.
+func IPNet(name string, value net.IPNet, usage string) *net.IPNet {
+	return CommandLine.IPNetP(name, "", value, usage)
+}
+
+// IPNetP is like IPNet, but accepts a shorthand letter that can be used after a single dash.
+func IPNetP(name, shorthand string, value net.IPNet, usage string) *net.IPNet {
+	return CommandLine.IPNetP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/string.go b/vendor/github.com/spf13/pflag/string.go
new file mode 100644
index 0000000..04e0a26
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/string.go
@@ -0,0 +1,80 @@
+package pflag
+
+// -- string Value
+type stringValue string
+
+func newStringValue(val string, p *string) *stringValue {
+	*p = val
+	return (*stringValue)(p)
+}
+
+func (s *stringValue) Set(val string) error {
+	*s = stringValue(val)
+	return nil
+}
+func (s *stringValue) Type() string {
+	return "string"
+}
+
+func (s *stringValue) String() string { return string(*s) }
+
+func stringConv(sval string) (interface{}, error) {
+	return sval, nil
+}
+
+// GetString return the string value of a flag with the given name
+func (f *FlagSet) GetString(name string) (string, error) {
+	val, err := f.getFlagType(name, "string", stringConv)
+	if err != nil {
+		return "", err
+	}
+	return val.(string), nil
+}
+
+// StringVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a string variable in which to store the value of the flag.
+func (f *FlagSet) StringVar(p *string, name string, value string, usage string) {
+	f.VarP(newStringValue(value, p), name, "", usage)
+}
+
+// StringVarP is like StringVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringVarP(p *string, name, shorthand string, value string, usage string) {
+	f.VarP(newStringValue(value, p), name, shorthand, usage)
+}
+
+// StringVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a string variable in which to store the value of the flag.
+func StringVar(p *string, name string, value string, usage string) {
+	CommandLine.VarP(newStringValue(value, p), name, "", usage)
+}
+
+// StringVarP is like StringVar, but accepts a shorthand letter that can be used after a single dash.
+func StringVarP(p *string, name, shorthand string, value string, usage string) {
+	CommandLine.VarP(newStringValue(value, p), name, shorthand, usage)
+}
+
+// String defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a string variable that stores the value of the flag.
+func (f *FlagSet) String(name string, value string, usage string) *string {
+	p := new(string)
+	f.StringVarP(p, name, "", value, usage)
+	return p
+}
+
+// StringP is like String, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringP(name, shorthand string, value string, usage string) *string {
+	p := new(string)
+	f.StringVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// String defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a string variable that stores the value of the flag.
+func String(name string, value string, usage string) *string {
+	return CommandLine.StringP(name, "", value, usage)
+}
+
+// StringP is like String, but accepts a shorthand letter that can be used after a single dash.
+func StringP(name, shorthand string, value string, usage string) *string {
+	return CommandLine.StringP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/string_array.go b/vendor/github.com/spf13/pflag/string_array.go
new file mode 100644
index 0000000..fa7bc60
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/string_array.go
@@ -0,0 +1,103 @@
+package pflag
+
+// -- stringArray Value
+type stringArrayValue struct {
+	value   *[]string
+	changed bool
+}
+
+func newStringArrayValue(val []string, p *[]string) *stringArrayValue {
+	ssv := new(stringArrayValue)
+	ssv.value = p
+	*ssv.value = val
+	return ssv
+}
+
+func (s *stringArrayValue) Set(val string) error {
+	if !s.changed {
+		*s.value = []string{val}
+		s.changed = true
+	} else {
+		*s.value = append(*s.value, val)
+	}
+	return nil
+}
+
+func (s *stringArrayValue) Type() string {
+	return "stringArray"
+}
+
+func (s *stringArrayValue) String() string {
+	str, _ := writeAsCSV(*s.value)
+	return "[" + str + "]"
+}
+
+func stringArrayConv(sval string) (interface{}, error) {
+	sval = sval[1 : len(sval)-1]
+	// An empty string would cause a array with one (empty) string
+	if len(sval) == 0 {
+		return []string{}, nil
+	}
+	return readAsCSV(sval)
+}
+
+// GetStringArray return the []string value of a flag with the given name
+func (f *FlagSet) GetStringArray(name string) ([]string, error) {
+	val, err := f.getFlagType(name, "stringArray", stringArrayConv)
+	if err != nil {
+		return []string{}, err
+	}
+	return val.([]string), nil
+}
+
+// StringArrayVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a []string variable in which to store the values of the multiple flags.
+// The value of each argument will not try to be separated by comma. Use a StringSlice for that.
+func (f *FlagSet) StringArrayVar(p *[]string, name string, value []string, usage string) {
+	f.VarP(newStringArrayValue(value, p), name, "", usage)
+}
+
+// StringArrayVarP is like StringArrayVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringArrayVarP(p *[]string, name, shorthand string, value []string, usage string) {
+	f.VarP(newStringArrayValue(value, p), name, shorthand, usage)
+}
+
+// StringArrayVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a []string variable in which to store the value of the flag.
+// The value of each argument will not try to be separated by comma. Use a StringSlice for that.
+func StringArrayVar(p *[]string, name string, value []string, usage string) {
+	CommandLine.VarP(newStringArrayValue(value, p), name, "", usage)
+}
+
+// StringArrayVarP is like StringArrayVar, but accepts a shorthand letter that can be used after a single dash.
+func StringArrayVarP(p *[]string, name, shorthand string, value []string, usage string) {
+	CommandLine.VarP(newStringArrayValue(value, p), name, shorthand, usage)
+}
+
+// StringArray defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a []string variable that stores the value of the flag.
+// The value of each argument will not try to be separated by comma. Use a StringSlice for that.
+func (f *FlagSet) StringArray(name string, value []string, usage string) *[]string {
+	p := []string{}
+	f.StringArrayVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// StringArrayP is like StringArray, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringArrayP(name, shorthand string, value []string, usage string) *[]string {
+	p := []string{}
+	f.StringArrayVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// StringArray defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a []string variable that stores the value of the flag.
+// The value of each argument will not try to be separated by comma. Use a StringSlice for that.
+func StringArray(name string, value []string, usage string) *[]string {
+	return CommandLine.StringArrayP(name, "", value, usage)
+}
+
+// StringArrayP is like StringArray, but accepts a shorthand letter that can be used after a single dash.
+func StringArrayP(name, shorthand string, value []string, usage string) *[]string {
+	return CommandLine.StringArrayP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/string_slice.go b/vendor/github.com/spf13/pflag/string_slice.go
new file mode 100644
index 0000000..0cd3ccc
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/string_slice.go
@@ -0,0 +1,149 @@
+package pflag
+
+import (
+	"bytes"
+	"encoding/csv"
+	"strings"
+)
+
+// -- stringSlice Value
+type stringSliceValue struct {
+	value   *[]string
+	changed bool
+}
+
+func newStringSliceValue(val []string, p *[]string) *stringSliceValue {
+	ssv := new(stringSliceValue)
+	ssv.value = p
+	*ssv.value = val
+	return ssv
+}
+
+func readAsCSV(val string) ([]string, error) {
+	if val == "" {
+		return []string{}, nil
+	}
+	stringReader := strings.NewReader(val)
+	csvReader := csv.NewReader(stringReader)
+	return csvReader.Read()
+}
+
+func writeAsCSV(vals []string) (string, error) {
+	b := &bytes.Buffer{}
+	w := csv.NewWriter(b)
+	err := w.Write(vals)
+	if err != nil {
+		return "", err
+	}
+	w.Flush()
+	return strings.TrimSuffix(b.String(), "\n"), nil
+}
+
+func (s *stringSliceValue) Set(val string) error {
+	v, err := readAsCSV(val)
+	if err != nil {
+		return err
+	}
+	if !s.changed {
+		*s.value = v
+	} else {
+		*s.value = append(*s.value, v...)
+	}
+	s.changed = true
+	return nil
+}
+
+func (s *stringSliceValue) Type() string {
+	return "stringSlice"
+}
+
+func (s *stringSliceValue) String() string {
+	str, _ := writeAsCSV(*s.value)
+	return "[" + str + "]"
+}
+
+func stringSliceConv(sval string) (interface{}, error) {
+	sval = sval[1 : len(sval)-1]
+	// An empty string would cause a slice with one (empty) string
+	if len(sval) == 0 {
+		return []string{}, nil
+	}
+	return readAsCSV(sval)
+}
+
+// GetStringSlice return the []string value of a flag with the given name
+func (f *FlagSet) GetStringSlice(name string) ([]string, error) {
+	val, err := f.getFlagType(name, "stringSlice", stringSliceConv)
+	if err != nil {
+		return []string{}, err
+	}
+	return val.([]string), nil
+}
+
+// StringSliceVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a []string variable in which to store the value of the flag.
+// Compared to StringArray flags, StringSlice flags take comma-separated value as arguments and split them accordingly.
+// For example:
+//   --ss="v1,v2" -ss="v3"
+// will result in
+//   []string{"v1", "v2", "v3"}
+func (f *FlagSet) StringSliceVar(p *[]string, name string, value []string, usage string) {
+	f.VarP(newStringSliceValue(value, p), name, "", usage)
+}
+
+// StringSliceVarP is like StringSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringSliceVarP(p *[]string, name, shorthand string, value []string, usage string) {
+	f.VarP(newStringSliceValue(value, p), name, shorthand, usage)
+}
+
+// StringSliceVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a []string variable in which to store the value of the flag.
+// Compared to StringArray flags, StringSlice flags take comma-separated value as arguments and split them accordingly.
+// For example:
+//   --ss="v1,v2" -ss="v3"
+// will result in
+//   []string{"v1", "v2", "v3"}
+func StringSliceVar(p *[]string, name string, value []string, usage string) {
+	CommandLine.VarP(newStringSliceValue(value, p), name, "", usage)
+}
+
+// StringSliceVarP is like StringSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func StringSliceVarP(p *[]string, name, shorthand string, value []string, usage string) {
+	CommandLine.VarP(newStringSliceValue(value, p), name, shorthand, usage)
+}
+
+// StringSlice defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a []string variable that stores the value of the flag.
+// Compared to StringArray flags, StringSlice flags take comma-separated value as arguments and split them accordingly.
+// For example:
+//   --ss="v1,v2" -ss="v3"
+// will result in
+//   []string{"v1", "v2", "v3"}
+func (f *FlagSet) StringSlice(name string, value []string, usage string) *[]string {
+	p := []string{}
+	f.StringSliceVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// StringSliceP is like StringSlice, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringSliceP(name, shorthand string, value []string, usage string) *[]string {
+	p := []string{}
+	f.StringSliceVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// StringSlice defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a []string variable that stores the value of the flag.
+// Compared to StringArray flags, StringSlice flags take comma-separated value as arguments and split them accordingly.
+// For example:
+//   --ss="v1,v2" -ss="v3"
+// will result in
+//   []string{"v1", "v2", "v3"}
+func StringSlice(name string, value []string, usage string) *[]string {
+	return CommandLine.StringSliceP(name, "", value, usage)
+}
+
+// StringSliceP is like StringSlice, but accepts a shorthand letter that can be used after a single dash.
+func StringSliceP(name, shorthand string, value []string, usage string) *[]string {
+	return CommandLine.StringSliceP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/string_to_int.go b/vendor/github.com/spf13/pflag/string_to_int.go
new file mode 100644
index 0000000..5ceda39
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/string_to_int.go
@@ -0,0 +1,149 @@
+package pflag
+
+import (
+	"bytes"
+	"fmt"
+	"strconv"
+	"strings"
+)
+
+// -- stringToInt Value
+type stringToIntValue struct {
+	value   *map[string]int
+	changed bool
+}
+
+func newStringToIntValue(val map[string]int, p *map[string]int) *stringToIntValue {
+	ssv := new(stringToIntValue)
+	ssv.value = p
+	*ssv.value = val
+	return ssv
+}
+
+// Format: a=1,b=2
+func (s *stringToIntValue) Set(val string) error {
+	ss := strings.Split(val, ",")
+	out := make(map[string]int, len(ss))
+	for _, pair := range ss {
+		kv := strings.SplitN(pair, "=", 2)
+		if len(kv) != 2 {
+			return fmt.Errorf("%s must be formatted as key=value", pair)
+		}
+		var err error
+		out[kv[0]], err = strconv.Atoi(kv[1])
+		if err != nil {
+			return err
+		}
+	}
+	if !s.changed {
+		*s.value = out
+	} else {
+		for k, v := range out {
+			(*s.value)[k] = v
+		}
+	}
+	s.changed = true
+	return nil
+}
+
+func (s *stringToIntValue) Type() string {
+	return "stringToInt"
+}
+
+func (s *stringToIntValue) String() string {
+	var buf bytes.Buffer
+	i := 0
+	for k, v := range *s.value {
+		if i > 0 {
+			buf.WriteRune(',')
+		}
+		buf.WriteString(k)
+		buf.WriteRune('=')
+		buf.WriteString(strconv.Itoa(v))
+		i++
+	}
+	return "[" + buf.String() + "]"
+}
+
+func stringToIntConv(val string) (interface{}, error) {
+	val = strings.Trim(val, "[]")
+	// An empty string would cause an empty map
+	if len(val) == 0 {
+		return map[string]int{}, nil
+	}
+	ss := strings.Split(val, ",")
+	out := make(map[string]int, len(ss))
+	for _, pair := range ss {
+		kv := strings.SplitN(pair, "=", 2)
+		if len(kv) != 2 {
+			return nil, fmt.Errorf("%s must be formatted as key=value", pair)
+		}
+		var err error
+		out[kv[0]], err = strconv.Atoi(kv[1])
+		if err != nil {
+			return nil, err
+		}
+	}
+	return out, nil
+}
+
+// GetStringToInt return the map[string]int value of a flag with the given name
+func (f *FlagSet) GetStringToInt(name string) (map[string]int, error) {
+	val, err := f.getFlagType(name, "stringToInt", stringToIntConv)
+	if err != nil {
+		return map[string]int{}, err
+	}
+	return val.(map[string]int), nil
+}
+
+// StringToIntVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a map[string]int variable in which to store the values of the multiple flags.
+// The value of each argument will not try to be separated by comma
+func (f *FlagSet) StringToIntVar(p *map[string]int, name string, value map[string]int, usage string) {
+	f.VarP(newStringToIntValue(value, p), name, "", usage)
+}
+
+// StringToIntVarP is like StringToIntVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringToIntVarP(p *map[string]int, name, shorthand string, value map[string]int, usage string) {
+	f.VarP(newStringToIntValue(value, p), name, shorthand, usage)
+}
+
+// StringToIntVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a map[string]int variable in which to store the value of the flag.
+// The value of each argument will not try to be separated by comma
+func StringToIntVar(p *map[string]int, name string, value map[string]int, usage string) {
+	CommandLine.VarP(newStringToIntValue(value, p), name, "", usage)
+}
+
+// StringToIntVarP is like StringToIntVar, but accepts a shorthand letter that can be used after a single dash.
+func StringToIntVarP(p *map[string]int, name, shorthand string, value map[string]int, usage string) {
+	CommandLine.VarP(newStringToIntValue(value, p), name, shorthand, usage)
+}
+
+// StringToInt defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a map[string]int variable that stores the value of the flag.
+// The value of each argument will not try to be separated by comma
+func (f *FlagSet) StringToInt(name string, value map[string]int, usage string) *map[string]int {
+	p := map[string]int{}
+	f.StringToIntVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// StringToIntP is like StringToInt, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringToIntP(name, shorthand string, value map[string]int, usage string) *map[string]int {
+	p := map[string]int{}
+	f.StringToIntVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// StringToInt defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a map[string]int variable that stores the value of the flag.
+// The value of each argument will not try to be separated by comma
+func StringToInt(name string, value map[string]int, usage string) *map[string]int {
+	return CommandLine.StringToIntP(name, "", value, usage)
+}
+
+// StringToIntP is like StringToInt, but accepts a shorthand letter that can be used after a single dash.
+func StringToIntP(name, shorthand string, value map[string]int, usage string) *map[string]int {
+	return CommandLine.StringToIntP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/string_to_string.go b/vendor/github.com/spf13/pflag/string_to_string.go
new file mode 100644
index 0000000..890a01a
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/string_to_string.go
@@ -0,0 +1,160 @@
+package pflag
+
+import (
+	"bytes"
+	"encoding/csv"
+	"fmt"
+	"strings"
+)
+
+// -- stringToString Value
+type stringToStringValue struct {
+	value   *map[string]string
+	changed bool
+}
+
+func newStringToStringValue(val map[string]string, p *map[string]string) *stringToStringValue {
+	ssv := new(stringToStringValue)
+	ssv.value = p
+	*ssv.value = val
+	return ssv
+}
+
+// Format: a=1,b=2
+func (s *stringToStringValue) Set(val string) error {
+	var ss []string
+	n := strings.Count(val, "=")
+	switch n {
+	case 0:
+		return fmt.Errorf("%s must be formatted as key=value", val)
+	case 1:
+		ss = append(ss, strings.Trim(val, `"`))
+	default:
+		r := csv.NewReader(strings.NewReader(val))
+		var err error
+		ss, err = r.Read()
+		if err != nil {
+			return err
+		}
+	}
+
+	out := make(map[string]string, len(ss))
+	for _, pair := range ss {
+		kv := strings.SplitN(pair, "=", 2)
+		if len(kv) != 2 {
+			return fmt.Errorf("%s must be formatted as key=value", pair)
+		}
+		out[kv[0]] = kv[1]
+	}
+	if !s.changed {
+		*s.value = out
+	} else {
+		for k, v := range out {
+			(*s.value)[k] = v
+		}
+	}
+	s.changed = true
+	return nil
+}
+
+func (s *stringToStringValue) Type() string {
+	return "stringToString"
+}
+
+func (s *stringToStringValue) String() string {
+	records := make([]string, 0, len(*s.value)>>1)
+	for k, v := range *s.value {
+		records = append(records, k+"="+v)
+	}
+
+	var buf bytes.Buffer
+	w := csv.NewWriter(&buf)
+	if err := w.Write(records); err != nil {
+		panic(err)
+	}
+	w.Flush()
+	return "[" + strings.TrimSpace(buf.String()) + "]"
+}
+
+func stringToStringConv(val string) (interface{}, error) {
+	val = strings.Trim(val, "[]")
+	// An empty string would cause an empty map
+	if len(val) == 0 {
+		return map[string]string{}, nil
+	}
+	r := csv.NewReader(strings.NewReader(val))
+	ss, err := r.Read()
+	if err != nil {
+		return nil, err
+	}
+	out := make(map[string]string, len(ss))
+	for _, pair := range ss {
+		kv := strings.SplitN(pair, "=", 2)
+		if len(kv) != 2 {
+			return nil, fmt.Errorf("%s must be formatted as key=value", pair)
+		}
+		out[kv[0]] = kv[1]
+	}
+	return out, nil
+}
+
+// GetStringToString return the map[string]string value of a flag with the given name
+func (f *FlagSet) GetStringToString(name string) (map[string]string, error) {
+	val, err := f.getFlagType(name, "stringToString", stringToStringConv)
+	if err != nil {
+		return map[string]string{}, err
+	}
+	return val.(map[string]string), nil
+}
+
+// StringToStringVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a map[string]string variable in which to store the values of the multiple flags.
+// The value of each argument will not try to be separated by comma
+func (f *FlagSet) StringToStringVar(p *map[string]string, name string, value map[string]string, usage string) {
+	f.VarP(newStringToStringValue(value, p), name, "", usage)
+}
+
+// StringToStringVarP is like StringToStringVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringToStringVarP(p *map[string]string, name, shorthand string, value map[string]string, usage string) {
+	f.VarP(newStringToStringValue(value, p), name, shorthand, usage)
+}
+
+// StringToStringVar defines a string flag with specified name, default value, and usage string.
+// The argument p points to a map[string]string variable in which to store the value of the flag.
+// The value of each argument will not try to be separated by comma
+func StringToStringVar(p *map[string]string, name string, value map[string]string, usage string) {
+	CommandLine.VarP(newStringToStringValue(value, p), name, "", usage)
+}
+
+// StringToStringVarP is like StringToStringVar, but accepts a shorthand letter that can be used after a single dash.
+func StringToStringVarP(p *map[string]string, name, shorthand string, value map[string]string, usage string) {
+	CommandLine.VarP(newStringToStringValue(value, p), name, shorthand, usage)
+}
+
+// StringToString defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a map[string]string variable that stores the value of the flag.
+// The value of each argument will not try to be separated by comma
+func (f *FlagSet) StringToString(name string, value map[string]string, usage string) *map[string]string {
+	p := map[string]string{}
+	f.StringToStringVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// StringToStringP is like StringToString, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) StringToStringP(name, shorthand string, value map[string]string, usage string) *map[string]string {
+	p := map[string]string{}
+	f.StringToStringVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// StringToString defines a string flag with specified name, default value, and usage string.
+// The return value is the address of a map[string]string variable that stores the value of the flag.
+// The value of each argument will not try to be separated by comma
+func StringToString(name string, value map[string]string, usage string) *map[string]string {
+	return CommandLine.StringToStringP(name, "", value, usage)
+}
+
+// StringToStringP is like StringToString, but accepts a shorthand letter that can be used after a single dash.
+func StringToStringP(name, shorthand string, value map[string]string, usage string) *map[string]string {
+	return CommandLine.StringToStringP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/uint.go b/vendor/github.com/spf13/pflag/uint.go
new file mode 100644
index 0000000..dcbc2b7
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/uint.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- uint Value
+type uintValue uint
+
+func newUintValue(val uint, p *uint) *uintValue {
+	*p = val
+	return (*uintValue)(p)
+}
+
+func (i *uintValue) Set(s string) error {
+	v, err := strconv.ParseUint(s, 0, 64)
+	*i = uintValue(v)
+	return err
+}
+
+func (i *uintValue) Type() string {
+	return "uint"
+}
+
+func (i *uintValue) String() string { return strconv.FormatUint(uint64(*i), 10) }
+
+func uintConv(sval string) (interface{}, error) {
+	v, err := strconv.ParseUint(sval, 0, 0)
+	if err != nil {
+		return 0, err
+	}
+	return uint(v), nil
+}
+
+// GetUint return the uint value of a flag with the given name
+func (f *FlagSet) GetUint(name string) (uint, error) {
+	val, err := f.getFlagType(name, "uint", uintConv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(uint), nil
+}
+
+// UintVar defines a uint flag with specified name, default value, and usage string.
+// The argument p points to a uint variable in which to store the value of the flag.
+func (f *FlagSet) UintVar(p *uint, name string, value uint, usage string) {
+	f.VarP(newUintValue(value, p), name, "", usage)
+}
+
+// UintVarP is like UintVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) UintVarP(p *uint, name, shorthand string, value uint, usage string) {
+	f.VarP(newUintValue(value, p), name, shorthand, usage)
+}
+
+// UintVar defines a uint flag with specified name, default value, and usage string.
+// The argument p points to a uint  variable in which to store the value of the flag.
+func UintVar(p *uint, name string, value uint, usage string) {
+	CommandLine.VarP(newUintValue(value, p), name, "", usage)
+}
+
+// UintVarP is like UintVar, but accepts a shorthand letter that can be used after a single dash.
+func UintVarP(p *uint, name, shorthand string, value uint, usage string) {
+	CommandLine.VarP(newUintValue(value, p), name, shorthand, usage)
+}
+
+// Uint defines a uint flag with specified name, default value, and usage string.
+// The return value is the address of a uint  variable that stores the value of the flag.
+func (f *FlagSet) Uint(name string, value uint, usage string) *uint {
+	p := new(uint)
+	f.UintVarP(p, name, "", value, usage)
+	return p
+}
+
+// UintP is like Uint, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) UintP(name, shorthand string, value uint, usage string) *uint {
+	p := new(uint)
+	f.UintVarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Uint defines a uint flag with specified name, default value, and usage string.
+// The return value is the address of a uint  variable that stores the value of the flag.
+func Uint(name string, value uint, usage string) *uint {
+	return CommandLine.UintP(name, "", value, usage)
+}
+
+// UintP is like Uint, but accepts a shorthand letter that can be used after a single dash.
+func UintP(name, shorthand string, value uint, usage string) *uint {
+	return CommandLine.UintP(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/uint16.go b/vendor/github.com/spf13/pflag/uint16.go
new file mode 100644
index 0000000..7e9914e
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/uint16.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- uint16 value
+type uint16Value uint16
+
+func newUint16Value(val uint16, p *uint16) *uint16Value {
+	*p = val
+	return (*uint16Value)(p)
+}
+
+func (i *uint16Value) Set(s string) error {
+	v, err := strconv.ParseUint(s, 0, 16)
+	*i = uint16Value(v)
+	return err
+}
+
+func (i *uint16Value) Type() string {
+	return "uint16"
+}
+
+func (i *uint16Value) String() string { return strconv.FormatUint(uint64(*i), 10) }
+
+func uint16Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseUint(sval, 0, 16)
+	if err != nil {
+		return 0, err
+	}
+	return uint16(v), nil
+}
+
+// GetUint16 return the uint16 value of a flag with the given name
+func (f *FlagSet) GetUint16(name string) (uint16, error) {
+	val, err := f.getFlagType(name, "uint16", uint16Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(uint16), nil
+}
+
+// Uint16Var defines a uint flag with specified name, default value, and usage string.
+// The argument p points to a uint variable in which to store the value of the flag.
+func (f *FlagSet) Uint16Var(p *uint16, name string, value uint16, usage string) {
+	f.VarP(newUint16Value(value, p), name, "", usage)
+}
+
+// Uint16VarP is like Uint16Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint16VarP(p *uint16, name, shorthand string, value uint16, usage string) {
+	f.VarP(newUint16Value(value, p), name, shorthand, usage)
+}
+
+// Uint16Var defines a uint flag with specified name, default value, and usage string.
+// The argument p points to a uint  variable in which to store the value of the flag.
+func Uint16Var(p *uint16, name string, value uint16, usage string) {
+	CommandLine.VarP(newUint16Value(value, p), name, "", usage)
+}
+
+// Uint16VarP is like Uint16Var, but accepts a shorthand letter that can be used after a single dash.
+func Uint16VarP(p *uint16, name, shorthand string, value uint16, usage string) {
+	CommandLine.VarP(newUint16Value(value, p), name, shorthand, usage)
+}
+
+// Uint16 defines a uint flag with specified name, default value, and usage string.
+// The return value is the address of a uint  variable that stores the value of the flag.
+func (f *FlagSet) Uint16(name string, value uint16, usage string) *uint16 {
+	p := new(uint16)
+	f.Uint16VarP(p, name, "", value, usage)
+	return p
+}
+
+// Uint16P is like Uint16, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint16P(name, shorthand string, value uint16, usage string) *uint16 {
+	p := new(uint16)
+	f.Uint16VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Uint16 defines a uint flag with specified name, default value, and usage string.
+// The return value is the address of a uint  variable that stores the value of the flag.
+func Uint16(name string, value uint16, usage string) *uint16 {
+	return CommandLine.Uint16P(name, "", value, usage)
+}
+
+// Uint16P is like Uint16, but accepts a shorthand letter that can be used after a single dash.
+func Uint16P(name, shorthand string, value uint16, usage string) *uint16 {
+	return CommandLine.Uint16P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/uint32.go b/vendor/github.com/spf13/pflag/uint32.go
new file mode 100644
index 0000000..d802453
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/uint32.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- uint32 value
+type uint32Value uint32
+
+func newUint32Value(val uint32, p *uint32) *uint32Value {
+	*p = val
+	return (*uint32Value)(p)
+}
+
+func (i *uint32Value) Set(s string) error {
+	v, err := strconv.ParseUint(s, 0, 32)
+	*i = uint32Value(v)
+	return err
+}
+
+func (i *uint32Value) Type() string {
+	return "uint32"
+}
+
+func (i *uint32Value) String() string { return strconv.FormatUint(uint64(*i), 10) }
+
+func uint32Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseUint(sval, 0, 32)
+	if err != nil {
+		return 0, err
+	}
+	return uint32(v), nil
+}
+
+// GetUint32 return the uint32 value of a flag with the given name
+func (f *FlagSet) GetUint32(name string) (uint32, error) {
+	val, err := f.getFlagType(name, "uint32", uint32Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(uint32), nil
+}
+
+// Uint32Var defines a uint32 flag with specified name, default value, and usage string.
+// The argument p points to a uint32 variable in which to store the value of the flag.
+func (f *FlagSet) Uint32Var(p *uint32, name string, value uint32, usage string) {
+	f.VarP(newUint32Value(value, p), name, "", usage)
+}
+
+// Uint32VarP is like Uint32Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint32VarP(p *uint32, name, shorthand string, value uint32, usage string) {
+	f.VarP(newUint32Value(value, p), name, shorthand, usage)
+}
+
+// Uint32Var defines a uint32 flag with specified name, default value, and usage string.
+// The argument p points to a uint32  variable in which to store the value of the flag.
+func Uint32Var(p *uint32, name string, value uint32, usage string) {
+	CommandLine.VarP(newUint32Value(value, p), name, "", usage)
+}
+
+// Uint32VarP is like Uint32Var, but accepts a shorthand letter that can be used after a single dash.
+func Uint32VarP(p *uint32, name, shorthand string, value uint32, usage string) {
+	CommandLine.VarP(newUint32Value(value, p), name, shorthand, usage)
+}
+
+// Uint32 defines a uint32 flag with specified name, default value, and usage string.
+// The return value is the address of a uint32  variable that stores the value of the flag.
+func (f *FlagSet) Uint32(name string, value uint32, usage string) *uint32 {
+	p := new(uint32)
+	f.Uint32VarP(p, name, "", value, usage)
+	return p
+}
+
+// Uint32P is like Uint32, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint32P(name, shorthand string, value uint32, usage string) *uint32 {
+	p := new(uint32)
+	f.Uint32VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Uint32 defines a uint32 flag with specified name, default value, and usage string.
+// The return value is the address of a uint32  variable that stores the value of the flag.
+func Uint32(name string, value uint32, usage string) *uint32 {
+	return CommandLine.Uint32P(name, "", value, usage)
+}
+
+// Uint32P is like Uint32, but accepts a shorthand letter that can be used after a single dash.
+func Uint32P(name, shorthand string, value uint32, usage string) *uint32 {
+	return CommandLine.Uint32P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/uint64.go b/vendor/github.com/spf13/pflag/uint64.go
new file mode 100644
index 0000000..f62240f
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/uint64.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- uint64 Value
+type uint64Value uint64
+
+func newUint64Value(val uint64, p *uint64) *uint64Value {
+	*p = val
+	return (*uint64Value)(p)
+}
+
+func (i *uint64Value) Set(s string) error {
+	v, err := strconv.ParseUint(s, 0, 64)
+	*i = uint64Value(v)
+	return err
+}
+
+func (i *uint64Value) Type() string {
+	return "uint64"
+}
+
+func (i *uint64Value) String() string { return strconv.FormatUint(uint64(*i), 10) }
+
+func uint64Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseUint(sval, 0, 64)
+	if err != nil {
+		return 0, err
+	}
+	return uint64(v), nil
+}
+
+// GetUint64 return the uint64 value of a flag with the given name
+func (f *FlagSet) GetUint64(name string) (uint64, error) {
+	val, err := f.getFlagType(name, "uint64", uint64Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(uint64), nil
+}
+
+// Uint64Var defines a uint64 flag with specified name, default value, and usage string.
+// The argument p points to a uint64 variable in which to store the value of the flag.
+func (f *FlagSet) Uint64Var(p *uint64, name string, value uint64, usage string) {
+	f.VarP(newUint64Value(value, p), name, "", usage)
+}
+
+// Uint64VarP is like Uint64Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint64VarP(p *uint64, name, shorthand string, value uint64, usage string) {
+	f.VarP(newUint64Value(value, p), name, shorthand, usage)
+}
+
+// Uint64Var defines a uint64 flag with specified name, default value, and usage string.
+// The argument p points to a uint64 variable in which to store the value of the flag.
+func Uint64Var(p *uint64, name string, value uint64, usage string) {
+	CommandLine.VarP(newUint64Value(value, p), name, "", usage)
+}
+
+// Uint64VarP is like Uint64Var, but accepts a shorthand letter that can be used after a single dash.
+func Uint64VarP(p *uint64, name, shorthand string, value uint64, usage string) {
+	CommandLine.VarP(newUint64Value(value, p), name, shorthand, usage)
+}
+
+// Uint64 defines a uint64 flag with specified name, default value, and usage string.
+// The return value is the address of a uint64 variable that stores the value of the flag.
+func (f *FlagSet) Uint64(name string, value uint64, usage string) *uint64 {
+	p := new(uint64)
+	f.Uint64VarP(p, name, "", value, usage)
+	return p
+}
+
+// Uint64P is like Uint64, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint64P(name, shorthand string, value uint64, usage string) *uint64 {
+	p := new(uint64)
+	f.Uint64VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Uint64 defines a uint64 flag with specified name, default value, and usage string.
+// The return value is the address of a uint64 variable that stores the value of the flag.
+func Uint64(name string, value uint64, usage string) *uint64 {
+	return CommandLine.Uint64P(name, "", value, usage)
+}
+
+// Uint64P is like Uint64, but accepts a shorthand letter that can be used after a single dash.
+func Uint64P(name, shorthand string, value uint64, usage string) *uint64 {
+	return CommandLine.Uint64P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/uint8.go b/vendor/github.com/spf13/pflag/uint8.go
new file mode 100644
index 0000000..bb0e83c
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/uint8.go
@@ -0,0 +1,88 @@
+package pflag
+
+import "strconv"
+
+// -- uint8 Value
+type uint8Value uint8
+
+func newUint8Value(val uint8, p *uint8) *uint8Value {
+	*p = val
+	return (*uint8Value)(p)
+}
+
+func (i *uint8Value) Set(s string) error {
+	v, err := strconv.ParseUint(s, 0, 8)
+	*i = uint8Value(v)
+	return err
+}
+
+func (i *uint8Value) Type() string {
+	return "uint8"
+}
+
+func (i *uint8Value) String() string { return strconv.FormatUint(uint64(*i), 10) }
+
+func uint8Conv(sval string) (interface{}, error) {
+	v, err := strconv.ParseUint(sval, 0, 8)
+	if err != nil {
+		return 0, err
+	}
+	return uint8(v), nil
+}
+
+// GetUint8 return the uint8 value of a flag with the given name
+func (f *FlagSet) GetUint8(name string) (uint8, error) {
+	val, err := f.getFlagType(name, "uint8", uint8Conv)
+	if err != nil {
+		return 0, err
+	}
+	return val.(uint8), nil
+}
+
+// Uint8Var defines a uint8 flag with specified name, default value, and usage string.
+// The argument p points to a uint8 variable in which to store the value of the flag.
+func (f *FlagSet) Uint8Var(p *uint8, name string, value uint8, usage string) {
+	f.VarP(newUint8Value(value, p), name, "", usage)
+}
+
+// Uint8VarP is like Uint8Var, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint8VarP(p *uint8, name, shorthand string, value uint8, usage string) {
+	f.VarP(newUint8Value(value, p), name, shorthand, usage)
+}
+
+// Uint8Var defines a uint8 flag with specified name, default value, and usage string.
+// The argument p points to a uint8 variable in which to store the value of the flag.
+func Uint8Var(p *uint8, name string, value uint8, usage string) {
+	CommandLine.VarP(newUint8Value(value, p), name, "", usage)
+}
+
+// Uint8VarP is like Uint8Var, but accepts a shorthand letter that can be used after a single dash.
+func Uint8VarP(p *uint8, name, shorthand string, value uint8, usage string) {
+	CommandLine.VarP(newUint8Value(value, p), name, shorthand, usage)
+}
+
+// Uint8 defines a uint8 flag with specified name, default value, and usage string.
+// The return value is the address of a uint8 variable that stores the value of the flag.
+func (f *FlagSet) Uint8(name string, value uint8, usage string) *uint8 {
+	p := new(uint8)
+	f.Uint8VarP(p, name, "", value, usage)
+	return p
+}
+
+// Uint8P is like Uint8, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) Uint8P(name, shorthand string, value uint8, usage string) *uint8 {
+	p := new(uint8)
+	f.Uint8VarP(p, name, shorthand, value, usage)
+	return p
+}
+
+// Uint8 defines a uint8 flag with specified name, default value, and usage string.
+// The return value is the address of a uint8 variable that stores the value of the flag.
+func Uint8(name string, value uint8, usage string) *uint8 {
+	return CommandLine.Uint8P(name, "", value, usage)
+}
+
+// Uint8P is like Uint8, but accepts a shorthand letter that can be used after a single dash.
+func Uint8P(name, shorthand string, value uint8, usage string) *uint8 {
+	return CommandLine.Uint8P(name, shorthand, value, usage)
+}
diff --git a/vendor/github.com/spf13/pflag/uint_slice.go b/vendor/github.com/spf13/pflag/uint_slice.go
new file mode 100644
index 0000000..edd94c6
--- /dev/null
+++ b/vendor/github.com/spf13/pflag/uint_slice.go
@@ -0,0 +1,126 @@
+package pflag
+
+import (
+	"fmt"
+	"strconv"
+	"strings"
+)
+
+// -- uintSlice Value
+type uintSliceValue struct {
+	value   *[]uint
+	changed bool
+}
+
+func newUintSliceValue(val []uint, p *[]uint) *uintSliceValue {
+	uisv := new(uintSliceValue)
+	uisv.value = p
+	*uisv.value = val
+	return uisv
+}
+
+func (s *uintSliceValue) Set(val string) error {
+	ss := strings.Split(val, ",")
+	out := make([]uint, len(ss))
+	for i, d := range ss {
+		u, err := strconv.ParseUint(d, 10, 0)
+		if err != nil {
+			return err
+		}
+		out[i] = uint(u)
+	}
+	if !s.changed {
+		*s.value = out
+	} else {
+		*s.value = append(*s.value, out...)
+	}
+	s.changed = true
+	return nil
+}
+
+func (s *uintSliceValue) Type() string {
+	return "uintSlice"
+}
+
+func (s *uintSliceValue) String() string {
+	out := make([]string, len(*s.value))
+	for i, d := range *s.value {
+		out[i] = fmt.Sprintf("%d", d)
+	}
+	return "[" + strings.Join(out, ",") + "]"
+}
+
+func uintSliceConv(val string) (interface{}, error) {
+	val = strings.Trim(val, "[]")
+	// Empty string would cause a slice with one (empty) entry
+	if len(val) == 0 {
+		return []uint{}, nil
+	}
+	ss := strings.Split(val, ",")
+	out := make([]uint, len(ss))
+	for i, d := range ss {
+		u, err := strconv.ParseUint(d, 10, 0)
+		if err != nil {
+			return nil, err
+		}
+		out[i] = uint(u)
+	}
+	return out, nil
+}
+
+// GetUintSlice returns the []uint value of a flag with the given name.
+func (f *FlagSet) GetUintSlice(name string) ([]uint, error) {
+	val, err := f.getFlagType(name, "uintSlice", uintSliceConv)
+	if err != nil {
+		return []uint{}, err
+	}
+	return val.([]uint), nil
+}
+
+// UintSliceVar defines a uintSlice flag with specified name, default value, and usage string.
+// The argument p points to a []uint variable in which to store the value of the flag.
+func (f *FlagSet) UintSliceVar(p *[]uint, name string, value []uint, usage string) {
+	f.VarP(newUintSliceValue(value, p), name, "", usage)
+}
+
+// UintSliceVarP is like UintSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) UintSliceVarP(p *[]uint, name, shorthand string, value []uint, usage string) {
+	f.VarP(newUintSliceValue(value, p), name, shorthand, usage)
+}
+
+// UintSliceVar defines a uint[] flag with specified name, default value, and usage string.
+// The argument p points to a uint[] variable in which to store the value of the flag.
+func UintSliceVar(p *[]uint, name string, value []uint, usage string) {
+	CommandLine.VarP(newUintSliceValue(value, p), name, "", usage)
+}
+
+// UintSliceVarP is like the UintSliceVar, but accepts a shorthand letter that can be used after a single dash.
+func UintSliceVarP(p *[]uint, name, shorthand string, value []uint, usage string) {
+	CommandLine.VarP(newUintSliceValue(value, p), name, shorthand, usage)
+}
+
+// UintSlice defines a []uint flag with specified name, default value, and usage string.
+// The return value is the address of a []uint variable that stores the value of the flag.
+func (f *FlagSet) UintSlice(name string, value []uint, usage string) *[]uint {
+	p := []uint{}
+	f.UintSliceVarP(&p, name, "", value, usage)
+	return &p
+}
+
+// UintSliceP is like UintSlice, but accepts a shorthand letter that can be used after a single dash.
+func (f *FlagSet) UintSliceP(name, shorthand string, value []uint, usage string) *[]uint {
+	p := []uint{}
+	f.UintSliceVarP(&p, name, shorthand, value, usage)
+	return &p
+}
+
+// UintSlice defines a []uint flag with specified name, default value, and usage string.
+// The return value is the address of a []uint variable that stores the value of the flag.
+func UintSlice(name string, value []uint, usage string) *[]uint {
+	return CommandLine.UintSliceP(name, "", value, usage)
+}
+
+// UintSliceP is like UintSlice, but accepts a shorthand letter that can be used after a single dash.
+func UintSliceP(name, shorthand string, value []uint, usage string) *[]uint {
+	return CommandLine.UintSliceP(name, shorthand, value, usage)
+}
diff --git a/vendor/golang.org/x/net/html/parse.go b/vendor/golang.org/x/net/html/parse.go
index 1d3c198..992cff2 100644
--- a/vendor/golang.org/x/net/html/parse.go
+++ b/vendor/golang.org/x/net/html/parse.go
@@ -630,7 +630,16 @@ func inHeadIM(p *parser) bool {
 			p.oe.pop()
 			p.acknowledgeSelfClosingTag()
 			return true
-		case a.Script, a.Title, a.Noscript, a.Noframes, a.Style:
+		case a.Noscript:
+			p.addElement()
+			if p.scripting {
+				p.setOriginalIM()
+				p.im = textIM
+			} else {
+				p.im = inHeadNoscriptIM
+			}
+			return true
+		case a.Script, a.Title, a.Noframes, a.Style:
 			p.addElement()
 			p.setOriginalIM()
 			p.im = textIM
@@ -692,6 +701,49 @@ func inHeadIM(p *parser) bool {
 	return false
 }
 
+// 12.2.6.4.5.
+func inHeadNoscriptIM(p *parser) bool {
+	switch p.tok.Type {
+	case DoctypeToken:
+		// Ignore the token.
+		return true
+	case StartTagToken:
+		switch p.tok.DataAtom {
+		case a.Html:
+			return inBodyIM(p)
+		case a.Basefont, a.Bgsound, a.Link, a.Meta, a.Noframes, a.Style:
+			return inHeadIM(p)
+		case a.Head, a.Noscript:
+			// Ignore the token.
+			return true
+		}
+	case EndTagToken:
+		switch p.tok.DataAtom {
+		case a.Noscript, a.Br:
+		default:
+			// Ignore the token.
+			return true
+		}
+	case TextToken:
+		s := strings.TrimLeft(p.tok.Data, whitespace)
+		if len(s) == 0 {
+			// It was all whitespace.
+			return inHeadIM(p)
+		}
+	case CommentToken:
+		return inHeadIM(p)
+	}
+	p.oe.pop()
+	if p.top().DataAtom != a.Head {
+		panic("html: the new current node will be a head element.")
+	}
+	p.im = inHeadIM
+	if p.tok.DataAtom == a.Noscript {
+		return true
+	}
+	return false
+}
+
 // Section 12.2.6.4.6.
 func afterHeadIM(p *parser) bool {
 	switch p.tok.Type {
@@ -1692,8 +1744,9 @@ func inCellIM(p *parser) bool {
 				return true
 			}
 			// Close the cell and reprocess.
-			p.popUntil(tableScope, a.Td, a.Th)
-			p.clearActiveFormattingElements()
+			if p.popUntil(tableScope, a.Td, a.Th) {
+				p.clearActiveFormattingElements()
+			}
 			p.im = inRowIM
 			return false
 		}
@@ -2247,6 +2300,33 @@ func (p *parser) parse() error {
 //
 // The input is assumed to be UTF-8 encoded.
 func Parse(r io.Reader) (*Node, error) {
+	return ParseWithOptions(r)
+}
+
+// ParseFragment parses a fragment of HTML and returns the nodes that were
+// found. If the fragment is the InnerHTML for an existing element, pass that
+// element in context.
+//
+// It has the same intricacies as Parse.
+func ParseFragment(r io.Reader, context *Node) ([]*Node, error) {
+	return ParseFragmentWithOptions(r, context)
+}
+
+// ParseOption configures a parser.
+type ParseOption func(p *parser)
+
+// ParseOptionEnableScripting configures the scripting flag.
+// https://html.spec.whatwg.org/multipage/webappapis.html#enabling-and-disabling-scripting
+//
+// By default, scripting is enabled.
+func ParseOptionEnableScripting(enable bool) ParseOption {
+	return func(p *parser) {
+		p.scripting = enable
+	}
+}
+
+// ParseWithOptions is like Parse, with options.
+func ParseWithOptions(r io.Reader, opts ...ParseOption) (*Node, error) {
 	p := &parser{
 		tokenizer: NewTokenizer(r),
 		doc: &Node{
@@ -2256,6 +2336,11 @@ func Parse(r io.Reader) (*Node, error) {
 		framesetOK: true,
 		im:         initialIM,
 	}
+
+	for _, f := range opts {
+		f(p)
+	}
+
 	err := p.parse()
 	if err != nil {
 		return nil, err
@@ -2263,12 +2348,8 @@ func Parse(r io.Reader) (*Node, error) {
 	return p.doc, nil
 }
 
-// ParseFragment parses a fragment of HTML and returns the nodes that were
-// found. If the fragment is the InnerHTML for an existing element, pass that
-// element in context.
-//
-// It has the same intricacies as Parse.
-func ParseFragment(r io.Reader, context *Node) ([]*Node, error) {
+// ParseFragmentWithOptions is like ParseFragment, with options.
+func ParseFragmentWithOptions(r io.Reader, context *Node, opts ...ParseOption) ([]*Node, error) {
 	contextTag := ""
 	if context != nil {
 		if context.Type != ElementNode {
@@ -2292,6 +2373,10 @@ func ParseFragment(r io.Reader, context *Node) ([]*Node, error) {
 		context:   context,
 	}
 
+	for _, f := range opts {
+		f(p)
+	}
+
 	root := &Node{
 		Type:     ElementNode,
 		DataAtom: a.Html,
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s
new file mode 100644
index 0000000..6db717d
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s
@@ -0,0 +1,54 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build riscv64,!gccgo
+
+#include "textflag.h"
+
+//
+// System calls for linux/riscv64.
+//
+// Where available, just jump to package syscall's implementation of
+// these functions.
+
+TEXT ·Syscall(SB),NOSPLIT,$0-56
+	JMP	syscall·Syscall(SB)
+
+TEXT ·Syscall6(SB),NOSPLIT,$0-80
+	JMP	syscall·Syscall6(SB)
+
+TEXT ·SyscallNoError(SB),NOSPLIT,$0-48
+	CALL	runtime·entersyscall(SB)
+	MOV	a1+8(FP), A0
+	MOV	a2+16(FP), A1
+	MOV	a3+24(FP), A2
+	MOV	$0, A3
+	MOV	$0, A4
+	MOV	$0, A5
+	MOV	$0, A6
+	MOV	trap+0(FP), A7	// syscall entry
+	ECALL
+	MOV	A0, r1+32(FP)	// r1
+	MOV	A1, r2+40(FP)	// r2
+	CALL	runtime·exitsyscall(SB)
+	RET
+
+TEXT ·RawSyscall(SB),NOSPLIT,$0-56
+	JMP	syscall·RawSyscall(SB)
+
+TEXT ·RawSyscall6(SB),NOSPLIT,$0-80
+	JMP	syscall·RawSyscall6(SB)
+
+TEXT ·RawSyscallNoError(SB),NOSPLIT,$0-48
+	MOV	a1+8(FP), A0
+	MOV	a2+16(FP), A1
+	MOV	a3+24(FP), A2
+	MOV	ZERO, A3
+	MOV	ZERO, A4
+	MOV	ZERO, A5
+	MOV	trap+0(FP), A7	// syscall entry
+	ECALL
+	MOV	A0, r1+32(FP)
+	MOV	A1, r2+40(FP)
+	RET
diff --git a/vendor/golang.org/x/sys/unix/asm_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/asm_openbsd_arm64.s
new file mode 100644
index 0000000..0cedea3
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/asm_openbsd_arm64.s
@@ -0,0 +1,29 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build !gccgo
+
+#include "textflag.h"
+
+//
+// System call support for arm64, OpenBSD
+//
+
+// Just jump to package syscall's implementation for all these functions.
+// The runtime may know about them.
+
+TEXT	·Syscall(SB),NOSPLIT,$0-56
+	JMP	syscall·Syscall(SB)
+
+TEXT	·Syscall6(SB),NOSPLIT,$0-80
+	JMP	syscall·Syscall6(SB)
+
+TEXT	·Syscall9(SB),NOSPLIT,$0-104
+	JMP	syscall·Syscall9(SB)
+
+TEXT	·RawSyscall(SB),NOSPLIT,$0-56
+	JMP	syscall·RawSyscall(SB)
+
+TEXT	·RawSyscall6(SB),NOSPLIT,$0-80
+	JMP	syscall·RawSyscall6(SB)
diff --git a/vendor/golang.org/x/sys/unix/dirent.go b/vendor/golang.org/x/sys/unix/dirent.go
index 4407c50..6f3460e 100644
--- a/vendor/golang.org/x/sys/unix/dirent.go
+++ b/vendor/golang.org/x/sys/unix/dirent.go
@@ -6,12 +6,97 @@
 
 package unix
 
-import "syscall"
+import "unsafe"
+
+// readInt returns the size-bytes unsigned integer in native byte order at offset off.
+func readInt(b []byte, off, size uintptr) (u uint64, ok bool) {
+	if len(b) < int(off+size) {
+		return 0, false
+	}
+	if isBigEndian {
+		return readIntBE(b[off:], size), true
+	}
+	return readIntLE(b[off:], size), true
+}
+
+func readIntBE(b []byte, size uintptr) uint64 {
+	switch size {
+	case 1:
+		return uint64(b[0])
+	case 2:
+		_ = b[1] // bounds check hint to compiler; see golang.org/issue/14808
+		return uint64(b[1]) | uint64(b[0])<<8
+	case 4:
+		_ = b[3] // bounds check hint to compiler; see golang.org/issue/14808
+		return uint64(b[3]) | uint64(b[2])<<8 | uint64(b[1])<<16 | uint64(b[0])<<24
+	case 8:
+		_ = b[7] // bounds check hint to compiler; see golang.org/issue/14808
+		return uint64(b[7]) | uint64(b[6])<<8 | uint64(b[5])<<16 | uint64(b[4])<<24 |
+			uint64(b[3])<<32 | uint64(b[2])<<40 | uint64(b[1])<<48 | uint64(b[0])<<56
+	default:
+		panic("syscall: readInt with unsupported size")
+	}
+}
+
+func readIntLE(b []byte, size uintptr) uint64 {
+	switch size {
+	case 1:
+		return uint64(b[0])
+	case 2:
+		_ = b[1] // bounds check hint to compiler; see golang.org/issue/14808
+		return uint64(b[0]) | uint64(b[1])<<8
+	case 4:
+		_ = b[3] // bounds check hint to compiler; see golang.org/issue/14808
+		return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24
+	case 8:
+		_ = b[7] // bounds check hint to compiler; see golang.org/issue/14808
+		return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24 |
+			uint64(b[4])<<32 | uint64(b[5])<<40 | uint64(b[6])<<48 | uint64(b[7])<<56
+	default:
+		panic("syscall: readInt with unsupported size")
+	}
+}
 
 // ParseDirent parses up to max directory entries in buf,
 // appending the names to names. It returns the number of
 // bytes consumed from buf, the number of entries added
 // to names, and the new names slice.
 func ParseDirent(buf []byte, max int, names []string) (consumed int, count int, newnames []string) {
-	return syscall.ParseDirent(buf, max, names)
+	origlen := len(buf)
+	count = 0
+	for max != 0 && len(buf) > 0 {
+		reclen, ok := direntReclen(buf)
+		if !ok || reclen > uint64(len(buf)) {
+			return origlen, count, names
+		}
+		rec := buf[:reclen]
+		buf = buf[reclen:]
+		ino, ok := direntIno(rec)
+		if !ok {
+			break
+		}
+		if ino == 0 { // File absent in directory.
+			continue
+		}
+		const namoff = uint64(unsafe.Offsetof(Dirent{}.Name))
+		namlen, ok := direntNamlen(rec)
+		if !ok || namoff+namlen > uint64(len(rec)) {
+			break
+		}
+		name := rec[namoff : namoff+namlen]
+		for i, c := range name {
+			if c == 0 {
+				name = name[:i]
+				break
+			}
+		}
+		// Check for useless names before allocating a string.
+		if string(name) == "." || string(name) == ".." {
+			continue
+		}
+		max--
+		count++
+		names = append(names, string(name))
+	}
+	return origlen - len(buf), count, names
 }
diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh
index 1e5c59d..5a22eca 100644
--- a/vendor/golang.org/x/sys/unix/mkall.sh
+++ b/vendor/golang.org/x/sys/unix/mkall.sh
@@ -105,25 +105,25 @@ dragonfly_amd64)
 freebsd_386)
 	mkerrors="$mkerrors -m32"
 	mksyscall="go run mksyscall.go -l32"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 freebsd_amd64)
 	mkerrors="$mkerrors -m64"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 freebsd_arm)
 	mkerrors="$mkerrors"
 	mksyscall="go run mksyscall.go -l32 -arm"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
 	# Let the type of C char be signed for making the bare syscall
 	# API consistent across platforms.
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
 	;;
 freebsd_arm64)
 	mkerrors="$mkerrors -m64"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 netbsd_386)
@@ -146,24 +146,39 @@ netbsd_arm)
 	# API consistent across platforms.
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
 	;;
+netbsd_arm64)
+	mkerrors="$mkerrors -m64"
+	mksyscall="go run mksyscall.go -netbsd"
+	mksysnum="go run mksysnum.go 'http://cvsweb.netbsd.org/bsdweb.cgi/~checkout~/src/sys/kern/syscalls.master'"
+	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
+	;;
 openbsd_386)
 	mkerrors="$mkerrors -m32"
 	mksyscall="go run mksyscall.go -l32 -openbsd"
-	mksysctl="./mksysctl_openbsd.pl"
+	mksysctl="go run mksysctl_openbsd.go"
 	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 openbsd_amd64)
 	mkerrors="$mkerrors -m64"
 	mksyscall="go run mksyscall.go -openbsd"
-	mksysctl="./mksysctl_openbsd.pl"
+	mksysctl="go run mksysctl_openbsd.go"
 	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 openbsd_arm)
 	mkerrors="$mkerrors"
 	mksyscall="go run mksyscall.go -l32 -openbsd -arm"
-	mksysctl="./mksysctl_openbsd.pl"
+	mksysctl="go run mksysctl_openbsd.go"
+	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
+	# Let the type of C char be signed for making the bare syscall
+	# API consistent across platforms.
+	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
+	;;
+openbsd_arm64)
+	mkerrors="$mkerrors -m64"
+	mksyscall="go run mksyscall.go -openbsd"
+	mksysctl="go run mksysctl_openbsd.go"
 	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
 	# Let the type of C char be signed for making the bare syscall
 	# API consistent across platforms.
diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh
index cfb61ba..3d85f27 100644
--- a/vendor/golang.org/x/sys/unix/mkerrors.sh
+++ b/vendor/golang.org/x/sys/unix/mkerrors.sh
@@ -182,6 +182,8 @@ struct ltchars {
 #include <sys/signalfd.h>
 #include <sys/socket.h>
 #include <sys/xattr.h>
+#include <linux/bpf.h>
+#include <linux/capability.h>
 #include <linux/errqueue.h>
 #include <linux/if.h>
 #include <linux/if_alg.h>
@@ -222,6 +224,7 @@ struct ltchars {
 #include <linux/hdreg.h>
 #include <linux/rtc.h>
 #include <linux/if_xdp.h>
+#include <linux/cryptouser.h>
 #include <mtd/ubi-user.h>
 #include <net/route.h>
 
@@ -432,7 +435,7 @@ ccflags="$@"
 		$2 ~ /^TC[IO](ON|OFF)$/ ||
 		$2 ~ /^IN_/ ||
 		$2 ~ /^LOCK_(SH|EX|NB|UN)$/ ||
-		$2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|ICMP6|TCP|EVFILT|NOTE|EV|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR)_/ ||
+		$2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|ICMP6|TCP|MCAST|EVFILT|NOTE|EV|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR)_/ ||
 		$2 ~ /^TP_STATUS_/ ||
 		$2 ~ /^FALLOC_/ ||
 		$2 == "ICMPV6_FILTER" ||
@@ -465,7 +468,7 @@ ccflags="$@"
 		$2 ~ /^RLIMIT_(AS|CORE|CPU|DATA|FSIZE|LOCKS|MEMLOCK|MSGQUEUE|NICE|NOFILE|NPROC|RSS|RTPRIO|RTTIME|SIGPENDING|STACK)|RLIM_INFINITY/ ||
 		$2 ~ /^PRIO_(PROCESS|PGRP|USER)/ ||
 		$2 ~ /^CLONE_[A-Z_]+/ ||
-		$2 !~ /^(BPF_TIMEVAL)$/ &&
+		$2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ &&
 		$2 ~ /^(BPF|DLT)_/ ||
 		$2 ~ /^(CLOCK|TIMER)_/ ||
 		$2 ~ /^CAN_/ ||
@@ -499,6 +502,7 @@ ccflags="$@"
 		$2 ~ /^NFN/ ||
 		$2 ~ /^XDP_/ ||
 		$2 ~ /^(HDIO|WIN|SMART)_/ ||
+		$2 ~ /^CRYPTO_/ ||
 		$2 !~ "WMESGLEN" &&
 		$2 ~ /^W[A-Z0-9]+$/ ||
 		$2 ~/^PPPIOC/ ||
diff --git a/vendor/golang.org/x/sys/unix/mkpost.go b/vendor/golang.org/x/sys/unix/mkpost.go
index 9feddd0..eb43320 100644
--- a/vendor/golang.org/x/sys/unix/mkpost.go
+++ b/vendor/golang.org/x/sys/unix/mkpost.go
@@ -42,9 +42,16 @@ func main() {
 		log.Fatal(err)
 	}
 
+	if goos == "aix" {
+		// Replace type of Atim, Mtim and Ctim by Timespec in Stat_t
+		// to avoid having both StTimespec and Timespec.
+		sttimespec := regexp.MustCompile(`_Ctype_struct_st_timespec`)
+		b = sttimespec.ReplaceAll(b, []byte("Timespec"))
+	}
+
 	// Intentionally export __val fields in Fsid and Sigset_t
-	valRegex := regexp.MustCompile(`type (Fsid|Sigset_t) struct {(\s+)X__val(\s+\S+\s+)}`)
-	b = valRegex.ReplaceAll(b, []byte("type $1 struct {${2}Val$3}"))
+	valRegex := regexp.MustCompile(`type (Fsid|Sigset_t) struct {(\s+)X__(bits|val)(\s+\S+\s+)}`)
+	b = valRegex.ReplaceAll(b, []byte("type $1 struct {${2}Val$4}"))
 
 	// Intentionally export __fds_bits field in FdSet
 	fdSetRegex := regexp.MustCompile(`type (FdSet) struct {(\s+)X__fds_bits(\s+\S+\s+)}`)
@@ -96,6 +103,15 @@ func main() {
 	cgoCommandRegex := regexp.MustCompile(`(cgo -godefs .*)`)
 	b = cgoCommandRegex.ReplaceAll(b, []byte(replacement))
 
+	// Rename Stat_t time fields
+	if goos == "freebsd" && goarch == "386" {
+		// Hide Stat_t.[AMCB]tim_ext fields
+		renameStatTimeExtFieldsRegex := regexp.MustCompile(`[AMCB]tim_ext`)
+		b = renameStatTimeExtFieldsRegex.ReplaceAll(b, []byte("_"))
+	}
+	renameStatTimeFieldsRegex := regexp.MustCompile(`([AMCB])(?:irth)?time?(?:spec)?\s+(Timespec|StTimespec)`)
+	b = renameStatTimeFieldsRegex.ReplaceAll(b, []byte("${1}tim ${2}"))
+
 	// gofmt
 	b, err = format.Source(b)
 	if err != nil {
diff --git a/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc.go
index f2c58fb..3be3cdf 100644
--- a/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc.go
@@ -214,6 +214,11 @@ func main() {
 			}
 
 			if funct != "fcntl" && funct != "FcntlInt" && funct != "readlen" && funct != "writelen" {
+				if sysname == "select" {
+					// select is a keyword of Go. Its name is
+					// changed to c_select.
+					cExtern += "#define c_select select\n"
+				}
 				// Imports of system calls from libc
 				cExtern += fmt.Sprintf("%s %s", cRettype, sysname)
 				cIn := strings.Join(cIn, ", ")
@@ -328,7 +333,13 @@ func main() {
 			} else {
 				call += ""
 			}
-			call += fmt.Sprintf("C.%s(%s)", sysname, arglist)
+			if sysname == "select" {
+				// select is a keyword of Go. Its name is
+				// changed to c_select.
+				call += fmt.Sprintf("C.c_%s(%s)", sysname, arglist)
+			} else {
+				call += fmt.Sprintf("C.%s(%s)", sysname, arglist)
+			}
 
 			// Assign return values.
 			body := ""
diff --git a/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc64.go
index 45b4429..c960099 100644
--- a/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/mksyscall_aix_ppc64.go
@@ -282,6 +282,11 @@ func main() {
 			if !onlyCommon {
 				// GCCGO Prototype Generation
 				// Imports of system calls from libc
+				if sysname == "select" {
+					// select is a keyword of Go. Its name is
+					// changed to c_select.
+					cExtern += "#define c_select select\n"
+				}
 				cExtern += fmt.Sprintf("%s %s", cRettype, sysname)
 				cIn := strings.Join(cIn, ", ")
 				cExtern += fmt.Sprintf("(%s);\n", cIn)
@@ -490,7 +495,14 @@ func main() {
 
 			// GCCGO function generation
 			argsgccgolist := strings.Join(argsgccgo, ", ")
-			callgccgo := fmt.Sprintf("C.%s(%s)", sysname, argsgccgolist)
+			var callgccgo string
+			if sysname == "select" {
+				// select is a keyword of Go. Its name is
+				// changed to c_select.
+				callgccgo = fmt.Sprintf("C.c_%s(%s)", sysname, argsgccgolist)
+			} else {
+				callgccgo = fmt.Sprintf("C.%s(%s)", sysname, argsgccgolist)
+			}
 			textgccgo += callProto
 			textgccgo += fmt.Sprintf("\tr1 = uintptr(%s)\n", callgccgo)
 			textgccgo += "\te1 = syscall.GetErrno()\n"
diff --git a/vendor/golang.org/x/sys/unix/mksysctl_openbsd.go b/vendor/golang.org/x/sys/unix/mksysctl_openbsd.go
new file mode 100644
index 0000000..b6b4099
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/mksysctl_openbsd.go
@@ -0,0 +1,355 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Parse the header files for OpenBSD and generate a Go usable sysctl MIB.
+//
+// Build a MIB with each entry being an array containing the level, type and
+// a hash that will contain additional entries if the current entry is a node.
+// We then walk this MIB and create a flattened sysctl name to OID hash.
+
+package main
+
+import (
+	"bufio"
+	"fmt"
+	"os"
+	"path/filepath"
+	"regexp"
+	"sort"
+	"strings"
+)
+
+var (
+	goos, goarch string
+)
+
+// cmdLine returns this programs's commandline arguments.
+func cmdLine() string {
+	return "go run mksysctl_openbsd.go " + strings.Join(os.Args[1:], " ")
+}
+
+// buildTags returns build tags.
+func buildTags() string {
+	return fmt.Sprintf("%s,%s", goarch, goos)
+}
+
+// reMatch performs regular expression match and stores the substring slice to value pointed by m.
+func reMatch(re *regexp.Regexp, str string, m *[]string) bool {
+	*m = re.FindStringSubmatch(str)
+	if *m != nil {
+		return true
+	}
+	return false
+}
+
+type nodeElement struct {
+	n  int
+	t  string
+	pE *map[string]nodeElement
+}
+
+var (
+	debugEnabled bool
+	mib          map[string]nodeElement
+	node         *map[string]nodeElement
+	nodeMap      map[string]string
+	sysCtl       []string
+)
+
+var (
+	ctlNames1RE = regexp.MustCompile(`^#define\s+(CTL_NAMES)\s+{`)
+	ctlNames2RE = regexp.MustCompile(`^#define\s+(CTL_(.*)_NAMES)\s+{`)
+	ctlNames3RE = regexp.MustCompile(`^#define\s+((.*)CTL_NAMES)\s+{`)
+	netInetRE   = regexp.MustCompile(`^netinet/`)
+	netInet6RE  = regexp.MustCompile(`^netinet6/`)
+	netRE       = regexp.MustCompile(`^net/`)
+	bracesRE    = regexp.MustCompile(`{.*}`)
+	ctlTypeRE   = regexp.MustCompile(`{\s+"(\w+)",\s+(CTLTYPE_[A-Z]+)\s+}`)
+	fsNetKernRE = regexp.MustCompile(`^(fs|net|kern)_`)
+)
+
+func debug(s string) {
+	if debugEnabled {
+		fmt.Fprintln(os.Stderr, s)
+	}
+}
+
+// Walk the MIB and build a sysctl name to OID mapping.
+func buildSysctl(pNode *map[string]nodeElement, name string, oid []int) {
+	lNode := pNode // local copy of pointer to node
+	var keys []string
+	for k := range *lNode {
+		keys = append(keys, k)
+	}
+	sort.Strings(keys)
+
+	for _, key := range keys {
+		nodename := name
+		if name != "" {
+			nodename += "."
+		}
+		nodename += key
+
+		nodeoid := append(oid, (*pNode)[key].n)
+
+		if (*pNode)[key].t == `CTLTYPE_NODE` {
+			if _, ok := nodeMap[nodename]; ok {
+				lNode = &mib
+				ctlName := nodeMap[nodename]
+				for _, part := range strings.Split(ctlName, ".") {
+					lNode = ((*lNode)[part]).pE
+				}
+			} else {
+				lNode = (*pNode)[key].pE
+			}
+			buildSysctl(lNode, nodename, nodeoid)
+		} else if (*pNode)[key].t != "" {
+			oidStr := []string{}
+			for j := range nodeoid {
+				oidStr = append(oidStr, fmt.Sprintf("%d", nodeoid[j]))
+			}
+			text := "\t{ \"" + nodename + "\", []_C_int{ " + strings.Join(oidStr, ", ") + " } }, \n"
+			sysCtl = append(sysCtl, text)
+		}
+	}
+}
+
+func main() {
+	// Get the OS (using GOOS_TARGET if it exist)
+	goos = os.Getenv("GOOS_TARGET")
+	if goos == "" {
+		goos = os.Getenv("GOOS")
+	}
+	// Get the architecture (using GOARCH_TARGET if it exists)
+	goarch = os.Getenv("GOARCH_TARGET")
+	if goarch == "" {
+		goarch = os.Getenv("GOARCH")
+	}
+	// Check if GOOS and GOARCH environment variables are defined
+	if goarch == "" || goos == "" {
+		fmt.Fprintf(os.Stderr, "GOARCH or GOOS not defined in environment\n")
+		os.Exit(1)
+	}
+
+	mib = make(map[string]nodeElement)
+	headers := [...]string{
+		`sys/sysctl.h`,
+		`sys/socket.h`,
+		`sys/tty.h`,
+		`sys/malloc.h`,
+		`sys/mount.h`,
+		`sys/namei.h`,
+		`sys/sem.h`,
+		`sys/shm.h`,
+		`sys/vmmeter.h`,
+		`uvm/uvmexp.h`,
+		`uvm/uvm_param.h`,
+		`uvm/uvm_swap_encrypt.h`,
+		`ddb/db_var.h`,
+		`net/if.h`,
+		`net/if_pfsync.h`,
+		`net/pipex.h`,
+		`netinet/in.h`,
+		`netinet/icmp_var.h`,
+		`netinet/igmp_var.h`,
+		`netinet/ip_ah.h`,
+		`netinet/ip_carp.h`,
+		`netinet/ip_divert.h`,
+		`netinet/ip_esp.h`,
+		`netinet/ip_ether.h`,
+		`netinet/ip_gre.h`,
+		`netinet/ip_ipcomp.h`,
+		`netinet/ip_ipip.h`,
+		`netinet/pim_var.h`,
+		`netinet/tcp_var.h`,
+		`netinet/udp_var.h`,
+		`netinet6/in6.h`,
+		`netinet6/ip6_divert.h`,
+		`netinet6/pim6_var.h`,
+		`netinet/icmp6.h`,
+		`netmpls/mpls.h`,
+	}
+
+	ctls := [...]string{
+		`kern`,
+		`vm`,
+		`fs`,
+		`net`,
+		//debug			/* Special handling required */
+		`hw`,
+		//machdep		/* Arch specific */
+		`user`,
+		`ddb`,
+		//vfs			/* Special handling required */
+		`fs.posix`,
+		`kern.forkstat`,
+		`kern.intrcnt`,
+		`kern.malloc`,
+		`kern.nchstats`,
+		`kern.seminfo`,
+		`kern.shminfo`,
+		`kern.timecounter`,
+		`kern.tty`,
+		`kern.watchdog`,
+		`net.bpf`,
+		`net.ifq`,
+		`net.inet`,
+		`net.inet.ah`,
+		`net.inet.carp`,
+		`net.inet.divert`,
+		`net.inet.esp`,
+		`net.inet.etherip`,
+		`net.inet.gre`,
+		`net.inet.icmp`,
+		`net.inet.igmp`,
+		`net.inet.ip`,
+		`net.inet.ip.ifq`,
+		`net.inet.ipcomp`,
+		`net.inet.ipip`,
+		`net.inet.mobileip`,
+		`net.inet.pfsync`,
+		`net.inet.pim`,
+		`net.inet.tcp`,
+		`net.inet.udp`,
+		`net.inet6`,
+		`net.inet6.divert`,
+		`net.inet6.ip6`,
+		`net.inet6.icmp6`,
+		`net.inet6.pim6`,
+		`net.inet6.tcp6`,
+		`net.inet6.udp6`,
+		`net.mpls`,
+		`net.mpls.ifq`,
+		`net.key`,
+		`net.pflow`,
+		`net.pfsync`,
+		`net.pipex`,
+		`net.rt`,
+		`vm.swapencrypt`,
+		//vfsgenctl		/* Special handling required */
+	}
+
+	// Node name "fixups"
+	ctlMap := map[string]string{
+		"ipproto":             "net.inet",
+		"net.inet.ipproto":    "net.inet",
+		"net.inet6.ipv6proto": "net.inet6",
+		"net.inet6.ipv6":      "net.inet6.ip6",
+		"net.inet.icmpv6":     "net.inet6.icmp6",
+		"net.inet6.divert6":   "net.inet6.divert",
+		"net.inet6.tcp6":      "net.inet.tcp",
+		"net.inet6.udp6":      "net.inet.udp",
+		"mpls":                "net.mpls",
+		"swpenc":              "vm.swapencrypt",
+	}
+
+	// Node mappings
+	nodeMap = map[string]string{
+		"net.inet.ip.ifq": "net.ifq",
+		"net.inet.pfsync": "net.pfsync",
+		"net.mpls.ifq":    "net.ifq",
+	}
+
+	mCtls := make(map[string]bool)
+	for _, ctl := range ctls {
+		mCtls[ctl] = true
+	}
+
+	for _, header := range headers {
+		debug("Processing " + header)
+		file, err := os.Open(filepath.Join("/usr/include", header))
+		if err != nil {
+			fmt.Fprintf(os.Stderr, "%v\n", err)
+			os.Exit(1)
+		}
+		s := bufio.NewScanner(file)
+		for s.Scan() {
+			var sub []string
+			if reMatch(ctlNames1RE, s.Text(), &sub) ||
+				reMatch(ctlNames2RE, s.Text(), &sub) ||
+				reMatch(ctlNames3RE, s.Text(), &sub) {
+				if sub[1] == `CTL_NAMES` {
+					// Top level.
+					node = &mib
+				} else {
+					// Node.
+					nodename := strings.ToLower(sub[2])
+					ctlName := ""
+					if reMatch(netInetRE, header, &sub) {
+						ctlName = "net.inet." + nodename
+					} else if reMatch(netInet6RE, header, &sub) {
+						ctlName = "net.inet6." + nodename
+					} else if reMatch(netRE, header, &sub) {
+						ctlName = "net." + nodename
+					} else {
+						ctlName = nodename
+						ctlName = fsNetKernRE.ReplaceAllString(ctlName, `$1.`)
+					}
+
+					if val, ok := ctlMap[ctlName]; ok {
+						ctlName = val
+					}
+					if _, ok := mCtls[ctlName]; !ok {
+						debug("Ignoring " + ctlName + "...")
+						continue
+					}
+
+					// Walk down from the top of the MIB.
+					node = &mib
+					for _, part := range strings.Split(ctlName, ".") {
+						if _, ok := (*node)[part]; !ok {
+							debug("Missing node " + part)
+							(*node)[part] = nodeElement{n: 0, t: "", pE: &map[string]nodeElement{}}
+						}
+						node = (*node)[part].pE
+					}
+				}
+
+				// Populate current node with entries.
+				i := -1
+				for !strings.HasPrefix(s.Text(), "}") {
+					s.Scan()
+					if reMatch(bracesRE, s.Text(), &sub) {
+						i++
+					}
+					if !reMatch(ctlTypeRE, s.Text(), &sub) {
+						continue
+					}
+					(*node)[sub[1]] = nodeElement{n: i, t: sub[2], pE: &map[string]nodeElement{}}
+				}
+			}
+		}
+		err = s.Err()
+		if err != nil {
+			fmt.Fprintf(os.Stderr, "%v\n", err)
+			os.Exit(1)
+		}
+		file.Close()
+	}
+	buildSysctl(&mib, "", []int{})
+
+	sort.Strings(sysCtl)
+	text := strings.Join(sysCtl, "")
+
+	fmt.Printf(srcTemplate, cmdLine(), buildTags(), text)
+}
+
+const srcTemplate = `// %s
+// Code generated by the command above; DO NOT EDIT.
+
+// +build %s
+
+package unix
+
+type mibentry struct {
+	ctlname string
+	ctloid []_C_int
+}
+
+var sysctlMib = []mibentry {
+%s
+}
+`
diff --git a/vendor/golang.org/x/sys/unix/mksysctl_openbsd.pl b/vendor/golang.org/x/sys/unix/mksysctl_openbsd.pl
deleted file mode 100644
index 20632e1..0000000
--- a/vendor/golang.org/x/sys/unix/mksysctl_openbsd.pl
+++ /dev/null
@@ -1,265 +0,0 @@
-#!/usr/bin/env perl
-
-# Copyright 2011 The Go Authors. All rights reserved.
-# Use of this source code is governed by a BSD-style
-# license that can be found in the LICENSE file.
-
-#
-# Parse the header files for OpenBSD and generate a Go usable sysctl MIB.
-#
-# Build a MIB with each entry being an array containing the level, type and
-# a hash that will contain additional entries if the current entry is a node.
-# We then walk this MIB and create a flattened sysctl name to OID hash.
-#
-
-use strict;
-
-if($ENV{'GOARCH'} eq "" || $ENV{'GOOS'} eq "") {
-	print STDERR "GOARCH or GOOS not defined in environment\n";
-	exit 1;
-}
-
-my $debug = 0;
-my %ctls = ();
-
-my @headers = qw (
-	sys/sysctl.h
-	sys/socket.h
-	sys/tty.h
-	sys/malloc.h
-	sys/mount.h
-	sys/namei.h
-	sys/sem.h
-	sys/shm.h
-	sys/vmmeter.h
-	uvm/uvmexp.h
-	uvm/uvm_param.h
-	uvm/uvm_swap_encrypt.h
-	ddb/db_var.h
-	net/if.h
-	net/if_pfsync.h
-	net/pipex.h
-	netinet/in.h
-	netinet/icmp_var.h
-	netinet/igmp_var.h
-	netinet/ip_ah.h
-	netinet/ip_carp.h
-	netinet/ip_divert.h
-	netinet/ip_esp.h
-	netinet/ip_ether.h
-	netinet/ip_gre.h
-	netinet/ip_ipcomp.h
-	netinet/ip_ipip.h
-	netinet/pim_var.h
-	netinet/tcp_var.h
-	netinet/udp_var.h
-	netinet6/in6.h
-	netinet6/ip6_divert.h
-	netinet6/pim6_var.h
-	netinet/icmp6.h
-	netmpls/mpls.h
-);
-
-my @ctls = qw (
-	kern
-	vm
-	fs
-	net
-	#debug				# Special handling required
-	hw
-	#machdep			# Arch specific
-	user
-	ddb
-	#vfs				# Special handling required
-	fs.posix
-	kern.forkstat
-	kern.intrcnt
-	kern.malloc
-	kern.nchstats
-	kern.seminfo
-	kern.shminfo
-	kern.timecounter
-	kern.tty
-	kern.watchdog
-	net.bpf
-	net.ifq
-	net.inet
-	net.inet.ah
-	net.inet.carp
-	net.inet.divert
-	net.inet.esp
-	net.inet.etherip
-	net.inet.gre
-	net.inet.icmp
-	net.inet.igmp
-	net.inet.ip
-	net.inet.ip.ifq
-	net.inet.ipcomp
-	net.inet.ipip
-	net.inet.mobileip
-	net.inet.pfsync
-	net.inet.pim
-	net.inet.tcp
-	net.inet.udp
-	net.inet6
-	net.inet6.divert
-	net.inet6.ip6
-	net.inet6.icmp6
-	net.inet6.pim6
-	net.inet6.tcp6
-	net.inet6.udp6
-	net.mpls
-	net.mpls.ifq
-	net.key
-	net.pflow
-	net.pfsync
-	net.pipex
-	net.rt
-	vm.swapencrypt
-	#vfsgenctl			# Special handling required
-);
-
-# Node name "fixups"
-my %ctl_map = (
-	"ipproto" => "net.inet",
-	"net.inet.ipproto" => "net.inet",
-	"net.inet6.ipv6proto" => "net.inet6",
-	"net.inet6.ipv6" => "net.inet6.ip6",
-	"net.inet.icmpv6" => "net.inet6.icmp6",
-	"net.inet6.divert6" => "net.inet6.divert",
-	"net.inet6.tcp6" => "net.inet.tcp",
-	"net.inet6.udp6" => "net.inet.udp",
-	"mpls" => "net.mpls",
-	"swpenc" => "vm.swapencrypt"
-);
-
-# Node mappings
-my %node_map = (
-	"net.inet.ip.ifq" => "net.ifq",
-	"net.inet.pfsync" => "net.pfsync",
-	"net.mpls.ifq" => "net.ifq"
-);
-
-my $ctlname;
-my %mib = ();
-my %sysctl = ();
-my $node;
-
-sub debug() {
-	print STDERR "$_[0]\n" if $debug;
-}
-
-# Walk the MIB and build a sysctl name to OID mapping.
-sub build_sysctl() {
-	my ($node, $name, $oid) = @_;
-	my %node = %{$node};
-	my @oid = @{$oid};
-
-	foreach my $key (sort keys %node) {
-		my @node = @{$node{$key}};
-		my $nodename = $name.($name ne '' ? '.' : '').$key;
-		my @nodeoid = (@oid, $node[0]);
-		if ($node[1] eq 'CTLTYPE_NODE') {
-			if (exists $node_map{$nodename}) {
-				$node = \%mib;
-				$ctlname = $node_map{$nodename};
-				foreach my $part (split /\./, $ctlname) {
-					$node = \%{@{$$node{$part}}[2]};
-				}
-			} else {
-				$node = $node[2];
-			}
-			&build_sysctl($node, $nodename, \@nodeoid);
-		} elsif ($node[1] ne '') {
-			$sysctl{$nodename} = \@nodeoid;
-		}
-	}
-}
-
-foreach my $ctl (@ctls) {
-	$ctls{$ctl} = $ctl;
-}
-
-# Build MIB
-foreach my $header (@headers) {
-	&debug("Processing $header...");
-	open HEADER, "/usr/include/$header" ||
-	    print STDERR "Failed to open $header\n";
-	while (<HEADER>) {
-		if ($_ =~ /^#define\s+(CTL_NAMES)\s+{/ ||
-		    $_ =~ /^#define\s+(CTL_(.*)_NAMES)\s+{/ ||
-		    $_ =~ /^#define\s+((.*)CTL_NAMES)\s+{/) {
-			if ($1 eq 'CTL_NAMES') {
-				# Top level.
-				$node = \%mib;
-			} else {
-				# Node.
-				my $nodename = lc($2);
-				if ($header =~ /^netinet\//) {
-					$ctlname = "net.inet.$nodename";
-				} elsif ($header =~ /^netinet6\//) {
-					$ctlname = "net.inet6.$nodename";
-				} elsif ($header =~ /^net\//) {
-					$ctlname = "net.$nodename";
-				} else {
-					$ctlname = "$nodename";
-					$ctlname =~ s/^(fs|net|kern)_/$1\./;
-				}
-				if (exists $ctl_map{$ctlname}) {
-					$ctlname = $ctl_map{$ctlname};
-				}
-				if (not exists $ctls{$ctlname}) {
-					&debug("Ignoring $ctlname...");
-					next;
-				}
-
-				# Walk down from the top of the MIB.
-				$node = \%mib;
-				foreach my $part (split /\./, $ctlname) {
-					if (not exists $$node{$part}) {
-						&debug("Missing node $part");
-						$$node{$part} = [ 0, '', {} ];
-					}
-					$node = \%{@{$$node{$part}}[2]};
-				}
-			}
-
-			# Populate current node with entries.
-			my $i = -1;
-			while (defined($_) && $_ !~ /^}/) {
-				$_ = <HEADER>;
-				$i++ if $_ =~ /{.*}/;
-				next if $_ !~ /{\s+"(\w+)",\s+(CTLTYPE_[A-Z]+)\s+}/;
-				$$node{$1} = [ $i, $2, {} ];
-			}
-		}
-	}
-	close HEADER;
-}
-
-&build_sysctl(\%mib, "", []);
-
-print <<EOF;
-// mksysctl_openbsd.pl
-// Code generated by the command above; DO NOT EDIT.
-
-// +build $ENV{'GOARCH'},$ENV{'GOOS'}
-
-package unix;
-
-type mibentry struct {
-	ctlname string
-	ctloid []_C_int
-}
-
-var sysctlMib = []mibentry {
-EOF
-
-foreach my $name (sort keys %sysctl) {
-	my @oid = @{$sysctl{$name}};
-	print "\t{ \"$name\", []_C_int{ ", join(', ', @oid), " } }, \n";
-}
-
-print <<EOF;
-}
-EOF
diff --git a/vendor/golang.org/x/sys/unix/mksysnum.go b/vendor/golang.org/x/sys/unix/mksysnum.go
index 07f8960..baa6ecd 100644
--- a/vendor/golang.org/x/sys/unix/mksysnum.go
+++ b/vendor/golang.org/x/sys/unix/mksysnum.go
@@ -139,7 +139,7 @@ func main() {
 				text += format(name, num, proto)
 			}
 		case "freebsd":
-			if t.Match(`^([0-9]+)\s+\S+\s+(?:NO)?STD\s+({ \S+\s+(\w+).*)$`) {
+			if t.Match(`^([0-9]+)\s+\S+\s+(?:(?:NO)?STD|COMPAT10)\s+({ \S+\s+(\w+).*)$`) {
 				num, proto := t.sub[1], t.sub[2]
 				name := fmt.Sprintf("SYS_%s", t.sub[3])
 				text += format(name, num, proto)
diff --git a/vendor/golang.org/x/sys/unix/openbsd_pledge.go b/vendor/golang.org/x/sys/unix/pledge_openbsd.go
similarity index 98%
rename from vendor/golang.org/x/sys/unix/openbsd_pledge.go
rename to vendor/golang.org/x/sys/unix/pledge_openbsd.go
index 230a36d..eb48294 100644
--- a/vendor/golang.org/x/sys/unix/openbsd_pledge.go
+++ b/vendor/golang.org/x/sys/unix/pledge_openbsd.go
@@ -2,9 +2,6 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-// +build openbsd
-// +build 386 amd64 arm
-
 package unix
 
 import (
diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdents.go b/vendor/golang.org/x/sys/unix/readdirent_getdents.go
new file mode 100644
index 0000000..3a90aa6
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/readdirent_getdents.go
@@ -0,0 +1,12 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build aix dragonfly freebsd linux netbsd openbsd
+
+package unix
+
+// ReadDirent reads directory entries from fd and writes them into buf.
+func ReadDirent(fd int, buf []byte) (n int, err error) {
+	return Getdents(fd, buf)
+}
diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go
new file mode 100644
index 0000000..5fdae40
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go
@@ -0,0 +1,19 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build darwin
+
+package unix
+
+import "unsafe"
+
+// ReadDirent reads directory entries from fd and writes them into buf.
+func ReadDirent(fd int, buf []byte) (n int, err error) {
+	// Final argument is (basep *uintptr) and the syscall doesn't take nil.
+	// 64 bits should be enough. (32 bits isn't even on 386). Since the
+	// actual system call is getdirentries64, 64 is a good guess.
+	// TODO(rsc): Can we use a single global basep for all calls?
+	var base = (*uintptr)(unsafe.Pointer(new(uint64)))
+	return Getdirentries(fd, buf, base)
+}
diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go
index 723b7f1..062bcab 100644
--- a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go
+++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go
@@ -21,10 +21,10 @@ func cmsgAlignOf(salen int) int {
 	case "aix":
 		// There is no alignment on AIX.
 		salign = 1
-	case "darwin", "dragonfly", "solaris":
-		// NOTE: It seems like 64-bit Darwin, DragonFly BSD and
-		// Solaris kernels still require 32-bit aligned access to
-		// network subsystem.
+	case "darwin", "dragonfly", "solaris", "illumos":
+		// NOTE: It seems like 64-bit Darwin, DragonFly BSD,
+		// illumos, and Solaris kernels still require 32-bit
+		// aligned access to network subsystem.
 		if SizeofPtr == 8 {
 			salign = 4
 		}
diff --git a/vendor/golang.org/x/sys/unix/syscall.go b/vendor/golang.org/x/sys/unix/syscall.go
index 0d4b1d7..fd4ee8e 100644
--- a/vendor/golang.org/x/sys/unix/syscall.go
+++ b/vendor/golang.org/x/sys/unix/syscall.go
@@ -50,5 +50,4 @@ func BytePtrFromString(s string) (*byte, error) {
 }
 
 // Single-word zero for use when we need a valid pointer to 0 bytes.
-// See mkunix.pl.
 var _zero uintptr
diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go
index fd83d87..1aa065f 100644
--- a/vendor/golang.org/x/sys/unix/syscall_aix.go
+++ b/vendor/golang.org/x/sys/unix/syscall_aix.go
@@ -280,8 +280,24 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 	return -1, ENOSYS
 }
 
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen))
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	reclen, ok := direntReclen(buf)
+	if !ok {
+		return 0, false
+	}
+	return reclen - uint64(unsafe.Offsetof(Dirent{}.Name)), true
+}
+
 //sys	getdirent(fd int, buf []byte) (n int, err error)
-func ReadDirent(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	return getdirent(fd, buf)
 }
 
@@ -444,8 +460,6 @@ func IoctlGetTermios(fd int, req uint) (*Termios, error) {
 //sysnb	Times(tms *Tms) (ticks uintptr, err error)
 //sysnb	Umask(mask int) (oldmask int)
 //sysnb	Uname(buf *Utsname) (err error)
-//TODO umount
-// //sys	Unmount(target string, flags int) (err error) = umount
 //sys   Unlink(path string) (err error)
 //sys   Unlinkat(dirfd int, path string, flags int) (err error)
 //sys	Ustat(dev int, ubuf *Ustat_t) (err error)
@@ -456,8 +470,8 @@ func IoctlGetTermios(fd int, req uint) (*Termios, error) {
 //sys	Dup2(oldfd int, newfd int) (err error)
 //sys	Fadvise(fd int, offset int64, length int64, advice int) (err error) = posix_fadvise64
 //sys	Fchown(fd int, uid int, gid int) (err error)
-//sys	Fstat(fd int, stat *Stat_t) (err error)
-//sys	Fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) = fstatat
+//sys	fstat(fd int, stat *Stat_t) (err error)
+//sys	fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) = fstatat
 //sys	Fstatfs(fd int, buf *Statfs_t) (err error)
 //sys	Ftruncate(fd int, length int64) (err error)
 //sysnb	Getegid() (egid int)
@@ -466,18 +480,17 @@ func IoctlGetTermios(fd int, req uint) (*Termios, error) {
 //sysnb	Getuid() (uid int)
 //sys	Lchown(path string, uid int, gid int) (err error)
 //sys	Listen(s int, n int) (err error)
-//sys	Lstat(path string, stat *Stat_t) (err error)
+//sys	lstat(path string, stat *Stat_t) (err error)
 //sys	Pause() (err error)
 //sys	Pread(fd int, p []byte, offset int64) (n int, err error) = pread64
 //sys	Pwrite(fd int, p []byte, offset int64) (n int, err error) = pwrite64
-//TODO Select
-// //sys	Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error)
+//sys	Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error)
 //sys	Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error)
 //sysnb	Setregid(rgid int, egid int) (err error)
 //sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
-//sys	Stat(path string, stat *Stat_t) (err error)
+//sys	stat(path string, statptr *Stat_t) (err error)
 //sys	Statfs(path string, buf *Statfs_t) (err error)
 //sys	Truncate(path string, length int64) (err error)
 
@@ -493,8 +506,10 @@ func IoctlGetTermios(fd int, req uint) (*Termios, error) {
 //sysnb	getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error)
 //sys	recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error)
 //sys	sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error)
-//sys	recvmsg(s int, msg *Msghdr, flags int) (n int, err error)
-//sys	sendmsg(s int, msg *Msghdr, flags int) (n int, err error)
+
+// In order to use msghdr structure with Control, Controllen, nrecvmsg and nsendmsg must be used.
+//sys	recvmsg(s int, msg *Msghdr, flags int) (n int, err error) = nrecvmsg
+//sys	sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg
 
 //sys	munmap(addr uintptr, length uintptr) (err error)
 
@@ -547,3 +562,12 @@ func Poll(fds []PollFd, timeout int) (n int, err error) {
 //sys	Utime(path string, buf *Utimbuf) (err error)
 
 //sys	Getsystemcfg(label int) (n uint64)
+
+//sys	umount(target string) (err error)
+func Unmount(target string, flags int) (err error) {
+	if flags != 0 {
+		// AIX doesn't have any flags for umount.
+		return ENOSYS
+	}
+	return umount(target)
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go
index c28af1f..bf05603 100644
--- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go
@@ -32,3 +32,19 @@ func (msghdr *Msghdr) SetControllen(length int) {
 func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }
+
+func Fstat(fd int, stat *Stat_t) error {
+	return fstat(fd, stat)
+}
+
+func Fstatat(dirfd int, path string, stat *Stat_t, flags int) error {
+	return fstatat(dirfd, path, stat, flags)
+}
+
+func Lstat(path string, stat *Stat_t) error {
+	return lstat(path, stat)
+}
+
+func Stat(path string, statptr *Stat_t) error {
+	return stat(path, statptr)
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go
index 881cacc..13d4321 100644
--- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go
@@ -32,3 +32,50 @@ func (msghdr *Msghdr) SetControllen(length int) {
 func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }
+
+// In order to only have Timespec structure, type of Stat_t's fields
+// Atim, Mtim and Ctim is changed from StTimespec to Timespec during
+// ztypes generation.
+// On ppc64, Timespec.Nsec is an int64 while StTimespec.Nsec is an
+// int32, so the fields' value must be modified.
+func fixStatTimFields(stat *Stat_t) {
+	stat.Atim.Nsec >>= 32
+	stat.Mtim.Nsec >>= 32
+	stat.Ctim.Nsec >>= 32
+}
+
+func Fstat(fd int, stat *Stat_t) error {
+	err := fstat(fd, stat)
+	if err != nil {
+		return err
+	}
+	fixStatTimFields(stat)
+	return nil
+}
+
+func Fstatat(dirfd int, path string, stat *Stat_t, flags int) error {
+	err := fstatat(dirfd, path, stat, flags)
+	if err != nil {
+		return err
+	}
+	fixStatTimFields(stat)
+	return nil
+}
+
+func Lstat(path string, stat *Stat_t) error {
+	err := lstat(path, stat)
+	if err != nil {
+		return err
+	}
+	fixStatTimFields(stat)
+	return nil
+}
+
+func Stat(path string, statptr *Stat_t) error {
+	err := stat(path, statptr)
+	if err != nil {
+		return err
+	}
+	fixStatTimFields(statptr)
+	return nil
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go
index 33c8b5f..97a8eef 100644
--- a/vendor/golang.org/x/sys/unix/syscall_bsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go
@@ -63,15 +63,6 @@ func Setgroups(gids []int) (err error) {
 	return setgroups(len(a), &a[0])
 }
 
-func ReadDirent(fd int, buf []byte) (n int, err error) {
-	// Final argument is (basep *uintptr) and the syscall doesn't take nil.
-	// 64 bits should be enough. (32 bits isn't even on 386). Since the
-	// actual system call is getdirentries64, 64 is a good guess.
-	// TODO(rsc): Can we use a single global basep for all calls?
-	var base = (*uintptr)(unsafe.Pointer(new(uint64)))
-	return Getdirentries(fd, buf, base)
-}
-
 // Wait status is 7 bits at bottom, either 0 (exited),
 // 0x7F (stopped), or a signal number that caused an exit.
 // The 0x80 bit is whether there was a core dump.
@@ -86,6 +77,7 @@ const (
 	shift = 8
 
 	exited  = 0
+	killed  = 9
 	stopped = 0x7F
 )
 
@@ -112,6 +104,8 @@ func (w WaitStatus) CoreDump() bool { return w.Signaled() && w&core != 0 }
 
 func (w WaitStatus) Stopped() bool { return w&mask == stopped && syscall.Signal(w>>shift) != SIGSTOP }
 
+func (w WaitStatus) Killed() bool { return w&mask == killed && syscall.Signal(w>>shift) != SIGKILL }
+
 func (w WaitStatus) Continued() bool { return w&mask == stopped && syscall.Signal(w>>shift) == SIGSTOP }
 
 func (w WaitStatus) StopSignal() syscall.Signal {
diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go
index 2120091..216b4ac 100644
--- a/vendor/golang.org/x/sys/unix/syscall_darwin.go
+++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go
@@ -77,6 +77,18 @@ func nametomib(name string) (mib []_C_int, err error) {
 	return buf[0 : n/siz], nil
 }
 
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen))
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Namlen), unsafe.Sizeof(Dirent{}.Namlen))
+}
+
 //sys   ptrace(request int, pid int, addr uintptr, data uintptr) (err error)
 func PtraceAttach(pid int) (err error) { return ptrace(PT_ATTACH, pid, 0, 0) }
 func PtraceDetach(pid int) (err error) { return ptrace(PT_DETACH, pid, 0, 0) }
diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go
index 962eee3..260a400 100644
--- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go
+++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go
@@ -57,6 +57,22 @@ func nametomib(name string) (mib []_C_int, err error) {
 	return buf[0 : n/siz], nil
 }
 
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Fileno), unsafe.Sizeof(Dirent{}.Fileno))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	namlen, ok := direntNamlen(buf)
+	if !ok {
+		return 0, false
+	}
+	return (16 + namlen + 1 + 7) &^ 7, true
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Namlen), unsafe.Sizeof(Dirent{}.Namlen))
+}
+
 //sysnb pipe() (r int, w int, err error)
 
 func Pipe(p []int) (err error) {
@@ -269,6 +285,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	Fstatfs(fd int, stat *Statfs_t) (err error)
 //sys	Fsync(fd int) (err error)
 //sys	Ftruncate(fd int, length int64) (err error)
+//sys	Getdents(fd int, buf []byte) (n int, err error)
 //sys	Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error)
 //sys	Getdtablesize() (size int)
 //sysnb	Getegid() (egid int)
diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go
index a7ca1eb..329d240 100644
--- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go
@@ -82,6 +82,18 @@ func nametomib(name string) (mib []_C_int, err error) {
 	return buf[0 : n/siz], nil
 }
 
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Fileno), unsafe.Sizeof(Dirent{}.Fileno))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen))
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Namlen), unsafe.Sizeof(Dirent{}.Namlen))
+}
+
 func Pipe(p []int) (err error) {
 	return Pipe2(p, 0)
 }
@@ -362,7 +374,21 @@ func Getdents(fd int, buf []byte) (n int, err error) {
 
 func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 	if supportsABI(_ino64First) {
-		return getdirentries_freebsd12(fd, buf, basep)
+		if basep == nil || unsafe.Sizeof(*basep) == 8 {
+			return getdirentries_freebsd12(fd, buf, (*uint64)(unsafe.Pointer(basep)))
+		}
+		// The freebsd12 syscall needs a 64-bit base. On 32-bit machines
+		// we can't just use the basep passed in. See #32498.
+		var base uint64 = uint64(*basep)
+		n, err = getdirentries_freebsd12(fd, buf, &base)
+		*basep = uintptr(base)
+		if base>>32 != 0 {
+			// We can't stuff the base back into a uintptr, so any
+			// future calls would be suspect. Generate an error.
+			// EIO is allowed by getdirentries.
+			err = EIO
+		}
+		return
 	}
 
 	// The old syscall entries are smaller than the new. Use 1/4 of the original
@@ -404,22 +430,22 @@ func roundup(x, y int) int {
 
 func (s *Stat_t) convertFrom(old *stat_freebsd11_t) {
 	*s = Stat_t{
-		Dev:      uint64(old.Dev),
-		Ino:      uint64(old.Ino),
-		Nlink:    uint64(old.Nlink),
-		Mode:     old.Mode,
-		Uid:      old.Uid,
-		Gid:      old.Gid,
-		Rdev:     uint64(old.Rdev),
-		Atim:     old.Atim,
-		Mtim:     old.Mtim,
-		Ctim:     old.Ctim,
-		Birthtim: old.Birthtim,
-		Size:     old.Size,
-		Blocks:   old.Blocks,
-		Blksize:  old.Blksize,
-		Flags:    old.Flags,
-		Gen:      uint64(old.Gen),
+		Dev:     uint64(old.Dev),
+		Ino:     uint64(old.Ino),
+		Nlink:   uint64(old.Nlink),
+		Mode:    old.Mode,
+		Uid:     old.Uid,
+		Gid:     old.Gid,
+		Rdev:    uint64(old.Rdev),
+		Atim:    old.Atim,
+		Mtim:    old.Mtim,
+		Ctim:    old.Ctim,
+		Btim:    old.Btim,
+		Size:    old.Size,
+		Blocks:  old.Blocks,
+		Blksize: old.Blksize,
+		Flags:   old.Flags,
+		Gen:     uint64(old.Gen),
 	}
 }
 
@@ -507,6 +533,70 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 	return sendfile(outfd, infd, offset, count)
 }
 
+//sys	ptrace(request int, pid int, addr uintptr, data int) (err error)
+
+func PtraceAttach(pid int) (err error) {
+	return ptrace(PTRACE_ATTACH, pid, 0, 0)
+}
+
+func PtraceCont(pid int, signal int) (err error) {
+	return ptrace(PTRACE_CONT, pid, 1, signal)
+}
+
+func PtraceDetach(pid int) (err error) {
+	return ptrace(PTRACE_DETACH, pid, 1, 0)
+}
+
+func PtraceGetFpRegs(pid int, fpregsout *FpReg) (err error) {
+	return ptrace(PTRACE_GETFPREGS, pid, uintptr(unsafe.Pointer(fpregsout)), 0)
+}
+
+func PtraceGetFsBase(pid int, fsbase *int64) (err error) {
+	return ptrace(PTRACE_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0)
+}
+
+func PtraceGetRegs(pid int, regsout *Reg) (err error) {
+	return ptrace(PTRACE_GETREGS, pid, uintptr(unsafe.Pointer(regsout)), 0)
+}
+
+func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) {
+	ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint(countin)}
+	err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
+	return int(ioDesc.Len), err
+}
+
+func PtraceLwpEvents(pid int, enable int) (err error) {
+	return ptrace(PTRACE_LWPEVENTS, pid, 0, enable)
+}
+
+func PtraceLwpInfo(pid int, info uintptr) (err error) {
+	return ptrace(PTRACE_LWPINFO, pid, info, int(unsafe.Sizeof(PtraceLwpInfoStruct{})))
+}
+
+func PtracePeekData(pid int, addr uintptr, out []byte) (count int, err error) {
+	return PtraceIO(PIOD_READ_D, pid, addr, out, SizeofLong)
+}
+
+func PtracePeekText(pid int, addr uintptr, out []byte) (count int, err error) {
+	return PtraceIO(PIOD_READ_I, pid, addr, out, SizeofLong)
+}
+
+func PtracePokeData(pid int, addr uintptr, data []byte) (count int, err error) {
+	return PtraceIO(PIOD_WRITE_D, pid, addr, data, SizeofLong)
+}
+
+func PtracePokeText(pid int, addr uintptr, data []byte) (count int, err error) {
+	return PtraceIO(PIOD_WRITE_I, pid, addr, data, SizeofLong)
+}
+
+func PtraceSetRegs(pid int, regs *Reg) (err error) {
+	return ptrace(PTRACE_SETREGS, pid, uintptr(unsafe.Pointer(regs)), 0)
+}
+
+func PtraceSingleStep(pid int) (err error) {
+	return ptrace(PTRACE_SINGLESTEP, pid, 1, 0)
+}
+
 /*
  * Exposed directly
  */
@@ -555,7 +645,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	Fsync(fd int) (err error)
 //sys	Ftruncate(fd int, length int64) (err error)
 //sys	getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error)
-//sys	getdirentries_freebsd12(fd int, buf []byte, basep *uintptr) (n int, err error)
+//sys	getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error)
 //sys	Getdtablesize() (size int)
 //sysnb	Getegid() (egid int)
 //sysnb	Geteuid() (uid int)
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go
index 7e429ab..637b501 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux.go
@@ -13,7 +13,6 @@ package unix
 
 import (
 	"encoding/binary"
-	"net"
 	"runtime"
 	"syscall"
 	"unsafe"
@@ -109,6 +108,12 @@ func IoctlGetInt(fd int, req uint) (int, error) {
 	return value, err
 }
 
+func IoctlGetUint32(fd int, req uint) (uint32, error) {
+	var value uint32
+	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
+	return value, err
+}
+
 func IoctlGetWinsize(fd int, req uint) (*Winsize, error) {
 	var value Winsize
 	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
@@ -759,7 +764,7 @@ const px_proto_oe = 0
 
 type SockaddrPPPoE struct {
 	SID    uint16
-	Remote net.HardwareAddr
+	Remote []byte
 	Dev    string
 	raw    RawSockaddrPPPoX
 }
@@ -910,7 +915,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) {
 		}
 		sa := &SockaddrPPPoE{
 			SID:    binary.BigEndian.Uint16(pp[6:8]),
-			Remote: net.HardwareAddr(pp[8:14]),
+			Remote: pp[8:14],
 		}
 		for i := 14; i < 14+IFNAMSIZ; i++ {
 			if pp[i] == 0 {
@@ -1408,8 +1413,20 @@ func Reboot(cmd int) (err error) {
 	return reboot(LINUX_REBOOT_MAGIC1, LINUX_REBOOT_MAGIC2, cmd, "")
 }
 
-func ReadDirent(fd int, buf []byte) (n int, err error) {
-	return Getdents(fd, buf)
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen))
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	reclen, ok := direntReclen(buf)
+	if !ok {
+		return 0, false
+	}
+	return reclen - uint64(unsafe.Offsetof(Dirent{}.Name)), true
 }
 
 //sys	mount(source string, target string, fstype string, flags uintptr, data *byte) (err error)
@@ -1444,6 +1461,8 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	Acct(path string) (err error)
 //sys	AddKey(keyType string, description string, payload []byte, ringid int) (id int, err error)
 //sys	Adjtimex(buf *Timex) (state int, err error)
+//sys	Capget(hdr *CapUserHeader, data *CapUserData) (err error)
+//sys	Capset(hdr *CapUserHeader, data *CapUserData) (err error)
 //sys	Chdir(path string) (err error)
 //sys	Chroot(path string) (err error)
 //sys	ClockGetres(clockid int32, res *Timespec) (err error)
@@ -1531,9 +1550,13 @@ func Setgid(uid int) (err error) {
 	return EOPNOTSUPP
 }
 
+func Signalfd(fd int, sigmask *Sigset_t, flags int) (newfd int, err error) {
+	return signalfd(fd, sigmask, _C__NSIG/8, flags)
+}
+
 //sys	Setpriority(which int, who int, prio int) (err error)
 //sys	Setxattr(path string, attr string, data []byte, flags int) (err error)
-//sys	Signalfd(fd int, mask *Sigset_t, flags int) = SYS_SIGNALFD4
+//sys	signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) = SYS_SIGNALFD4
 //sys	Statx(dirfd int, path string, flags int, mask int, stat *Statx_t) (err error)
 //sys	Sync()
 //sys	Syncfs(fd int) (err error)
@@ -1662,6 +1685,82 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) {
 	return EACCES
 }
 
+//sys nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) = SYS_NAME_TO_HANDLE_AT
+//sys openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) = SYS_OPEN_BY_HANDLE_AT
+
+// fileHandle is the argument to nameToHandleAt and openByHandleAt. We
+// originally tried to generate it via unix/linux/types.go with "type
+// fileHandle C.struct_file_handle" but that generated empty structs
+// for mips64 and mips64le. Instead, hard code it for now (it's the
+// same everywhere else) until the mips64 generator issue is fixed.
+type fileHandle struct {
+	Bytes uint32
+	Type  int32
+}
+
+// FileHandle represents the C struct file_handle used by
+// name_to_handle_at (see NameToHandleAt) and open_by_handle_at (see
+// OpenByHandleAt).
+type FileHandle struct {
+	*fileHandle
+}
+
+// NewFileHandle constructs a FileHandle.
+func NewFileHandle(handleType int32, handle []byte) FileHandle {
+	const hdrSize = unsafe.Sizeof(fileHandle{})
+	buf := make([]byte, hdrSize+uintptr(len(handle)))
+	copy(buf[hdrSize:], handle)
+	fh := (*fileHandle)(unsafe.Pointer(&buf[0]))
+	fh.Type = handleType
+	fh.Bytes = uint32(len(handle))
+	return FileHandle{fh}
+}
+
+func (fh *FileHandle) Size() int   { return int(fh.fileHandle.Bytes) }
+func (fh *FileHandle) Type() int32 { return fh.fileHandle.Type }
+func (fh *FileHandle) Bytes() []byte {
+	n := fh.Size()
+	if n == 0 {
+		return nil
+	}
+	return (*[1 << 30]byte)(unsafe.Pointer(uintptr(unsafe.Pointer(&fh.fileHandle.Type)) + 4))[:n:n]
+}
+
+// NameToHandleAt wraps the name_to_handle_at system call; it obtains
+// a handle for a path name.
+func NameToHandleAt(dirfd int, path string, flags int) (handle FileHandle, mountID int, err error) {
+	var mid _C_int
+	// Try first with a small buffer, assuming the handle will
+	// only be 32 bytes.
+	size := uint32(32 + unsafe.Sizeof(fileHandle{}))
+	didResize := false
+	for {
+		buf := make([]byte, size)
+		fh := (*fileHandle)(unsafe.Pointer(&buf[0]))
+		fh.Bytes = size - uint32(unsafe.Sizeof(fileHandle{}))
+		err = nameToHandleAt(dirfd, path, fh, &mid, flags)
+		if err == EOVERFLOW {
+			if didResize {
+				// We shouldn't need to resize more than once
+				return
+			}
+			didResize = true
+			size = fh.Bytes + uint32(unsafe.Sizeof(fileHandle{}))
+			continue
+		}
+		if err != nil {
+			return
+		}
+		return FileHandle{fh}, int(mid), nil
+	}
+}
+
+// OpenByHandleAt wraps the open_by_handle_at system call; it opens a
+// file via a handle as previously returned by NameToHandleAt.
+func OpenByHandleAt(mountFD int, handle FileHandle, flags int) (fd int, err error) {
+	return openByHandleAt(mountFD, handle.fileHandle, flags)
+}
+
 /*
  * Unimplemented
  */
@@ -1669,8 +1768,6 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) {
 // Alarm
 // ArchPrctl
 // Brk
-// Capget
-// Capset
 // ClockNanosleep
 // ClockSettime
 // Clone
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go
index 3a3c37b..f626794 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go
@@ -272,3 +272,16 @@ func SyncFileRange(fd int, off int64, n int64, flags int) error {
 	// order of their arguments.
 	return armSyncFileRange(fd, flags, off, n)
 }
+
+//sys	kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, flags int) (err error)
+
+func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error {
+	cmdlineLen := len(cmdline)
+	if cmdlineLen > 0 {
+		// Account for the additional NULL byte added by
+		// BytePtrFromString in kexecFileLoad. The kexec_file_load
+		// syscall expects a NULL-terminated string.
+		cmdlineLen++
+	}
+	return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags)
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go
index 5240e16..5ef3090 100644
--- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go
@@ -94,6 +94,18 @@ func nametomib(name string) (mib []_C_int, err error) {
 	return mib, nil
 }
 
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Fileno), unsafe.Sizeof(Dirent{}.Fileno))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen))
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Namlen), unsafe.Sizeof(Dirent{}.Namlen))
+}
+
 func SysctlClockinfo(name string) (*Clockinfo, error) {
 	mib, err := sysctlmib(name)
 	if err != nil {
@@ -120,9 +132,30 @@ func Pipe(p []int) (err error) {
 	return
 }
 
-//sys getdents(fd int, buf []byte) (n int, err error)
+//sys Getdents(fd int, buf []byte) (n int, err error)
 func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
-	return getdents(fd, buf)
+	n, err = Getdents(fd, buf)
+	if err != nil || basep == nil {
+		return
+	}
+
+	var off int64
+	off, err = Seek(fd, 0, 1 /* SEEK_CUR */)
+	if err != nil {
+		*basep = ^uintptr(0)
+		return
+	}
+	*basep = uintptr(off)
+	if unsafe.Sizeof(*basep) == 8 {
+		return
+	}
+	if off>>32 != 0 {
+		// We can't stuff the offset back into a uintptr, so any
+		// future calls would be suspect. Generate an error.
+		// EIO is allowed by getdirentries.
+		err = EIO
+	}
+	return
 }
 
 const ImplementsGetwd = true
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go
index c8648ec..1a074b2 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go
@@ -43,6 +43,18 @@ func nametomib(name string) (mib []_C_int, err error) {
 	return nil, EINVAL
 }
 
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Fileno), unsafe.Sizeof(Dirent{}.Fileno))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen))
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Namlen), unsafe.Sizeof(Dirent{}.Namlen))
+}
+
 func SysctlClockinfo(name string) (*Clockinfo, error) {
 	mib, err := sysctlmib(name)
 	if err != nil {
@@ -89,9 +101,30 @@ func Pipe(p []int) (err error) {
 	return
 }
 
-//sys getdents(fd int, buf []byte) (n int, err error)
+//sys Getdents(fd int, buf []byte) (n int, err error)
 func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
-	return getdents(fd, buf)
+	n, err = Getdents(fd, buf)
+	if err != nil || basep == nil {
+		return
+	}
+
+	var off int64
+	off, err = Seek(fd, 0, 1 /* SEEK_CUR */)
+	if err != nil {
+		*basep = ^uintptr(0)
+		return
+	}
+	*basep = uintptr(off)
+	if unsafe.Sizeof(*basep) == 8 {
+		return
+	}
+	if off>>32 != 0 {
+		// We can't stuff the offset back into a uintptr, so any
+		// future calls would be suspect. Generate an error.
+		// EIO was allowed by getdirentries.
+		err = EIO
+	}
+	return
 }
 
 const ImplementsGetwd = true
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go
new file mode 100644
index 0000000..0fb39cf
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go
@@ -0,0 +1,37 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build arm64,openbsd
+
+package unix
+
+func setTimespec(sec, nsec int64) Timespec {
+	return Timespec{Sec: sec, Nsec: nsec}
+}
+
+func setTimeval(sec, usec int64) Timeval {
+	return Timeval{Sec: sec, Usec: usec}
+}
+
+func SetKevent(k *Kevent_t, fd, mode, flags int) {
+	k.Ident = uint64(fd)
+	k.Filter = int16(mode)
+	k.Flags = uint16(flags)
+}
+
+func (iov *Iovec) SetLen(length int) {
+	iov.Len = uint64(length)
+}
+
+func (msghdr *Msghdr) SetControllen(length int) {
+	msghdr.Controllen = uint32(length)
+}
+
+func (cmsg *Cmsghdr) SetLen(length int) {
+	cmsg.Len = uint32(length)
+}
+
+// SYS___SYSCTL is used by syscall_bsd.go for all BSDs, but in modern versions
+// of openbsd/amd64 the syscall is called sysctl instead of __sysctl.
+const SYS___SYSCTL = SYS_SYSCTL
diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go
index e478012..0153a31 100644
--- a/vendor/golang.org/x/sys/unix/syscall_solaris.go
+++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go
@@ -35,6 +35,22 @@ type SockaddrDatalink struct {
 	raw    RawSockaddrDatalink
 }
 
+func direntIno(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino))
+}
+
+func direntReclen(buf []byte) (uint64, bool) {
+	return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen))
+}
+
+func direntNamlen(buf []byte) (uint64, bool) {
+	reclen, ok := direntReclen(buf)
+	if !ok {
+		return 0, false
+	}
+	return reclen - uint64(unsafe.Offsetof(Dirent{}.Name)), true
+}
+
 //sysnb	pipe(p *[2]_C_int) (n int, err error)
 
 func Pipe(p []int) (err error) {
@@ -189,6 +205,7 @@ func Setgroups(gids []int) (err error) {
 	return setgroups(len(a), &a[0])
 }
 
+// ReadDirent reads directory entries from fd and writes them into buf.
 func ReadDirent(fd int, buf []byte) (n int, err error) {
 	// Final argument is (basep *uintptr) and the syscall doesn't take nil.
 	// TODO(rsc): Can we use a single global basep for all calls?
diff --git a/vendor/golang.org/x/sys/unix/types_aix.go b/vendor/golang.org/x/sys/unix/types_aix.go
index 25e8349..40d2bee 100644
--- a/vendor/golang.org/x/sys/unix/types_aix.go
+++ b/vendor/golang.org/x/sys/unix/types_aix.go
@@ -87,8 +87,6 @@ type Mode_t C.mode_t
 
 type Timespec C.struct_timespec
 
-type StTimespec C.struct_st_timespec
-
 type Timeval C.struct_timeval
 
 type Timeval32 C.struct_timeval32
@@ -133,6 +131,8 @@ type RawSockaddrInet6 C.struct_sockaddr_in6
 
 type RawSockaddrUnix C.struct_sockaddr_un
 
+type RawSockaddrDatalink C.struct_sockaddr_dl
+
 type RawSockaddr C.struct_sockaddr
 
 type RawSockaddrAny C.struct_sockaddr_any
@@ -156,17 +156,18 @@ type Linger C.struct_linger
 type Msghdr C.struct_msghdr
 
 const (
-	SizeofSockaddrInet4 = C.sizeof_struct_sockaddr_in
-	SizeofSockaddrInet6 = C.sizeof_struct_sockaddr_in6
-	SizeofSockaddrAny   = C.sizeof_struct_sockaddr_any
-	SizeofSockaddrUnix  = C.sizeof_struct_sockaddr_un
-	SizeofLinger        = C.sizeof_struct_linger
-	SizeofIPMreq        = C.sizeof_struct_ip_mreq
-	SizeofIPv6Mreq      = C.sizeof_struct_ipv6_mreq
-	SizeofIPv6MTUInfo   = C.sizeof_struct_ip6_mtuinfo
-	SizeofMsghdr        = C.sizeof_struct_msghdr
-	SizeofCmsghdr       = C.sizeof_struct_cmsghdr
-	SizeofICMPv6Filter  = C.sizeof_struct_icmp6_filter
+	SizeofSockaddrInet4    = C.sizeof_struct_sockaddr_in
+	SizeofSockaddrInet6    = C.sizeof_struct_sockaddr_in6
+	SizeofSockaddrAny      = C.sizeof_struct_sockaddr_any
+	SizeofSockaddrUnix     = C.sizeof_struct_sockaddr_un
+	SizeofSockaddrDatalink = C.sizeof_struct_sockaddr_dl
+	SizeofLinger           = C.sizeof_struct_linger
+	SizeofIPMreq           = C.sizeof_struct_ip_mreq
+	SizeofIPv6Mreq         = C.sizeof_struct_ipv6_mreq
+	SizeofIPv6MTUInfo      = C.sizeof_struct_ip6_mtuinfo
+	SizeofMsghdr           = C.sizeof_struct_msghdr
+	SizeofCmsghdr          = C.sizeof_struct_cmsghdr
+	SizeofICMPv6Filter     = C.sizeof_struct_icmp6_filter
 )
 
 // Routing and interface messages
diff --git a/vendor/golang.org/x/sys/unix/types_freebsd.go b/vendor/golang.org/x/sys/unix/types_freebsd.go
index 7470798..a121dc3 100644
--- a/vendor/golang.org/x/sys/unix/types_freebsd.go
+++ b/vendor/golang.org/x/sys/unix/types_freebsd.go
@@ -243,11 +243,55 @@ const (
 // Ptrace requests
 
 const (
-	PTRACE_TRACEME = C.PT_TRACE_ME
-	PTRACE_CONT    = C.PT_CONTINUE
-	PTRACE_KILL    = C.PT_KILL
+	PTRACE_ATTACH     = C.PT_ATTACH
+	PTRACE_CONT       = C.PT_CONTINUE
+	PTRACE_DETACH     = C.PT_DETACH
+	PTRACE_GETFPREGS  = C.PT_GETFPREGS
+	PTRACE_GETFSBASE  = C.PT_GETFSBASE
+	PTRACE_GETLWPLIST = C.PT_GETLWPLIST
+	PTRACE_GETNUMLWPS = C.PT_GETNUMLWPS
+	PTRACE_GETREGS    = C.PT_GETREGS
+	PTRACE_GETXSTATE  = C.PT_GETXSTATE
+	PTRACE_IO         = C.PT_IO
+	PTRACE_KILL       = C.PT_KILL
+	PTRACE_LWPEVENTS  = C.PT_LWP_EVENTS
+	PTRACE_LWPINFO    = C.PT_LWPINFO
+	PTRACE_SETFPREGS  = C.PT_SETFPREGS
+	PTRACE_SETREGS    = C.PT_SETREGS
+	PTRACE_SINGLESTEP = C.PT_STEP
+	PTRACE_TRACEME    = C.PT_TRACE_ME
 )
 
+const (
+	PIOD_READ_D  = C.PIOD_READ_D
+	PIOD_WRITE_D = C.PIOD_WRITE_D
+	PIOD_READ_I  = C.PIOD_READ_I
+	PIOD_WRITE_I = C.PIOD_WRITE_I
+)
+
+const (
+	PL_FLAG_BORN   = C.PL_FLAG_BORN
+	PL_FLAG_EXITED = C.PL_FLAG_EXITED
+	PL_FLAG_SI     = C.PL_FLAG_SI
+)
+
+const (
+	TRAP_BRKPT = C.TRAP_BRKPT
+	TRAP_TRACE = C.TRAP_TRACE
+)
+
+type PtraceLwpInfoStruct C.struct_ptrace_lwpinfo
+
+type __Siginfo C.struct___siginfo
+
+type Sigset_t C.sigset_t
+
+type Reg C.struct_reg
+
+type FpReg C.struct_fpreg
+
+type PtraceIoDesc C.struct_ptrace_io_desc
+
 // Events (kqueue, kevent)
 
 type Kevent_t C.struct_kevent_freebsd11
diff --git a/vendor/golang.org/x/sys/unix/types_netbsd.go b/vendor/golang.org/x/sys/unix/types_netbsd.go
index 2dd4f95..4a96d72 100644
--- a/vendor/golang.org/x/sys/unix/types_netbsd.go
+++ b/vendor/golang.org/x/sys/unix/types_netbsd.go
@@ -254,6 +254,7 @@ type Ptmget C.struct_ptmget
 
 const (
 	AT_FDCWD            = C.AT_FDCWD
+	AT_SYMLINK_FOLLOW   = C.AT_SYMLINK_FOLLOW
 	AT_SYMLINK_NOFOLLOW = C.AT_SYMLINK_NOFOLLOW
 )
 
diff --git a/vendor/golang.org/x/sys/unix/types_openbsd.go b/vendor/golang.org/x/sys/unix/types_openbsd.go
index 8aafbe4..775cb57 100644
--- a/vendor/golang.org/x/sys/unix/types_openbsd.go
+++ b/vendor/golang.org/x/sys/unix/types_openbsd.go
@@ -241,6 +241,7 @@ type Winsize C.struct_winsize
 
 const (
 	AT_FDCWD            = C.AT_FDCWD
+	AT_SYMLINK_FOLLOW   = C.AT_SYMLINK_FOLLOW
 	AT_SYMLINK_NOFOLLOW = C.AT_SYMLINK_NOFOLLOW
 )
 
diff --git a/vendor/golang.org/x/sys/unix/openbsd_unveil.go b/vendor/golang.org/x/sys/unix/unveil_openbsd.go
similarity index 98%
rename from vendor/golang.org/x/sys/unix/openbsd_unveil.go
rename to vendor/golang.org/x/sys/unix/unveil_openbsd.go
index aebc2dc..168d5ae 100644
--- a/vendor/golang.org/x/sys/unix/openbsd_unveil.go
+++ b/vendor/golang.org/x/sys/unix/unveil_openbsd.go
@@ -2,8 +2,6 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-// +build openbsd
-
 package unix
 
 import (
diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go
index 4b7b965..1def8a5 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go
@@ -926,6 +926,8 @@ const (
 	TCSETSF                       = 0x5404
 	TCSETSW                       = 0x5403
 	TCXONC                        = 0x540b
+	TIMER_ABSTIME                 = 0x3e7
+	TIMER_MAX                     = 0x20
 	TIOC                          = 0x5400
 	TIOCCBRK                      = 0x2000747a
 	TIOCCDTR                      = 0x20007478
diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go
index ed04fd1..03187de 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go
@@ -3,7 +3,7 @@
 
 // +build ppc64,aix
 
-// Created by cgo -godefs - DO NOT EDIT
+// Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -maix64 _const.go
 
 package unix
@@ -926,6 +926,8 @@ const (
 	TCSETSF                       = 0x5404
 	TCSETSW                       = 0x5403
 	TCXONC                        = 0x540b
+	TIMER_ABSTIME                 = 0x3e7
+	TIMER_MAX                     = 0x20
 	TIOC                          = 0x5400
 	TIOCCBRK                      = 0x2000747a
 	TIOCCDTR                      = 0x20007478
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go
index 9e99d67..1db2f00 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1052,6 +1175,15 @@ const (
 	MAP_STACK                            = 0x20000
 	MAP_SYNC                             = 0x80000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1487,6 +1619,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1957,6 +2090,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -2005,6 +2139,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x12
 	SO_RCVTIMEO                          = 0x14
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x14
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2016,9 +2152,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x13
 	SO_SNDTIMEO                          = 0x15
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x15
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2111,6 +2255,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2312,8 +2458,10 @@ const (
 	UBI_IOCMKVOL                         = 0x40986f00
 	UBI_IOCRMVOL                         = 0x40046f01
 	UBI_IOCRNVOL                         = 0x51106f03
+	UBI_IOCRPEB                          = 0x40046f04
 	UBI_IOCRSVOL                         = 0x400c6f02
 	UBI_IOCSETVOLPROP                    = 0x40104f06
+	UBI_IOCSPEB                          = 0x40046f05
 	UBI_IOCVOLCRBLK                      = 0x40804f07
 	UBI_IOCVOLRMBLK                      = 0x4f08
 	UBI_IOCVOLUP                         = 0x40084f00
@@ -2462,6 +2610,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go
index e3091f1..8a9d2ea 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1052,6 +1175,15 @@ const (
 	MAP_STACK                            = 0x20000
 	MAP_SYNC                             = 0x80000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1487,6 +1619,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1958,6 +2091,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -2006,6 +2140,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x12
 	SO_RCVTIMEO                          = 0x14
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x14
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2017,9 +2153,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x13
 	SO_SNDTIMEO                          = 0x15
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x15
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2112,6 +2256,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2313,8 +2459,10 @@ const (
 	UBI_IOCMKVOL                         = 0x40986f00
 	UBI_IOCRMVOL                         = 0x40046f01
 	UBI_IOCRNVOL                         = 0x51106f03
+	UBI_IOCRPEB                          = 0x40046f04
 	UBI_IOCRSVOL                         = 0x400c6f02
 	UBI_IOCSETVOLPROP                    = 0x40104f06
+	UBI_IOCSPEB                          = 0x40046f05
 	UBI_IOCVOLCRBLK                      = 0x40804f07
 	UBI_IOCVOLRMBLK                      = 0x4f08
 	UBI_IOCVOLUP                         = 0x40084f00
@@ -2462,6 +2610,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go
index a75dfeb..2e74558 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1050,6 +1173,15 @@ const (
 	MAP_STACK                            = 0x20000
 	MAP_SYNC                             = 0x80000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1485,6 +1617,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1964,6 +2097,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -2012,6 +2146,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x12
 	SO_RCVTIMEO                          = 0x14
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x14
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2023,9 +2159,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x13
 	SO_SNDTIMEO                          = 0x15
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x15
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2118,6 +2262,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2319,8 +2465,10 @@ const (
 	UBI_IOCMKVOL                         = 0x40986f00
 	UBI_IOCRMVOL                         = 0x40046f01
 	UBI_IOCRNVOL                         = 0x51106f03
+	UBI_IOCRPEB                          = 0x40046f04
 	UBI_IOCRSVOL                         = 0x400c6f02
 	UBI_IOCSETVOLPROP                    = 0x40104f06
+	UBI_IOCSPEB                          = 0x40046f05
 	UBI_IOCVOLCRBLK                      = 0x40804f07
 	UBI_IOCVOLRMBLK                      = 0x4f08
 	UBI_IOCVOLUP                         = 0x40084f00
@@ -2468,6 +2616,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go
index 393ad7c..b1dc633 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -499,6 +612,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -507,8 +621,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -522,6 +640,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -530,6 +652,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1053,6 +1176,15 @@ const (
 	MAP_STACK                            = 0x20000
 	MAP_SYNC                             = 0x80000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1488,6 +1620,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1948,6 +2081,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -1996,6 +2130,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x12
 	SO_RCVTIMEO                          = 0x14
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x14
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2007,9 +2143,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x13
 	SO_SNDTIMEO                          = 0x15
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x15
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2103,6 +2247,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2304,8 +2450,10 @@ const (
 	UBI_IOCMKVOL                         = 0x40986f00
 	UBI_IOCRMVOL                         = 0x40046f01
 	UBI_IOCRNVOL                         = 0x51106f03
+	UBI_IOCRPEB                          = 0x40046f04
 	UBI_IOCRSVOL                         = 0x400c6f02
 	UBI_IOCSETVOLPROP                    = 0x40104f06
+	UBI_IOCSPEB                          = 0x40046f05
 	UBI_IOCVOLCRBLK                      = 0x40804f07
 	UBI_IOCVOLRMBLK                      = 0x4f08
 	UBI_IOCVOLUP                         = 0x40084f00
@@ -2453,6 +2601,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go
index ba1beb9..ad4d9af 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1050,6 +1173,15 @@ const (
 	MAP_SHARED_VALIDATE                  = 0x3
 	MAP_STACK                            = 0x40000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1485,6 +1617,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1957,6 +2090,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x20
 	SO_BSDCOMPAT                         = 0xe
@@ -2005,6 +2139,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x1004
 	SO_RCVTIMEO                          = 0x1006
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x1006
 	SO_REUSEADDR                         = 0x4
 	SO_REUSEPORT                         = 0x200
 	SO_RXQ_OVFL                          = 0x28
@@ -2016,10 +2152,18 @@ const (
 	SO_SNDBUFFORCE                       = 0x1f
 	SO_SNDLOWAT                          = 0x1003
 	SO_SNDTIMEO                          = 0x1005
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x1005
 	SO_STYLE                             = 0x1008
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x1008
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2111,6 +2255,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2314,8 +2460,10 @@ const (
 	UBI_IOCMKVOL                         = 0x80986f00
 	UBI_IOCRMVOL                         = 0x80046f01
 	UBI_IOCRNVOL                         = 0x91106f03
+	UBI_IOCRPEB                          = 0x80046f04
 	UBI_IOCRSVOL                         = 0x800c6f02
 	UBI_IOCSETVOLPROP                    = 0x80104f06
+	UBI_IOCSPEB                          = 0x80046f05
 	UBI_IOCVOLCRBLK                      = 0x80804f07
 	UBI_IOCVOLRMBLK                      = 0x20004f08
 	UBI_IOCVOLUP                         = 0x80084f00
@@ -2464,6 +2612,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go
index efba3e5..fe29650 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1050,6 +1173,15 @@ const (
 	MAP_SHARED_VALIDATE                  = 0x3
 	MAP_STACK                            = 0x40000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1485,6 +1617,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1957,6 +2090,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x20
 	SO_BSDCOMPAT                         = 0xe
@@ -2005,6 +2139,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x1004
 	SO_RCVTIMEO                          = 0x1006
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x1006
 	SO_REUSEADDR                         = 0x4
 	SO_REUSEPORT                         = 0x200
 	SO_RXQ_OVFL                          = 0x28
@@ -2016,10 +2152,18 @@ const (
 	SO_SNDBUFFORCE                       = 0x1f
 	SO_SNDLOWAT                          = 0x1003
 	SO_SNDTIMEO                          = 0x1005
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x1005
 	SO_STYLE                             = 0x1008
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x1008
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2111,6 +2255,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2314,8 +2460,10 @@ const (
 	UBI_IOCMKVOL                         = 0x80986f00
 	UBI_IOCRMVOL                         = 0x80046f01
 	UBI_IOCRNVOL                         = 0x91106f03
+	UBI_IOCRPEB                          = 0x80046f04
 	UBI_IOCRSVOL                         = 0x800c6f02
 	UBI_IOCSETVOLPROP                    = 0x80104f06
+	UBI_IOCSPEB                          = 0x80046f05
 	UBI_IOCVOLCRBLK                      = 0x80804f07
 	UBI_IOCVOLRMBLK                      = 0x20004f08
 	UBI_IOCVOLUP                         = 0x80084f00
@@ -2464,6 +2612,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go
index d3f6e90..6088783 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1050,6 +1173,15 @@ const (
 	MAP_SHARED_VALIDATE                  = 0x3
 	MAP_STACK                            = 0x40000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1485,6 +1617,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1957,6 +2090,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x20
 	SO_BSDCOMPAT                         = 0xe
@@ -2005,6 +2139,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x1004
 	SO_RCVTIMEO                          = 0x1006
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x1006
 	SO_REUSEADDR                         = 0x4
 	SO_REUSEPORT                         = 0x200
 	SO_RXQ_OVFL                          = 0x28
@@ -2016,10 +2152,18 @@ const (
 	SO_SNDBUFFORCE                       = 0x1f
 	SO_SNDLOWAT                          = 0x1003
 	SO_SNDTIMEO                          = 0x1005
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x1005
 	SO_STYLE                             = 0x1008
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x1008
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2111,6 +2255,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2314,8 +2460,10 @@ const (
 	UBI_IOCMKVOL                         = 0x80986f00
 	UBI_IOCRMVOL                         = 0x80046f01
 	UBI_IOCRNVOL                         = 0x91106f03
+	UBI_IOCRPEB                          = 0x80046f04
 	UBI_IOCRSVOL                         = 0x800c6f02
 	UBI_IOCSETVOLPROP                    = 0x80104f06
+	UBI_IOCSPEB                          = 0x80046f05
 	UBI_IOCVOLCRBLK                      = 0x80804f07
 	UBI_IOCVOLRMBLK                      = 0x20004f08
 	UBI_IOCVOLUP                         = 0x80084f00
@@ -2464,6 +2612,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go
index 7275cd8..4cf9ddf 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1050,6 +1173,15 @@ const (
 	MAP_SHARED_VALIDATE                  = 0x3
 	MAP_STACK                            = 0x40000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1485,6 +1617,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1957,6 +2090,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x20
 	SO_BSDCOMPAT                         = 0xe
@@ -2005,6 +2139,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x1004
 	SO_RCVTIMEO                          = 0x1006
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x1006
 	SO_REUSEADDR                         = 0x4
 	SO_REUSEPORT                         = 0x200
 	SO_RXQ_OVFL                          = 0x28
@@ -2016,10 +2152,18 @@ const (
 	SO_SNDBUFFORCE                       = 0x1f
 	SO_SNDLOWAT                          = 0x1003
 	SO_SNDTIMEO                          = 0x1005
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x1005
 	SO_STYLE                             = 0x1008
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x1008
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2111,6 +2255,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2314,8 +2460,10 @@ const (
 	UBI_IOCMKVOL                         = 0x80986f00
 	UBI_IOCRMVOL                         = 0x80046f01
 	UBI_IOCRNVOL                         = 0x91106f03
+	UBI_IOCRPEB                          = 0x80046f04
 	UBI_IOCRSVOL                         = 0x800c6f02
 	UBI_IOCSETVOLPROP                    = 0x80104f06
+	UBI_IOCSPEB                          = 0x80046f05
 	UBI_IOCVOLCRBLK                      = 0x80804f07
 	UBI_IOCVOLRMBLK                      = 0x20004f08
 	UBI_IOCVOLUP                         = 0x80084f00
@@ -2464,6 +2612,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go
index 7586a13..374e300 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0xff
 	CBAUDEX                              = 0x0
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x3000
 	CREAD                                = 0x800
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x100
 	CS7                                  = 0x200
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1049,6 +1172,15 @@ const (
 	MAP_SHARED_VALIDATE                  = 0x3
 	MAP_STACK                            = 0x20000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x2000
 	MCL_FUTURE                           = 0x4000
 	MCL_ONFAULT                          = 0x8000
@@ -1487,6 +1619,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -2015,6 +2148,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -2063,6 +2197,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x10
 	SO_RCVTIMEO                          = 0x12
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x12
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2074,9 +2210,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x11
 	SO_SNDTIMEO                          = 0x13
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x13
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2167,6 +2311,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2374,8 +2520,10 @@ const (
 	UBI_IOCMKVOL                         = 0x80986f00
 	UBI_IOCRMVOL                         = 0x80046f01
 	UBI_IOCRNVOL                         = 0x91106f03
+	UBI_IOCRPEB                          = 0x80046f04
 	UBI_IOCRSVOL                         = 0x800c6f02
 	UBI_IOCSETVOLPROP                    = 0x80104f06
+	UBI_IOCSPEB                          = 0x80046f05
 	UBI_IOCVOLCRBLK                      = 0x80804f07
 	UBI_IOCVOLRMBLK                      = 0x20004f08
 	UBI_IOCVOLUP                         = 0x80084f00
@@ -2523,6 +2671,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go
index b861ec7..badf141 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0xff
 	CBAUDEX                              = 0x0
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x3000
 	CREAD                                = 0x800
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x100
 	CS7                                  = 0x200
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1049,6 +1172,15 @@ const (
 	MAP_SHARED_VALIDATE                  = 0x3
 	MAP_STACK                            = 0x20000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x2000
 	MCL_FUTURE                           = 0x4000
 	MCL_ONFAULT                          = 0x8000
@@ -1487,6 +1619,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -2015,6 +2148,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -2063,6 +2197,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x10
 	SO_RCVTIMEO                          = 0x12
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x12
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2074,9 +2210,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x11
 	SO_SNDTIMEO                          = 0x13
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x13
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2167,6 +2311,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2374,8 +2520,10 @@ const (
 	UBI_IOCMKVOL                         = 0x80986f00
 	UBI_IOCRMVOL                         = 0x80046f01
 	UBI_IOCRNVOL                         = 0x91106f03
+	UBI_IOCRPEB                          = 0x80046f04
 	UBI_IOCRSVOL                         = 0x800c6f02
 	UBI_IOCSETVOLPROP                    = 0x80104f06
+	UBI_IOCSPEB                          = 0x80046f05
 	UBI_IOCVOLCRBLK                      = 0x80804f07
 	UBI_IOCVOLRMBLK                      = 0x20004f08
 	UBI_IOCVOLUP                         = 0x80084f00
@@ -2523,6 +2671,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go
index a321ec2..0ce8c7e 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1050,6 +1173,15 @@ const (
 	MAP_STACK                            = 0x20000
 	MAP_SYNC                             = 0x80000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1485,6 +1617,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -1945,6 +2078,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -1993,6 +2127,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x12
 	SO_RCVTIMEO                          = 0x14
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x14
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2004,9 +2140,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x13
 	SO_SNDTIMEO                          = 0x15
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x15
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2099,6 +2243,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2300,8 +2446,10 @@ const (
 	UBI_IOCMKVOL                         = 0x40986f00
 	UBI_IOCRMVOL                         = 0x40046f01
 	UBI_IOCRNVOL                         = 0x51106f03
+	UBI_IOCRPEB                          = 0x40046f04
 	UBI_IOCRSVOL                         = 0x400c6f02
 	UBI_IOCSETVOLPROP                    = 0x40104f06
+	UBI_IOCSPEB                          = 0x40046f05
 	UBI_IOCVOLCRBLK                      = 0x40804f07
 	UBI_IOCVOLRMBLK                      = 0x4f08
 	UBI_IOCVOLUP                         = 0x40084f00
@@ -2449,6 +2597,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go
index f6c9916..4767512 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go
@@ -197,10 +197,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -208,8 +257,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -223,20 +280,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -264,6 +334,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -320,6 +429,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -497,6 +610,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -505,8 +619,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -520,6 +638,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -528,6 +650,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1050,6 +1173,15 @@ const (
 	MAP_STACK                            = 0x20000
 	MAP_SYNC                             = 0x80000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x1
 	MCL_FUTURE                           = 0x2
 	MCL_ONFAULT                          = 0x4
@@ -1485,6 +1617,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -2018,6 +2151,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x33
 	SO_ATTACH_REUSEPORT_EBPF             = 0x34
 	SO_BINDTODEVICE                      = 0x19
+	SO_BINDTOIFINDEX                     = 0x3e
 	SO_BPF_EXTENSIONS                    = 0x30
 	SO_BROADCAST                         = 0x6
 	SO_BSDCOMPAT                         = 0xe
@@ -2066,6 +2200,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x21
 	SO_RCVLOWAT                          = 0x12
 	SO_RCVTIMEO                          = 0x14
+	SO_RCVTIMEO_NEW                      = 0x42
+	SO_RCVTIMEO_OLD                      = 0x14
 	SO_REUSEADDR                         = 0x2
 	SO_REUSEPORT                         = 0xf
 	SO_RXQ_OVFL                          = 0x28
@@ -2077,9 +2213,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x20
 	SO_SNDLOWAT                          = 0x13
 	SO_SNDTIMEO                          = 0x15
+	SO_SNDTIMEO_NEW                      = 0x43
+	SO_SNDTIMEO_OLD                      = 0x15
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x25
+	SO_TIMESTAMPING_NEW                  = 0x41
+	SO_TIMESTAMPING_OLD                  = 0x25
 	SO_TIMESTAMPNS                       = 0x23
+	SO_TIMESTAMPNS_NEW                   = 0x40
+	SO_TIMESTAMPNS_OLD                   = 0x23
+	SO_TIMESTAMP_NEW                     = 0x3f
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3d
 	SO_TYPE                              = 0x3
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2172,6 +2316,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2373,8 +2519,10 @@ const (
 	UBI_IOCMKVOL                         = 0x40986f00
 	UBI_IOCRMVOL                         = 0x40046f01
 	UBI_IOCRNVOL                         = 0x51106f03
+	UBI_IOCRPEB                          = 0x40046f04
 	UBI_IOCRSVOL                         = 0x400c6f02
 	UBI_IOCSETVOLPROP                    = 0x40104f06
+	UBI_IOCSPEB                          = 0x40046f05
 	UBI_IOCVOLCRBLK                      = 0x40804f07
 	UBI_IOCVOLRMBLK                      = 0x4f08
 	UBI_IOCVOLUP                         = 0x40084f00
@@ -2522,6 +2670,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
index c1e95e2..a46fc9b 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
@@ -200,10 +200,59 @@ const (
 	BPF_ABS                              = 0x20
 	BPF_ADD                              = 0x0
 	BPF_ALU                              = 0x4
+	BPF_ALU64                            = 0x7
 	BPF_AND                              = 0x50
+	BPF_ANY                              = 0x0
+	BPF_ARSH                             = 0xc0
 	BPF_B                                = 0x10
+	BPF_BUILD_ID_SIZE                    = 0x14
+	BPF_CALL                             = 0x80
+	BPF_DEVCG_ACC_MKNOD                  = 0x1
+	BPF_DEVCG_ACC_READ                   = 0x2
+	BPF_DEVCG_ACC_WRITE                  = 0x4
+	BPF_DEVCG_DEV_BLOCK                  = 0x1
+	BPF_DEVCG_DEV_CHAR                   = 0x2
 	BPF_DIV                              = 0x30
+	BPF_DW                               = 0x18
+	BPF_END                              = 0xd0
+	BPF_EXIST                            = 0x2
+	BPF_EXIT                             = 0x90
+	BPF_FROM_BE                          = 0x8
+	BPF_FROM_LE                          = 0x0
 	BPF_FS_MAGIC                         = 0xcafe4a11
+	BPF_F_ALLOW_MULTI                    = 0x2
+	BPF_F_ALLOW_OVERRIDE                 = 0x1
+	BPF_F_ANY_ALIGNMENT                  = 0x2
+	BPF_F_CTXLEN_MASK                    = 0xfffff00000000
+	BPF_F_CURRENT_CPU                    = 0xffffffff
+	BPF_F_CURRENT_NETNS                  = -0x1
+	BPF_F_DONT_FRAGMENT                  = 0x4
+	BPF_F_FAST_STACK_CMP                 = 0x200
+	BPF_F_HDR_FIELD_MASK                 = 0xf
+	BPF_F_INDEX_MASK                     = 0xffffffff
+	BPF_F_INGRESS                        = 0x1
+	BPF_F_INVALIDATE_HASH                = 0x2
+	BPF_F_LOCK                           = 0x4
+	BPF_F_MARK_ENFORCE                   = 0x40
+	BPF_F_MARK_MANGLED_0                 = 0x20
+	BPF_F_NO_COMMON_LRU                  = 0x2
+	BPF_F_NO_PREALLOC                    = 0x1
+	BPF_F_NUMA_NODE                      = 0x4
+	BPF_F_PSEUDO_HDR                     = 0x10
+	BPF_F_QUERY_EFFECTIVE                = 0x1
+	BPF_F_RDONLY                         = 0x8
+	BPF_F_RECOMPUTE_CSUM                 = 0x1
+	BPF_F_REUSE_STACKID                  = 0x400
+	BPF_F_SEQ_NUMBER                     = 0x8
+	BPF_F_SKIP_FIELD_MASK                = 0xff
+	BPF_F_STACK_BUILD_ID                 = 0x20
+	BPF_F_STRICT_ALIGNMENT               = 0x1
+	BPF_F_TUNINFO_IPV6                   = 0x1
+	BPF_F_USER_BUILD_ID                  = 0x800
+	BPF_F_USER_STACK                     = 0x100
+	BPF_F_WRONLY                         = 0x10
+	BPF_F_ZERO_CSUM_TX                   = 0x2
+	BPF_F_ZERO_SEED                      = 0x40
 	BPF_H                                = 0x8
 	BPF_IMM                              = 0x0
 	BPF_IND                              = 0x40
@@ -211,8 +260,16 @@ const (
 	BPF_JEQ                              = 0x10
 	BPF_JGE                              = 0x30
 	BPF_JGT                              = 0x20
+	BPF_JLE                              = 0xb0
+	BPF_JLT                              = 0xa0
 	BPF_JMP                              = 0x5
+	BPF_JMP32                            = 0x6
+	BPF_JNE                              = 0x50
 	BPF_JSET                             = 0x40
+	BPF_JSGE                             = 0x70
+	BPF_JSGT                             = 0x60
+	BPF_JSLE                             = 0xd0
+	BPF_JSLT                             = 0xc0
 	BPF_K                                = 0x0
 	BPF_LD                               = 0x0
 	BPF_LDX                              = 0x1
@@ -226,20 +283,33 @@ const (
 	BPF_MINOR_VERSION                    = 0x1
 	BPF_MISC                             = 0x7
 	BPF_MOD                              = 0x90
+	BPF_MOV                              = 0xb0
 	BPF_MSH                              = 0xa0
 	BPF_MUL                              = 0x20
 	BPF_NEG                              = 0x80
 	BPF_NET_OFF                          = -0x100000
+	BPF_NOEXIST                          = 0x1
+	BPF_OBJ_NAME_LEN                     = 0x10
 	BPF_OR                               = 0x40
+	BPF_PSEUDO_CALL                      = 0x1
+	BPF_PSEUDO_MAP_FD                    = 0x1
 	BPF_RET                              = 0x6
 	BPF_RSH                              = 0x70
+	BPF_SOCK_OPS_ALL_CB_FLAGS            = 0x7
+	BPF_SOCK_OPS_RETRANS_CB_FLAG         = 0x2
+	BPF_SOCK_OPS_RTO_CB_FLAG             = 0x1
+	BPF_SOCK_OPS_STATE_CB_FLAG           = 0x4
 	BPF_ST                               = 0x2
 	BPF_STX                              = 0x3
 	BPF_SUB                              = 0x10
+	BPF_TAG_SIZE                         = 0x8
 	BPF_TAX                              = 0x0
+	BPF_TO_BE                            = 0x8
+	BPF_TO_LE                            = 0x0
 	BPF_TXA                              = 0x80
 	BPF_W                                = 0x0
 	BPF_X                                = 0x8
+	BPF_XADD                             = 0xc0
 	BPF_XOR                              = 0xa0
 	BRKINT                               = 0x2
 	BS0                                  = 0x0
@@ -267,6 +337,45 @@ const (
 	CAN_SFF_MASK                         = 0x7ff
 	CAN_TP16                             = 0x3
 	CAN_TP20                             = 0x4
+	CAP_AUDIT_CONTROL                    = 0x1e
+	CAP_AUDIT_READ                       = 0x25
+	CAP_AUDIT_WRITE                      = 0x1d
+	CAP_BLOCK_SUSPEND                    = 0x24
+	CAP_CHOWN                            = 0x0
+	CAP_DAC_OVERRIDE                     = 0x1
+	CAP_DAC_READ_SEARCH                  = 0x2
+	CAP_FOWNER                           = 0x3
+	CAP_FSETID                           = 0x4
+	CAP_IPC_LOCK                         = 0xe
+	CAP_IPC_OWNER                        = 0xf
+	CAP_KILL                             = 0x5
+	CAP_LAST_CAP                         = 0x25
+	CAP_LEASE                            = 0x1c
+	CAP_LINUX_IMMUTABLE                  = 0x9
+	CAP_MAC_ADMIN                        = 0x21
+	CAP_MAC_OVERRIDE                     = 0x20
+	CAP_MKNOD                            = 0x1b
+	CAP_NET_ADMIN                        = 0xc
+	CAP_NET_BIND_SERVICE                 = 0xa
+	CAP_NET_BROADCAST                    = 0xb
+	CAP_NET_RAW                          = 0xd
+	CAP_SETFCAP                          = 0x1f
+	CAP_SETGID                           = 0x6
+	CAP_SETPCAP                          = 0x8
+	CAP_SETUID                           = 0x7
+	CAP_SYSLOG                           = 0x22
+	CAP_SYS_ADMIN                        = 0x15
+	CAP_SYS_BOOT                         = 0x16
+	CAP_SYS_CHROOT                       = 0x12
+	CAP_SYS_MODULE                       = 0x10
+	CAP_SYS_NICE                         = 0x17
+	CAP_SYS_PACCT                        = 0x14
+	CAP_SYS_PTRACE                       = 0x13
+	CAP_SYS_RAWIO                        = 0x11
+	CAP_SYS_RESOURCE                     = 0x18
+	CAP_SYS_TIME                         = 0x19
+	CAP_SYS_TTY_CONFIG                   = 0x1a
+	CAP_WAKE_ALARM                       = 0x23
 	CBAUD                                = 0x100f
 	CBAUDEX                              = 0x1000
 	CFLUSH                               = 0xf
@@ -323,6 +432,10 @@ const (
 	CRDLY                                = 0x600
 	CREAD                                = 0x80
 	CRTSCTS                              = 0x80000000
+	CRYPTO_MAX_NAME                      = 0x40
+	CRYPTO_MSG_MAX                       = 0x15
+	CRYPTO_NR_MSGTYPES                   = 0x6
+	CRYPTO_REPORT_MAXSIZE                = 0x160
 	CS5                                  = 0x0
 	CS6                                  = 0x10
 	CS7                                  = 0x20
@@ -501,6 +614,7 @@ const (
 	FAN_ALL_MARK_FLAGS                   = 0xff
 	FAN_ALL_OUTGOING_EVENTS              = 0x3403b
 	FAN_ALL_PERM_EVENTS                  = 0x30000
+	FAN_ATTRIB                           = 0x4
 	FAN_AUDIT                            = 0x10
 	FAN_CLASS_CONTENT                    = 0x4
 	FAN_CLASS_NOTIF                      = 0x0
@@ -509,8 +623,12 @@ const (
 	FAN_CLOSE                            = 0x18
 	FAN_CLOSE_NOWRITE                    = 0x10
 	FAN_CLOSE_WRITE                      = 0x8
+	FAN_CREATE                           = 0x100
+	FAN_DELETE                           = 0x200
+	FAN_DELETE_SELF                      = 0x400
 	FAN_DENY                             = 0x2
 	FAN_ENABLE_AUDIT                     = 0x40
+	FAN_EVENT_INFO_TYPE_FID              = 0x1
 	FAN_EVENT_METADATA_LEN               = 0x18
 	FAN_EVENT_ON_CHILD                   = 0x8000000
 	FAN_MARK_ADD                         = 0x1
@@ -524,6 +642,10 @@ const (
 	FAN_MARK_ONLYDIR                     = 0x8
 	FAN_MARK_REMOVE                      = 0x2
 	FAN_MODIFY                           = 0x2
+	FAN_MOVE                             = 0xc0
+	FAN_MOVED_FROM                       = 0x40
+	FAN_MOVED_TO                         = 0x80
+	FAN_MOVE_SELF                        = 0x800
 	FAN_NOFD                             = -0x1
 	FAN_NONBLOCK                         = 0x2
 	FAN_ONDIR                            = 0x40000000
@@ -532,6 +654,7 @@ const (
 	FAN_OPEN_EXEC_PERM                   = 0x40000
 	FAN_OPEN_PERM                        = 0x10000
 	FAN_Q_OVERFLOW                       = 0x4000
+	FAN_REPORT_FID                       = 0x200
 	FAN_REPORT_TID                       = 0x100
 	FAN_UNLIMITED_MARKS                  = 0x20
 	FAN_UNLIMITED_QUEUE                  = 0x10
@@ -1054,6 +1177,15 @@ const (
 	MAP_SHARED_VALIDATE                  = 0x3
 	MAP_STACK                            = 0x20000
 	MAP_TYPE                             = 0xf
+	MCAST_BLOCK_SOURCE                   = 0x2b
+	MCAST_EXCLUDE                        = 0x0
+	MCAST_INCLUDE                        = 0x1
+	MCAST_JOIN_GROUP                     = 0x2a
+	MCAST_JOIN_SOURCE_GROUP              = 0x2e
+	MCAST_LEAVE_GROUP                    = 0x2d
+	MCAST_LEAVE_SOURCE_GROUP             = 0x2f
+	MCAST_MSFILTER                       = 0x30
+	MCAST_UNBLOCK_SOURCE                 = 0x2c
 	MCL_CURRENT                          = 0x2000
 	MCL_FUTURE                           = 0x4000
 	MCL_ONFAULT                          = 0x8000
@@ -1489,6 +1621,7 @@ const (
 	PR_SET_TSC                           = 0x1a
 	PR_SET_UNALIGN                       = 0x6
 	PR_SPEC_DISABLE                      = 0x4
+	PR_SPEC_DISABLE_NOEXEC               = 0x10
 	PR_SPEC_ENABLE                       = 0x2
 	PR_SPEC_FORCE_DISABLE                = 0x8
 	PR_SPEC_INDIRECT_BRANCH              = 0x1
@@ -2010,6 +2143,7 @@ const (
 	SO_ATTACH_REUSEPORT_CBPF             = 0x35
 	SO_ATTACH_REUSEPORT_EBPF             = 0x36
 	SO_BINDTODEVICE                      = 0xd
+	SO_BINDTOIFINDEX                     = 0x41
 	SO_BPF_EXTENSIONS                    = 0x32
 	SO_BROADCAST                         = 0x20
 	SO_BSDCOMPAT                         = 0x400
@@ -2058,6 +2192,8 @@ const (
 	SO_RCVBUFFORCE                       = 0x100b
 	SO_RCVLOWAT                          = 0x800
 	SO_RCVTIMEO                          = 0x2000
+	SO_RCVTIMEO_NEW                      = 0x44
+	SO_RCVTIMEO_OLD                      = 0x2000
 	SO_REUSEADDR                         = 0x4
 	SO_REUSEPORT                         = 0x200
 	SO_RXQ_OVFL                          = 0x24
@@ -2069,9 +2205,17 @@ const (
 	SO_SNDBUFFORCE                       = 0x100a
 	SO_SNDLOWAT                          = 0x1000
 	SO_SNDTIMEO                          = 0x4000
+	SO_SNDTIMEO_NEW                      = 0x45
+	SO_SNDTIMEO_OLD                      = 0x4000
 	SO_TIMESTAMP                         = 0x1d
 	SO_TIMESTAMPING                      = 0x23
+	SO_TIMESTAMPING_NEW                  = 0x43
+	SO_TIMESTAMPING_OLD                  = 0x23
 	SO_TIMESTAMPNS                       = 0x21
+	SO_TIMESTAMPNS_NEW                   = 0x42
+	SO_TIMESTAMPNS_OLD                   = 0x21
+	SO_TIMESTAMP_NEW                     = 0x46
+	SO_TIMESTAMP_OLD                     = 0x1d
 	SO_TXTIME                            = 0x3f
 	SO_TYPE                              = 0x1008
 	SO_VM_SOCKETS_BUFFER_MAX_SIZE        = 0x2
@@ -2163,6 +2307,8 @@ const (
 	TCOFLUSH                             = 0x1
 	TCOOFF                               = 0x0
 	TCOON                                = 0x1
+	TCP_BPF_IW                           = 0x3e9
+	TCP_BPF_SNDCWND_CLAMP                = 0x3ea
 	TCP_CC_INFO                          = 0x1a
 	TCP_CM_INQ                           = 0x24
 	TCP_CONGESTION                       = 0xd
@@ -2362,8 +2508,10 @@ const (
 	UBI_IOCMKVOL                         = 0x80986f00
 	UBI_IOCRMVOL                         = 0x80046f01
 	UBI_IOCRNVOL                         = 0x91106f03
+	UBI_IOCRPEB                          = 0x80046f04
 	UBI_IOCRSVOL                         = 0x800c6f02
 	UBI_IOCSETVOLPROP                    = 0x80104f06
+	UBI_IOCSPEB                          = 0x80046f05
 	UBI_IOCVOLCRBLK                      = 0x80804f07
 	UBI_IOCVOLRMBLK                      = 0x20004f08
 	UBI_IOCVOLUP                         = 0x80084f00
@@ -2511,6 +2659,7 @@ const (
 	XDP_FLAGS_SKB_MODE                   = 0x2
 	XDP_FLAGS_UPDATE_IF_NOEXIST          = 0x1
 	XDP_MMAP_OFFSETS                     = 0x1
+	XDP_PACKET_HEADROOM                  = 0x100
 	XDP_PGOFF_RX_RING                    = 0x0
 	XDP_PGOFF_TX_RING                    = 0x80000000
 	XDP_RX_RING                          = 0x2
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go
new file mode 100644
index 0000000..ec5f92d
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go
@@ -0,0 +1,1789 @@
+// mkerrors.sh -m64
+// Code generated by the command above; see README.md. DO NOT EDIT.
+
+// +build arm64,openbsd
+
+// Code generated by cmd/cgo -godefs; DO NOT EDIT.
+// cgo -godefs -- -m64 _const.go
+
+package unix
+
+import "syscall"
+
+const (
+	AF_APPLETALK                      = 0x10
+	AF_BLUETOOTH                      = 0x20
+	AF_CCITT                          = 0xa
+	AF_CHAOS                          = 0x5
+	AF_CNT                            = 0x15
+	AF_COIP                           = 0x14
+	AF_DATAKIT                        = 0x9
+	AF_DECnet                         = 0xc
+	AF_DLI                            = 0xd
+	AF_E164                           = 0x1a
+	AF_ECMA                           = 0x8
+	AF_ENCAP                          = 0x1c
+	AF_HYLINK                         = 0xf
+	AF_IMPLINK                        = 0x3
+	AF_INET                           = 0x2
+	AF_INET6                          = 0x18
+	AF_IPX                            = 0x17
+	AF_ISDN                           = 0x1a
+	AF_ISO                            = 0x7
+	AF_KEY                            = 0x1e
+	AF_LAT                            = 0xe
+	AF_LINK                           = 0x12
+	AF_LOCAL                          = 0x1
+	AF_MAX                            = 0x24
+	AF_MPLS                           = 0x21
+	AF_NATM                           = 0x1b
+	AF_NS                             = 0x6
+	AF_OSI                            = 0x7
+	AF_PUP                            = 0x4
+	AF_ROUTE                          = 0x11
+	AF_SIP                            = 0x1d
+	AF_SNA                            = 0xb
+	AF_UNIX                           = 0x1
+	AF_UNSPEC                         = 0x0
+	ALTWERASE                         = 0x200
+	ARPHRD_ETHER                      = 0x1
+	ARPHRD_FRELAY                     = 0xf
+	ARPHRD_IEEE1394                   = 0x18
+	ARPHRD_IEEE802                    = 0x6
+	B0                                = 0x0
+	B110                              = 0x6e
+	B115200                           = 0x1c200
+	B1200                             = 0x4b0
+	B134                              = 0x86
+	B14400                            = 0x3840
+	B150                              = 0x96
+	B1800                             = 0x708
+	B19200                            = 0x4b00
+	B200                              = 0xc8
+	B230400                           = 0x38400
+	B2400                             = 0x960
+	B28800                            = 0x7080
+	B300                              = 0x12c
+	B38400                            = 0x9600
+	B4800                             = 0x12c0
+	B50                               = 0x32
+	B57600                            = 0xe100
+	B600                              = 0x258
+	B7200                             = 0x1c20
+	B75                               = 0x4b
+	B76800                            = 0x12c00
+	B9600                             = 0x2580
+	BIOCFLUSH                         = 0x20004268
+	BIOCGBLEN                         = 0x40044266
+	BIOCGDIRFILT                      = 0x4004427c
+	BIOCGDLT                          = 0x4004426a
+	BIOCGDLTLIST                      = 0xc010427b
+	BIOCGETIF                         = 0x4020426b
+	BIOCGFILDROP                      = 0x40044278
+	BIOCGHDRCMPLT                     = 0x40044274
+	BIOCGRSIG                         = 0x40044273
+	BIOCGRTIMEOUT                     = 0x4010426e
+	BIOCGSTATS                        = 0x4008426f
+	BIOCIMMEDIATE                     = 0x80044270
+	BIOCLOCK                          = 0x20004276
+	BIOCPROMISC                       = 0x20004269
+	BIOCSBLEN                         = 0xc0044266
+	BIOCSDIRFILT                      = 0x8004427d
+	BIOCSDLT                          = 0x8004427a
+	BIOCSETF                          = 0x80104267
+	BIOCSETIF                         = 0x8020426c
+	BIOCSETWF                         = 0x80104277
+	BIOCSFILDROP                      = 0x80044279
+	BIOCSHDRCMPLT                     = 0x80044275
+	BIOCSRSIG                         = 0x80044272
+	BIOCSRTIMEOUT                     = 0x8010426d
+	BIOCVERSION                       = 0x40044271
+	BPF_A                             = 0x10
+	BPF_ABS                           = 0x20
+	BPF_ADD                           = 0x0
+	BPF_ALIGNMENT                     = 0x4
+	BPF_ALU                           = 0x4
+	BPF_AND                           = 0x50
+	BPF_B                             = 0x10
+	BPF_DIRECTION_IN                  = 0x1
+	BPF_DIRECTION_OUT                 = 0x2
+	BPF_DIV                           = 0x30
+	BPF_FILDROP_CAPTURE               = 0x1
+	BPF_FILDROP_DROP                  = 0x2
+	BPF_FILDROP_PASS                  = 0x0
+	BPF_H                             = 0x8
+	BPF_IMM                           = 0x0
+	BPF_IND                           = 0x40
+	BPF_JA                            = 0x0
+	BPF_JEQ                           = 0x10
+	BPF_JGE                           = 0x30
+	BPF_JGT                           = 0x20
+	BPF_JMP                           = 0x5
+	BPF_JSET                          = 0x40
+	BPF_K                             = 0x0
+	BPF_LD                            = 0x0
+	BPF_LDX                           = 0x1
+	BPF_LEN                           = 0x80
+	BPF_LSH                           = 0x60
+	BPF_MAJOR_VERSION                 = 0x1
+	BPF_MAXBUFSIZE                    = 0x200000
+	BPF_MAXINSNS                      = 0x200
+	BPF_MEM                           = 0x60
+	BPF_MEMWORDS                      = 0x10
+	BPF_MINBUFSIZE                    = 0x20
+	BPF_MINOR_VERSION                 = 0x1
+	BPF_MISC                          = 0x7
+	BPF_MSH                           = 0xa0
+	BPF_MUL                           = 0x20
+	BPF_NEG                           = 0x80
+	BPF_OR                            = 0x40
+	BPF_RELEASE                       = 0x30bb6
+	BPF_RET                           = 0x6
+	BPF_RSH                           = 0x70
+	BPF_ST                            = 0x2
+	BPF_STX                           = 0x3
+	BPF_SUB                           = 0x10
+	BPF_TAX                           = 0x0
+	BPF_TXA                           = 0x80
+	BPF_W                             = 0x0
+	BPF_X                             = 0x8
+	BRKINT                            = 0x2
+	CFLUSH                            = 0xf
+	CLOCAL                            = 0x8000
+	CLOCK_BOOTTIME                    = 0x6
+	CLOCK_MONOTONIC                   = 0x3
+	CLOCK_PROCESS_CPUTIME_ID          = 0x2
+	CLOCK_REALTIME                    = 0x0
+	CLOCK_THREAD_CPUTIME_ID           = 0x4
+	CLOCK_UPTIME                      = 0x5
+	CREAD                             = 0x800
+	CRTSCTS                           = 0x10000
+	CS5                               = 0x0
+	CS6                               = 0x100
+	CS7                               = 0x200
+	CS8                               = 0x300
+	CSIZE                             = 0x300
+	CSTART                            = 0x11
+	CSTATUS                           = 0xff
+	CSTOP                             = 0x13
+	CSTOPB                            = 0x400
+	CSUSP                             = 0x1a
+	CTL_HW                            = 0x6
+	CTL_KERN                          = 0x1
+	CTL_MAXNAME                       = 0xc
+	CTL_NET                           = 0x4
+	DIOCOSFPFLUSH                     = 0x2000444e
+	DLT_ARCNET                        = 0x7
+	DLT_ATM_RFC1483                   = 0xb
+	DLT_AX25                          = 0x3
+	DLT_CHAOS                         = 0x5
+	DLT_C_HDLC                        = 0x68
+	DLT_EN10MB                        = 0x1
+	DLT_EN3MB                         = 0x2
+	DLT_ENC                           = 0xd
+	DLT_FDDI                          = 0xa
+	DLT_IEEE802                       = 0x6
+	DLT_IEEE802_11                    = 0x69
+	DLT_IEEE802_11_RADIO              = 0x7f
+	DLT_LOOP                          = 0xc
+	DLT_MPLS                          = 0xdb
+	DLT_NULL                          = 0x0
+	DLT_OPENFLOW                      = 0x10b
+	DLT_PFLOG                         = 0x75
+	DLT_PFSYNC                        = 0x12
+	DLT_PPP                           = 0x9
+	DLT_PPP_BSDOS                     = 0x10
+	DLT_PPP_ETHER                     = 0x33
+	DLT_PPP_SERIAL                    = 0x32
+	DLT_PRONET                        = 0x4
+	DLT_RAW                           = 0xe
+	DLT_SLIP                          = 0x8
+	DLT_SLIP_BSDOS                    = 0xf
+	DLT_USBPCAP                       = 0xf9
+	DLT_USER0                         = 0x93
+	DLT_USER1                         = 0x94
+	DLT_USER10                        = 0x9d
+	DLT_USER11                        = 0x9e
+	DLT_USER12                        = 0x9f
+	DLT_USER13                        = 0xa0
+	DLT_USER14                        = 0xa1
+	DLT_USER15                        = 0xa2
+	DLT_USER2                         = 0x95
+	DLT_USER3                         = 0x96
+	DLT_USER4                         = 0x97
+	DLT_USER5                         = 0x98
+	DLT_USER6                         = 0x99
+	DLT_USER7                         = 0x9a
+	DLT_USER8                         = 0x9b
+	DLT_USER9                         = 0x9c
+	DT_BLK                            = 0x6
+	DT_CHR                            = 0x2
+	DT_DIR                            = 0x4
+	DT_FIFO                           = 0x1
+	DT_LNK                            = 0xa
+	DT_REG                            = 0x8
+	DT_SOCK                           = 0xc
+	DT_UNKNOWN                        = 0x0
+	ECHO                              = 0x8
+	ECHOCTL                           = 0x40
+	ECHOE                             = 0x2
+	ECHOK                             = 0x4
+	ECHOKE                            = 0x1
+	ECHONL                            = 0x10
+	ECHOPRT                           = 0x20
+	EMT_TAGOVF                        = 0x1
+	EMUL_ENABLED                      = 0x1
+	EMUL_NATIVE                       = 0x2
+	ENDRUNDISC                        = 0x9
+	ETHERMIN                          = 0x2e
+	ETHERMTU                          = 0x5dc
+	ETHERTYPE_8023                    = 0x4
+	ETHERTYPE_AARP                    = 0x80f3
+	ETHERTYPE_ACCTON                  = 0x8390
+	ETHERTYPE_AEONIC                  = 0x8036
+	ETHERTYPE_ALPHA                   = 0x814a
+	ETHERTYPE_AMBER                   = 0x6008
+	ETHERTYPE_AMOEBA                  = 0x8145
+	ETHERTYPE_AOE                     = 0x88a2
+	ETHERTYPE_APOLLO                  = 0x80f7
+	ETHERTYPE_APOLLODOMAIN            = 0x8019
+	ETHERTYPE_APPLETALK               = 0x809b
+	ETHERTYPE_APPLITEK                = 0x80c7
+	ETHERTYPE_ARGONAUT                = 0x803a
+	ETHERTYPE_ARP                     = 0x806
+	ETHERTYPE_AT                      = 0x809b
+	ETHERTYPE_ATALK                   = 0x809b
+	ETHERTYPE_ATOMIC                  = 0x86df
+	ETHERTYPE_ATT                     = 0x8069
+	ETHERTYPE_ATTSTANFORD             = 0x8008
+	ETHERTYPE_AUTOPHON                = 0x806a
+	ETHERTYPE_AXIS                    = 0x8856
+	ETHERTYPE_BCLOOP                  = 0x9003
+	ETHERTYPE_BOFL                    = 0x8102
+	ETHERTYPE_CABLETRON               = 0x7034
+	ETHERTYPE_CHAOS                   = 0x804
+	ETHERTYPE_COMDESIGN               = 0x806c
+	ETHERTYPE_COMPUGRAPHIC            = 0x806d
+	ETHERTYPE_COUNTERPOINT            = 0x8062
+	ETHERTYPE_CRONUS                  = 0x8004
+	ETHERTYPE_CRONUSVLN               = 0x8003
+	ETHERTYPE_DCA                     = 0x1234
+	ETHERTYPE_DDE                     = 0x807b
+	ETHERTYPE_DEBNI                   = 0xaaaa
+	ETHERTYPE_DECAM                   = 0x8048
+	ETHERTYPE_DECCUST                 = 0x6006
+	ETHERTYPE_DECDIAG                 = 0x6005
+	ETHERTYPE_DECDNS                  = 0x803c
+	ETHERTYPE_DECDTS                  = 0x803e
+	ETHERTYPE_DECEXPER                = 0x6000
+	ETHERTYPE_DECLAST                 = 0x8041
+	ETHERTYPE_DECLTM                  = 0x803f
+	ETHERTYPE_DECMUMPS                = 0x6009
+	ETHERTYPE_DECNETBIOS              = 0x8040
+	ETHERTYPE_DELTACON                = 0x86de
+	ETHERTYPE_DIDDLE                  = 0x4321
+	ETHERTYPE_DLOG1                   = 0x660
+	ETHERTYPE_DLOG2                   = 0x661
+	ETHERTYPE_DN                      = 0x6003
+	ETHERTYPE_DOGFIGHT                = 0x1989
+	ETHERTYPE_DSMD                    = 0x8039
+	ETHERTYPE_ECMA                    = 0x803
+	ETHERTYPE_ENCRYPT                 = 0x803d
+	ETHERTYPE_ES                      = 0x805d
+	ETHERTYPE_EXCELAN                 = 0x8010
+	ETHERTYPE_EXPERDATA               = 0x8049
+	ETHERTYPE_FLIP                    = 0x8146
+	ETHERTYPE_FLOWCONTROL             = 0x8808
+	ETHERTYPE_FRARP                   = 0x808
+	ETHERTYPE_GENDYN                  = 0x8068
+	ETHERTYPE_HAYES                   = 0x8130
+	ETHERTYPE_HIPPI_FP                = 0x8180
+	ETHERTYPE_HITACHI                 = 0x8820
+	ETHERTYPE_HP                      = 0x8005
+	ETHERTYPE_IEEEPUP                 = 0xa00
+	ETHERTYPE_IEEEPUPAT               = 0xa01
+	ETHERTYPE_IMLBL                   = 0x4c42
+	ETHERTYPE_IMLBLDIAG               = 0x424c
+	ETHERTYPE_IP                      = 0x800
+	ETHERTYPE_IPAS                    = 0x876c
+	ETHERTYPE_IPV6                    = 0x86dd
+	ETHERTYPE_IPX                     = 0x8137
+	ETHERTYPE_IPXNEW                  = 0x8037
+	ETHERTYPE_KALPANA                 = 0x8582
+	ETHERTYPE_LANBRIDGE               = 0x8038
+	ETHERTYPE_LANPROBE                = 0x8888
+	ETHERTYPE_LAT                     = 0x6004
+	ETHERTYPE_LBACK                   = 0x9000
+	ETHERTYPE_LITTLE                  = 0x8060
+	ETHERTYPE_LLDP                    = 0x88cc
+	ETHERTYPE_LOGICRAFT               = 0x8148
+	ETHERTYPE_LOOPBACK                = 0x9000
+	ETHERTYPE_MATRA                   = 0x807a
+	ETHERTYPE_MAX                     = 0xffff
+	ETHERTYPE_MERIT                   = 0x807c
+	ETHERTYPE_MICP                    = 0x873a
+	ETHERTYPE_MOPDL                   = 0x6001
+	ETHERTYPE_MOPRC                   = 0x6002
+	ETHERTYPE_MOTOROLA                = 0x818d
+	ETHERTYPE_MPLS                    = 0x8847
+	ETHERTYPE_MPLS_MCAST              = 0x8848
+	ETHERTYPE_MUMPS                   = 0x813f
+	ETHERTYPE_NBPCC                   = 0x3c04
+	ETHERTYPE_NBPCLAIM                = 0x3c09
+	ETHERTYPE_NBPCLREQ                = 0x3c05
+	ETHERTYPE_NBPCLRSP                = 0x3c06
+	ETHERTYPE_NBPCREQ                 = 0x3c02
+	ETHERTYPE_NBPCRSP                 = 0x3c03
+	ETHERTYPE_NBPDG                   = 0x3c07
+	ETHERTYPE_NBPDGB                  = 0x3c08
+	ETHERTYPE_NBPDLTE                 = 0x3c0a
+	ETHERTYPE_NBPRAR                  = 0x3c0c
+	ETHERTYPE_NBPRAS                  = 0x3c0b
+	ETHERTYPE_NBPRST                  = 0x3c0d
+	ETHERTYPE_NBPSCD                  = 0x3c01
+	ETHERTYPE_NBPVCD                  = 0x3c00
+	ETHERTYPE_NBS                     = 0x802
+	ETHERTYPE_NCD                     = 0x8149
+	ETHERTYPE_NESTAR                  = 0x8006
+	ETHERTYPE_NETBEUI                 = 0x8191
+	ETHERTYPE_NOVELL                  = 0x8138
+	ETHERTYPE_NS                      = 0x600
+	ETHERTYPE_NSAT                    = 0x601
+	ETHERTYPE_NSCOMPAT                = 0x807
+	ETHERTYPE_NTRAILER                = 0x10
+	ETHERTYPE_OS9                     = 0x7007
+	ETHERTYPE_OS9NET                  = 0x7009
+	ETHERTYPE_PACER                   = 0x80c6
+	ETHERTYPE_PAE                     = 0x888e
+	ETHERTYPE_PBB                     = 0x88e7
+	ETHERTYPE_PCS                     = 0x4242
+	ETHERTYPE_PLANNING                = 0x8044
+	ETHERTYPE_PPP                     = 0x880b
+	ETHERTYPE_PPPOE                   = 0x8864
+	ETHERTYPE_PPPOEDISC               = 0x8863
+	ETHERTYPE_PRIMENTS                = 0x7031
+	ETHERTYPE_PUP                     = 0x200
+	ETHERTYPE_PUPAT                   = 0x200
+	ETHERTYPE_QINQ                    = 0x88a8
+	ETHERTYPE_RACAL                   = 0x7030
+	ETHERTYPE_RATIONAL                = 0x8150
+	ETHERTYPE_RAWFR                   = 0x6559
+	ETHERTYPE_RCL                     = 0x1995
+	ETHERTYPE_RDP                     = 0x8739
+	ETHERTYPE_RETIX                   = 0x80f2
+	ETHERTYPE_REVARP                  = 0x8035
+	ETHERTYPE_SCA                     = 0x6007
+	ETHERTYPE_SECTRA                  = 0x86db
+	ETHERTYPE_SECUREDATA              = 0x876d
+	ETHERTYPE_SGITW                   = 0x817e
+	ETHERTYPE_SG_BOUNCE               = 0x8016
+	ETHERTYPE_SG_DIAG                 = 0x8013
+	ETHERTYPE_SG_NETGAMES             = 0x8014
+	ETHERTYPE_SG_RESV                 = 0x8015
+	ETHERTYPE_SIMNET                  = 0x5208
+	ETHERTYPE_SLOW                    = 0x8809
+	ETHERTYPE_SNA                     = 0x80d5
+	ETHERTYPE_SNMP                    = 0x814c
+	ETHERTYPE_SONIX                   = 0xfaf5
+	ETHERTYPE_SPIDER                  = 0x809f
+	ETHERTYPE_SPRITE                  = 0x500
+	ETHERTYPE_STP                     = 0x8181
+	ETHERTYPE_TALARIS                 = 0x812b
+	ETHERTYPE_TALARISMC               = 0x852b
+	ETHERTYPE_TCPCOMP                 = 0x876b
+	ETHERTYPE_TCPSM                   = 0x9002
+	ETHERTYPE_TEC                     = 0x814f
+	ETHERTYPE_TIGAN                   = 0x802f
+	ETHERTYPE_TRAIL                   = 0x1000
+	ETHERTYPE_TRANSETHER              = 0x6558
+	ETHERTYPE_TYMSHARE                = 0x802e
+	ETHERTYPE_UBBST                   = 0x7005
+	ETHERTYPE_UBDEBUG                 = 0x900
+	ETHERTYPE_UBDIAGLOOP              = 0x7002
+	ETHERTYPE_UBDL                    = 0x7000
+	ETHERTYPE_UBNIU                   = 0x7001
+	ETHERTYPE_UBNMC                   = 0x7003
+	ETHERTYPE_VALID                   = 0x1600
+	ETHERTYPE_VARIAN                  = 0x80dd
+	ETHERTYPE_VAXELN                  = 0x803b
+	ETHERTYPE_VEECO                   = 0x8067
+	ETHERTYPE_VEXP                    = 0x805b
+	ETHERTYPE_VGLAB                   = 0x8131
+	ETHERTYPE_VINES                   = 0xbad
+	ETHERTYPE_VINESECHO               = 0xbaf
+	ETHERTYPE_VINESLOOP               = 0xbae
+	ETHERTYPE_VITAL                   = 0xff00
+	ETHERTYPE_VLAN                    = 0x8100
+	ETHERTYPE_VLTLMAN                 = 0x8080
+	ETHERTYPE_VPROD                   = 0x805c
+	ETHERTYPE_VURESERVED              = 0x8147
+	ETHERTYPE_WATERLOO                = 0x8130
+	ETHERTYPE_WELLFLEET               = 0x8103
+	ETHERTYPE_X25                     = 0x805
+	ETHERTYPE_X75                     = 0x801
+	ETHERTYPE_XNSSM                   = 0x9001
+	ETHERTYPE_XTP                     = 0x817d
+	ETHER_ADDR_LEN                    = 0x6
+	ETHER_ALIGN                       = 0x2
+	ETHER_CRC_LEN                     = 0x4
+	ETHER_CRC_POLY_BE                 = 0x4c11db6
+	ETHER_CRC_POLY_LE                 = 0xedb88320
+	ETHER_HDR_LEN                     = 0xe
+	ETHER_MAX_DIX_LEN                 = 0x600
+	ETHER_MAX_HARDMTU_LEN             = 0xff9b
+	ETHER_MAX_LEN                     = 0x5ee
+	ETHER_MIN_LEN                     = 0x40
+	ETHER_TYPE_LEN                    = 0x2
+	ETHER_VLAN_ENCAP_LEN              = 0x4
+	EVFILT_AIO                        = -0x3
+	EVFILT_DEVICE                     = -0x8
+	EVFILT_PROC                       = -0x5
+	EVFILT_READ                       = -0x1
+	EVFILT_SIGNAL                     = -0x6
+	EVFILT_SYSCOUNT                   = 0x8
+	EVFILT_TIMER                      = -0x7
+	EVFILT_VNODE                      = -0x4
+	EVFILT_WRITE                      = -0x2
+	EVL_ENCAPLEN                      = 0x4
+	EVL_PRIO_BITS                     = 0xd
+	EVL_PRIO_MAX                      = 0x7
+	EVL_VLID_MASK                     = 0xfff
+	EVL_VLID_MAX                      = 0xffe
+	EVL_VLID_MIN                      = 0x1
+	EVL_VLID_NULL                     = 0x0
+	EV_ADD                            = 0x1
+	EV_CLEAR                          = 0x20
+	EV_DELETE                         = 0x2
+	EV_DISABLE                        = 0x8
+	EV_DISPATCH                       = 0x80
+	EV_ENABLE                         = 0x4
+	EV_EOF                            = 0x8000
+	EV_ERROR                          = 0x4000
+	EV_FLAG1                          = 0x2000
+	EV_ONESHOT                        = 0x10
+	EV_RECEIPT                        = 0x40
+	EV_SYSFLAGS                       = 0xf000
+	EXTA                              = 0x4b00
+	EXTB                              = 0x9600
+	EXTPROC                           = 0x800
+	FD_CLOEXEC                        = 0x1
+	FD_SETSIZE                        = 0x400
+	FLUSHO                            = 0x800000
+	F_DUPFD                           = 0x0
+	F_DUPFD_CLOEXEC                   = 0xa
+	F_GETFD                           = 0x1
+	F_GETFL                           = 0x3
+	F_GETLK                           = 0x7
+	F_GETOWN                          = 0x5
+	F_ISATTY                          = 0xb
+	F_OK                              = 0x0
+	F_RDLCK                           = 0x1
+	F_SETFD                           = 0x2
+	F_SETFL                           = 0x4
+	F_SETLK                           = 0x8
+	F_SETLKW                          = 0x9
+	F_SETOWN                          = 0x6
+	F_UNLCK                           = 0x2
+	F_WRLCK                           = 0x3
+	HUPCL                             = 0x4000
+	HW_MACHINE                        = 0x1
+	ICANON                            = 0x100
+	ICMP6_FILTER                      = 0x12
+	ICRNL                             = 0x100
+	IEXTEN                            = 0x400
+	IFAN_ARRIVAL                      = 0x0
+	IFAN_DEPARTURE                    = 0x1
+	IFF_ALLMULTI                      = 0x200
+	IFF_BROADCAST                     = 0x2
+	IFF_CANTCHANGE                    = 0x8e52
+	IFF_DEBUG                         = 0x4
+	IFF_LINK0                         = 0x1000
+	IFF_LINK1                         = 0x2000
+	IFF_LINK2                         = 0x4000
+	IFF_LOOPBACK                      = 0x8
+	IFF_MULTICAST                     = 0x8000
+	IFF_NOARP                         = 0x80
+	IFF_OACTIVE                       = 0x400
+	IFF_POINTOPOINT                   = 0x10
+	IFF_PROMISC                       = 0x100
+	IFF_RUNNING                       = 0x40
+	IFF_SIMPLEX                       = 0x800
+	IFF_STATICARP                     = 0x20
+	IFF_UP                            = 0x1
+	IFNAMSIZ                          = 0x10
+	IFT_1822                          = 0x2
+	IFT_A12MPPSWITCH                  = 0x82
+	IFT_AAL2                          = 0xbb
+	IFT_AAL5                          = 0x31
+	IFT_ADSL                          = 0x5e
+	IFT_AFLANE8023                    = 0x3b
+	IFT_AFLANE8025                    = 0x3c
+	IFT_ARAP                          = 0x58
+	IFT_ARCNET                        = 0x23
+	IFT_ARCNETPLUS                    = 0x24
+	IFT_ASYNC                         = 0x54
+	IFT_ATM                           = 0x25
+	IFT_ATMDXI                        = 0x69
+	IFT_ATMFUNI                       = 0x6a
+	IFT_ATMIMA                        = 0x6b
+	IFT_ATMLOGICAL                    = 0x50
+	IFT_ATMRADIO                      = 0xbd
+	IFT_ATMSUBINTERFACE               = 0x86
+	IFT_ATMVCIENDPT                   = 0xc2
+	IFT_ATMVIRTUAL                    = 0x95
+	IFT_BGPPOLICYACCOUNTING           = 0xa2
+	IFT_BLUETOOTH                     = 0xf8
+	IFT_BRIDGE                        = 0xd1
+	IFT_BSC                           = 0x53
+	IFT_CARP                          = 0xf7
+	IFT_CCTEMUL                       = 0x3d
+	IFT_CEPT                          = 0x13
+	IFT_CES                           = 0x85
+	IFT_CHANNEL                       = 0x46
+	IFT_CNR                           = 0x55
+	IFT_COFFEE                        = 0x84
+	IFT_COMPOSITELINK                 = 0x9b
+	IFT_DCN                           = 0x8d
+	IFT_DIGITALPOWERLINE              = 0x8a
+	IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba
+	IFT_DLSW                          = 0x4a
+	IFT_DOCSCABLEDOWNSTREAM           = 0x80
+	IFT_DOCSCABLEMACLAYER             = 0x7f
+	IFT_DOCSCABLEUPSTREAM             = 0x81
+	IFT_DOCSCABLEUPSTREAMCHANNEL      = 0xcd
+	IFT_DS0                           = 0x51
+	IFT_DS0BUNDLE                     = 0x52
+	IFT_DS1FDL                        = 0xaa
+	IFT_DS3                           = 0x1e
+	IFT_DTM                           = 0x8c
+	IFT_DUMMY                         = 0xf1
+	IFT_DVBASILN                      = 0xac
+	IFT_DVBASIOUT                     = 0xad
+	IFT_DVBRCCDOWNSTREAM              = 0x93
+	IFT_DVBRCCMACLAYER                = 0x92
+	IFT_DVBRCCUPSTREAM                = 0x94
+	IFT_ECONET                        = 0xce
+	IFT_ENC                           = 0xf4
+	IFT_EON                           = 0x19
+	IFT_EPLRS                         = 0x57
+	IFT_ESCON                         = 0x49
+	IFT_ETHER                         = 0x6
+	IFT_FAITH                         = 0xf3
+	IFT_FAST                          = 0x7d
+	IFT_FASTETHER                     = 0x3e
+	IFT_FASTETHERFX                   = 0x45
+	IFT_FDDI                          = 0xf
+	IFT_FIBRECHANNEL                  = 0x38
+	IFT_FRAMERELAYINTERCONNECT        = 0x3a
+	IFT_FRAMERELAYMPI                 = 0x5c
+	IFT_FRDLCIENDPT                   = 0xc1
+	IFT_FRELAY                        = 0x20
+	IFT_FRELAYDCE                     = 0x2c
+	IFT_FRF16MFRBUNDLE                = 0xa3
+	IFT_FRFORWARD                     = 0x9e
+	IFT_G703AT2MB                     = 0x43
+	IFT_G703AT64K                     = 0x42
+	IFT_GIF                           = 0xf0
+	IFT_GIGABITETHERNET               = 0x75
+	IFT_GR303IDT                      = 0xb2
+	IFT_GR303RDT                      = 0xb1
+	IFT_H323GATEKEEPER                = 0xa4
+	IFT_H323PROXY                     = 0xa5
+	IFT_HDH1822                       = 0x3
+	IFT_HDLC                          = 0x76
+	IFT_HDSL2                         = 0xa8
+	IFT_HIPERLAN2                     = 0xb7
+	IFT_HIPPI                         = 0x2f
+	IFT_HIPPIINTERFACE                = 0x39
+	IFT_HOSTPAD                       = 0x5a
+	IFT_HSSI                          = 0x2e
+	IFT_HY                            = 0xe
+	IFT_IBM370PARCHAN                 = 0x48
+	IFT_IDSL                          = 0x9a
+	IFT_IEEE1394                      = 0x90
+	IFT_IEEE80211                     = 0x47
+	IFT_IEEE80212                     = 0x37
+	IFT_IEEE8023ADLAG                 = 0xa1
+	IFT_IFGSN                         = 0x91
+	IFT_IMT                           = 0xbe
+	IFT_INFINIBAND                    = 0xc7
+	IFT_INTERLEAVE                    = 0x7c
+	IFT_IP                            = 0x7e
+	IFT_IPFORWARD                     = 0x8e
+	IFT_IPOVERATM                     = 0x72
+	IFT_IPOVERCDLC                    = 0x6d
+	IFT_IPOVERCLAW                    = 0x6e
+	IFT_IPSWITCH                      = 0x4e
+	IFT_ISDN                          = 0x3f
+	IFT_ISDNBASIC                     = 0x14
+	IFT_ISDNPRIMARY                   = 0x15
+	IFT_ISDNS                         = 0x4b
+	IFT_ISDNU                         = 0x4c
+	IFT_ISO88022LLC                   = 0x29
+	IFT_ISO88023                      = 0x7
+	IFT_ISO88024                      = 0x8
+	IFT_ISO88025                      = 0x9
+	IFT_ISO88025CRFPINT               = 0x62
+	IFT_ISO88025DTR                   = 0x56
+	IFT_ISO88025FIBER                 = 0x73
+	IFT_ISO88026                      = 0xa
+	IFT_ISUP                          = 0xb3
+	IFT_L2VLAN                        = 0x87
+	IFT_L3IPVLAN                      = 0x88
+	IFT_L3IPXVLAN                     = 0x89
+	IFT_LAPB                          = 0x10
+	IFT_LAPD                          = 0x4d
+	IFT_LAPF                          = 0x77
+	IFT_LINEGROUP                     = 0xd2
+	IFT_LOCALTALK                     = 0x2a
+	IFT_LOOP                          = 0x18
+	IFT_MBIM                          = 0xfa
+	IFT_MEDIAMAILOVERIP               = 0x8b
+	IFT_MFSIGLINK                     = 0xa7
+	IFT_MIOX25                        = 0x26
+	IFT_MODEM                         = 0x30
+	IFT_MPC                           = 0x71
+	IFT_MPLS                          = 0xa6
+	IFT_MPLSTUNNEL                    = 0x96
+	IFT_MSDSL                         = 0x8f
+	IFT_MVL                           = 0xbf
+	IFT_MYRINET                       = 0x63
+	IFT_NFAS                          = 0xaf
+	IFT_NSIP                          = 0x1b
+	IFT_OPTICALCHANNEL                = 0xc3
+	IFT_OPTICALTRANSPORT              = 0xc4
+	IFT_OTHER                         = 0x1
+	IFT_P10                           = 0xc
+	IFT_P80                           = 0xd
+	IFT_PARA                          = 0x22
+	IFT_PFLOG                         = 0xf5
+	IFT_PFLOW                         = 0xf9
+	IFT_PFSYNC                        = 0xf6
+	IFT_PLC                           = 0xae
+	IFT_PON155                        = 0xcf
+	IFT_PON622                        = 0xd0
+	IFT_POS                           = 0xab
+	IFT_PPP                           = 0x17
+	IFT_PPPMULTILINKBUNDLE            = 0x6c
+	IFT_PROPATM                       = 0xc5
+	IFT_PROPBWAP2MP                   = 0xb8
+	IFT_PROPCNLS                      = 0x59
+	IFT_PROPDOCSWIRELESSDOWNSTREAM    = 0xb5
+	IFT_PROPDOCSWIRELESSMACLAYER      = 0xb4
+	IFT_PROPDOCSWIRELESSUPSTREAM      = 0xb6
+	IFT_PROPMUX                       = 0x36
+	IFT_PROPVIRTUAL                   = 0x35
+	IFT_PROPWIRELESSP2P               = 0x9d
+	IFT_PTPSERIAL                     = 0x16
+	IFT_PVC                           = 0xf2
+	IFT_Q2931                         = 0xc9
+	IFT_QLLC                          = 0x44
+	IFT_RADIOMAC                      = 0xbc
+	IFT_RADSL                         = 0x5f
+	IFT_REACHDSL                      = 0xc0
+	IFT_RFC1483                       = 0x9f
+	IFT_RS232                         = 0x21
+	IFT_RSRB                          = 0x4f
+	IFT_SDLC                          = 0x11
+	IFT_SDSL                          = 0x60
+	IFT_SHDSL                         = 0xa9
+	IFT_SIP                           = 0x1f
+	IFT_SIPSIG                        = 0xcc
+	IFT_SIPTG                         = 0xcb
+	IFT_SLIP                          = 0x1c
+	IFT_SMDSDXI                       = 0x2b
+	IFT_SMDSICIP                      = 0x34
+	IFT_SONET                         = 0x27
+	IFT_SONETOVERHEADCHANNEL          = 0xb9
+	IFT_SONETPATH                     = 0x32
+	IFT_SONETVT                       = 0x33
+	IFT_SRP                           = 0x97
+	IFT_SS7SIGLINK                    = 0x9c
+	IFT_STACKTOSTACK                  = 0x6f
+	IFT_STARLAN                       = 0xb
+	IFT_T1                            = 0x12
+	IFT_TDLC                          = 0x74
+	IFT_TELINK                        = 0xc8
+	IFT_TERMPAD                       = 0x5b
+	IFT_TR008                         = 0xb0
+	IFT_TRANSPHDLC                    = 0x7b
+	IFT_TUNNEL                        = 0x83
+	IFT_ULTRA                         = 0x1d
+	IFT_USB                           = 0xa0
+	IFT_V11                           = 0x40
+	IFT_V35                           = 0x2d
+	IFT_V36                           = 0x41
+	IFT_V37                           = 0x78
+	IFT_VDSL                          = 0x61
+	IFT_VIRTUALIPADDRESS              = 0x70
+	IFT_VIRTUALTG                     = 0xca
+	IFT_VOICEDID                      = 0xd5
+	IFT_VOICEEM                       = 0x64
+	IFT_VOICEEMFGD                    = 0xd3
+	IFT_VOICEENCAP                    = 0x67
+	IFT_VOICEFGDEANA                  = 0xd4
+	IFT_VOICEFXO                      = 0x65
+	IFT_VOICEFXS                      = 0x66
+	IFT_VOICEOVERATM                  = 0x98
+	IFT_VOICEOVERCABLE                = 0xc6
+	IFT_VOICEOVERFRAMERELAY           = 0x99
+	IFT_VOICEOVERIP                   = 0x68
+	IFT_X213                          = 0x5d
+	IFT_X25                           = 0x5
+	IFT_X25DDN                        = 0x4
+	IFT_X25HUNTGROUP                  = 0x7a
+	IFT_X25MLP                        = 0x79
+	IFT_X25PLE                        = 0x28
+	IFT_XETHER                        = 0x1a
+	IGNBRK                            = 0x1
+	IGNCR                             = 0x80
+	IGNPAR                            = 0x4
+	IMAXBEL                           = 0x2000
+	INLCR                             = 0x40
+	INPCK                             = 0x10
+	IN_CLASSA_HOST                    = 0xffffff
+	IN_CLASSA_MAX                     = 0x80
+	IN_CLASSA_NET                     = 0xff000000
+	IN_CLASSA_NSHIFT                  = 0x18
+	IN_CLASSB_HOST                    = 0xffff
+	IN_CLASSB_MAX                     = 0x10000
+	IN_CLASSB_NET                     = 0xffff0000
+	IN_CLASSB_NSHIFT                  = 0x10
+	IN_CLASSC_HOST                    = 0xff
+	IN_CLASSC_NET                     = 0xffffff00
+	IN_CLASSC_NSHIFT                  = 0x8
+	IN_CLASSD_HOST                    = 0xfffffff
+	IN_CLASSD_NET                     = 0xf0000000
+	IN_CLASSD_NSHIFT                  = 0x1c
+	IN_LOOPBACKNET                    = 0x7f
+	IN_RFC3021_HOST                   = 0x1
+	IN_RFC3021_NET                    = 0xfffffffe
+	IN_RFC3021_NSHIFT                 = 0x1f
+	IPPROTO_AH                        = 0x33
+	IPPROTO_CARP                      = 0x70
+	IPPROTO_DIVERT                    = 0x102
+	IPPROTO_DONE                      = 0x101
+	IPPROTO_DSTOPTS                   = 0x3c
+	IPPROTO_EGP                       = 0x8
+	IPPROTO_ENCAP                     = 0x62
+	IPPROTO_EON                       = 0x50
+	IPPROTO_ESP                       = 0x32
+	IPPROTO_ETHERIP                   = 0x61
+	IPPROTO_FRAGMENT                  = 0x2c
+	IPPROTO_GGP                       = 0x3
+	IPPROTO_GRE                       = 0x2f
+	IPPROTO_HOPOPTS                   = 0x0
+	IPPROTO_ICMP                      = 0x1
+	IPPROTO_ICMPV6                    = 0x3a
+	IPPROTO_IDP                       = 0x16
+	IPPROTO_IGMP                      = 0x2
+	IPPROTO_IP                        = 0x0
+	IPPROTO_IPCOMP                    = 0x6c
+	IPPROTO_IPIP                      = 0x4
+	IPPROTO_IPV4                      = 0x4
+	IPPROTO_IPV6                      = 0x29
+	IPPROTO_MAX                       = 0x100
+	IPPROTO_MAXID                     = 0x103
+	IPPROTO_MOBILE                    = 0x37
+	IPPROTO_MPLS                      = 0x89
+	IPPROTO_NONE                      = 0x3b
+	IPPROTO_PFSYNC                    = 0xf0
+	IPPROTO_PIM                       = 0x67
+	IPPROTO_PUP                       = 0xc
+	IPPROTO_RAW                       = 0xff
+	IPPROTO_ROUTING                   = 0x2b
+	IPPROTO_RSVP                      = 0x2e
+	IPPROTO_TCP                       = 0x6
+	IPPROTO_TP                        = 0x1d
+	IPPROTO_UDP                       = 0x11
+	IPV6_AUTH_LEVEL                   = 0x35
+	IPV6_AUTOFLOWLABEL                = 0x3b
+	IPV6_CHECKSUM                     = 0x1a
+	IPV6_DEFAULT_MULTICAST_HOPS       = 0x1
+	IPV6_DEFAULT_MULTICAST_LOOP       = 0x1
+	IPV6_DEFHLIM                      = 0x40
+	IPV6_DONTFRAG                     = 0x3e
+	IPV6_DSTOPTS                      = 0x32
+	IPV6_ESP_NETWORK_LEVEL            = 0x37
+	IPV6_ESP_TRANS_LEVEL              = 0x36
+	IPV6_FAITH                        = 0x1d
+	IPV6_FLOWINFO_MASK                = 0xffffff0f
+	IPV6_FLOWLABEL_MASK               = 0xffff0f00
+	IPV6_FRAGTTL                      = 0x78
+	IPV6_HLIMDEC                      = 0x1
+	IPV6_HOPLIMIT                     = 0x2f
+	IPV6_HOPOPTS                      = 0x31
+	IPV6_IPCOMP_LEVEL                 = 0x3c
+	IPV6_JOIN_GROUP                   = 0xc
+	IPV6_LEAVE_GROUP                  = 0xd
+	IPV6_MAXHLIM                      = 0xff
+	IPV6_MAXPACKET                    = 0xffff
+	IPV6_MINHOPCOUNT                  = 0x41
+	IPV6_MMTU                         = 0x500
+	IPV6_MULTICAST_HOPS               = 0xa
+	IPV6_MULTICAST_IF                 = 0x9
+	IPV6_MULTICAST_LOOP               = 0xb
+	IPV6_NEXTHOP                      = 0x30
+	IPV6_OPTIONS                      = 0x1
+	IPV6_PATHMTU                      = 0x2c
+	IPV6_PIPEX                        = 0x3f
+	IPV6_PKTINFO                      = 0x2e
+	IPV6_PORTRANGE                    = 0xe
+	IPV6_PORTRANGE_DEFAULT            = 0x0
+	IPV6_PORTRANGE_HIGH               = 0x1
+	IPV6_PORTRANGE_LOW                = 0x2
+	IPV6_RECVDSTOPTS                  = 0x28
+	IPV6_RECVDSTPORT                  = 0x40
+	IPV6_RECVHOPLIMIT                 = 0x25
+	IPV6_RECVHOPOPTS                  = 0x27
+	IPV6_RECVPATHMTU                  = 0x2b
+	IPV6_RECVPKTINFO                  = 0x24
+	IPV6_RECVRTHDR                    = 0x26
+	IPV6_RECVTCLASS                   = 0x39
+	IPV6_RTABLE                       = 0x1021
+	IPV6_RTHDR                        = 0x33
+	IPV6_RTHDRDSTOPTS                 = 0x23
+	IPV6_RTHDR_LOOSE                  = 0x0
+	IPV6_RTHDR_STRICT                 = 0x1
+	IPV6_RTHDR_TYPE_0                 = 0x0
+	IPV6_SOCKOPT_RESERVED1            = 0x3
+	IPV6_TCLASS                       = 0x3d
+	IPV6_UNICAST_HOPS                 = 0x4
+	IPV6_USE_MIN_MTU                  = 0x2a
+	IPV6_V6ONLY                       = 0x1b
+	IPV6_VERSION                      = 0x60
+	IPV6_VERSION_MASK                 = 0xf0
+	IP_ADD_MEMBERSHIP                 = 0xc
+	IP_AUTH_LEVEL                     = 0x14
+	IP_DEFAULT_MULTICAST_LOOP         = 0x1
+	IP_DEFAULT_MULTICAST_TTL          = 0x1
+	IP_DF                             = 0x4000
+	IP_DROP_MEMBERSHIP                = 0xd
+	IP_ESP_NETWORK_LEVEL              = 0x16
+	IP_ESP_TRANS_LEVEL                = 0x15
+	IP_HDRINCL                        = 0x2
+	IP_IPCOMP_LEVEL                   = 0x1d
+	IP_IPDEFTTL                       = 0x25
+	IP_IPSECFLOWINFO                  = 0x24
+	IP_IPSEC_LOCAL_AUTH               = 0x1b
+	IP_IPSEC_LOCAL_CRED               = 0x19
+	IP_IPSEC_LOCAL_ID                 = 0x17
+	IP_IPSEC_REMOTE_AUTH              = 0x1c
+	IP_IPSEC_REMOTE_CRED              = 0x1a
+	IP_IPSEC_REMOTE_ID                = 0x18
+	IP_MAXPACKET                      = 0xffff
+	IP_MAX_MEMBERSHIPS                = 0xfff
+	IP_MF                             = 0x2000
+	IP_MINTTL                         = 0x20
+	IP_MIN_MEMBERSHIPS                = 0xf
+	IP_MSS                            = 0x240
+	IP_MULTICAST_IF                   = 0x9
+	IP_MULTICAST_LOOP                 = 0xb
+	IP_MULTICAST_TTL                  = 0xa
+	IP_OFFMASK                        = 0x1fff
+	IP_OPTIONS                        = 0x1
+	IP_PIPEX                          = 0x22
+	IP_PORTRANGE                      = 0x13
+	IP_PORTRANGE_DEFAULT              = 0x0
+	IP_PORTRANGE_HIGH                 = 0x1
+	IP_PORTRANGE_LOW                  = 0x2
+	IP_RECVDSTADDR                    = 0x7
+	IP_RECVDSTPORT                    = 0x21
+	IP_RECVIF                         = 0x1e
+	IP_RECVOPTS                       = 0x5
+	IP_RECVRETOPTS                    = 0x6
+	IP_RECVRTABLE                     = 0x23
+	IP_RECVTTL                        = 0x1f
+	IP_RETOPTS                        = 0x8
+	IP_RF                             = 0x8000
+	IP_RTABLE                         = 0x1021
+	IP_SENDSRCADDR                    = 0x7
+	IP_TOS                            = 0x3
+	IP_TTL                            = 0x4
+	ISIG                              = 0x80
+	ISTRIP                            = 0x20
+	IUCLC                             = 0x1000
+	IXANY                             = 0x800
+	IXOFF                             = 0x400
+	IXON                              = 0x200
+	KERN_HOSTNAME                     = 0xa
+	KERN_OSRELEASE                    = 0x2
+	KERN_OSTYPE                       = 0x1
+	KERN_VERSION                      = 0x4
+	LCNT_OVERLOAD_FLUSH               = 0x6
+	LOCK_EX                           = 0x2
+	LOCK_NB                           = 0x4
+	LOCK_SH                           = 0x1
+	LOCK_UN                           = 0x8
+	MADV_DONTNEED                     = 0x4
+	MADV_FREE                         = 0x6
+	MADV_NORMAL                       = 0x0
+	MADV_RANDOM                       = 0x1
+	MADV_SEQUENTIAL                   = 0x2
+	MADV_SPACEAVAIL                   = 0x5
+	MADV_WILLNEED                     = 0x3
+	MAP_ANON                          = 0x1000
+	MAP_ANONYMOUS                     = 0x1000
+	MAP_CONCEAL                       = 0x8000
+	MAP_COPY                          = 0x2
+	MAP_FILE                          = 0x0
+	MAP_FIXED                         = 0x10
+	MAP_FLAGMASK                      = 0xfff7
+	MAP_HASSEMAPHORE                  = 0x0
+	MAP_INHERIT                       = 0x0
+	MAP_INHERIT_COPY                  = 0x1
+	MAP_INHERIT_NONE                  = 0x2
+	MAP_INHERIT_SHARE                 = 0x0
+	MAP_INHERIT_ZERO                  = 0x3
+	MAP_NOEXTEND                      = 0x0
+	MAP_NORESERVE                     = 0x0
+	MAP_PRIVATE                       = 0x2
+	MAP_RENAME                        = 0x0
+	MAP_SHARED                        = 0x1
+	MAP_STACK                         = 0x4000
+	MAP_TRYFIXED                      = 0x0
+	MCL_CURRENT                       = 0x1
+	MCL_FUTURE                        = 0x2
+	MNT_ASYNC                         = 0x40
+	MNT_DEFEXPORTED                   = 0x200
+	MNT_DELEXPORT                     = 0x20000
+	MNT_DOOMED                        = 0x8000000
+	MNT_EXPORTANON                    = 0x400
+	MNT_EXPORTED                      = 0x100
+	MNT_EXRDONLY                      = 0x80
+	MNT_FORCE                         = 0x80000
+	MNT_LAZY                          = 0x3
+	MNT_LOCAL                         = 0x1000
+	MNT_NOATIME                       = 0x8000
+	MNT_NODEV                         = 0x10
+	MNT_NOEXEC                        = 0x4
+	MNT_NOPERM                        = 0x20
+	MNT_NOSUID                        = 0x8
+	MNT_NOWAIT                        = 0x2
+	MNT_QUOTA                         = 0x2000
+	MNT_RDONLY                        = 0x1
+	MNT_RELOAD                        = 0x40000
+	MNT_ROOTFS                        = 0x4000
+	MNT_SOFTDEP                       = 0x4000000
+	MNT_STALLED                       = 0x100000
+	MNT_SWAPPABLE                     = 0x200000
+	MNT_SYNCHRONOUS                   = 0x2
+	MNT_UPDATE                        = 0x10000
+	MNT_VISFLAGMASK                   = 0x400ffff
+	MNT_WAIT                          = 0x1
+	MNT_WANTRDWR                      = 0x2000000
+	MNT_WXALLOWED                     = 0x800
+	MSG_BCAST                         = 0x100
+	MSG_CMSG_CLOEXEC                  = 0x800
+	MSG_CTRUNC                        = 0x20
+	MSG_DONTROUTE                     = 0x4
+	MSG_DONTWAIT                      = 0x80
+	MSG_EOR                           = 0x8
+	MSG_MCAST                         = 0x200
+	MSG_NOSIGNAL                      = 0x400
+	MSG_OOB                           = 0x1
+	MSG_PEEK                          = 0x2
+	MSG_TRUNC                         = 0x10
+	MSG_WAITALL                       = 0x40
+	MS_ASYNC                          = 0x1
+	MS_INVALIDATE                     = 0x4
+	MS_SYNC                           = 0x2
+	NAME_MAX                          = 0xff
+	NET_RT_DUMP                       = 0x1
+	NET_RT_FLAGS                      = 0x2
+	NET_RT_IFLIST                     = 0x3
+	NET_RT_IFNAMES                    = 0x6
+	NET_RT_MAXID                      = 0x7
+	NET_RT_STATS                      = 0x4
+	NET_RT_TABLE                      = 0x5
+	NOFLSH                            = 0x80000000
+	NOKERNINFO                        = 0x2000000
+	NOTE_ATTRIB                       = 0x8
+	NOTE_CHANGE                       = 0x1
+	NOTE_CHILD                        = 0x4
+	NOTE_DELETE                       = 0x1
+	NOTE_EOF                          = 0x2
+	NOTE_EXEC                         = 0x20000000
+	NOTE_EXIT                         = 0x80000000
+	NOTE_EXTEND                       = 0x4
+	NOTE_FORK                         = 0x40000000
+	NOTE_LINK                         = 0x10
+	NOTE_LOWAT                        = 0x1
+	NOTE_PCTRLMASK                    = 0xf0000000
+	NOTE_PDATAMASK                    = 0xfffff
+	NOTE_RENAME                       = 0x20
+	NOTE_REVOKE                       = 0x40
+	NOTE_TRACK                        = 0x1
+	NOTE_TRACKERR                     = 0x2
+	NOTE_TRUNCATE                     = 0x80
+	NOTE_WRITE                        = 0x2
+	OCRNL                             = 0x10
+	OLCUC                             = 0x20
+	ONLCR                             = 0x2
+	ONLRET                            = 0x80
+	ONOCR                             = 0x40
+	ONOEOT                            = 0x8
+	OPOST                             = 0x1
+	OXTABS                            = 0x4
+	O_ACCMODE                         = 0x3
+	O_APPEND                          = 0x8
+	O_ASYNC                           = 0x40
+	O_CLOEXEC                         = 0x10000
+	O_CREAT                           = 0x200
+	O_DIRECTORY                       = 0x20000
+	O_DSYNC                           = 0x80
+	O_EXCL                            = 0x800
+	O_EXLOCK                          = 0x20
+	O_FSYNC                           = 0x80
+	O_NDELAY                          = 0x4
+	O_NOCTTY                          = 0x8000
+	O_NOFOLLOW                        = 0x100
+	O_NONBLOCK                        = 0x4
+	O_RDONLY                          = 0x0
+	O_RDWR                            = 0x2
+	O_RSYNC                           = 0x80
+	O_SHLOCK                          = 0x10
+	O_SYNC                            = 0x80
+	O_TRUNC                           = 0x400
+	O_WRONLY                          = 0x1
+	PARENB                            = 0x1000
+	PARMRK                            = 0x8
+	PARODD                            = 0x2000
+	PENDIN                            = 0x20000000
+	PF_FLUSH                          = 0x1
+	PRIO_PGRP                         = 0x1
+	PRIO_PROCESS                      = 0x0
+	PRIO_USER                         = 0x2
+	PROT_EXEC                         = 0x4
+	PROT_NONE                         = 0x0
+	PROT_READ                         = 0x1
+	PROT_WRITE                        = 0x2
+	RLIMIT_CORE                       = 0x4
+	RLIMIT_CPU                        = 0x0
+	RLIMIT_DATA                       = 0x2
+	RLIMIT_FSIZE                      = 0x1
+	RLIMIT_MEMLOCK                    = 0x6
+	RLIMIT_NOFILE                     = 0x8
+	RLIMIT_NPROC                      = 0x7
+	RLIMIT_RSS                        = 0x5
+	RLIMIT_STACK                      = 0x3
+	RLIM_INFINITY                     = 0x7fffffffffffffff
+	RTAX_AUTHOR                       = 0x6
+	RTAX_BFD                          = 0xb
+	RTAX_BRD                          = 0x7
+	RTAX_DNS                          = 0xc
+	RTAX_DST                          = 0x0
+	RTAX_GATEWAY                      = 0x1
+	RTAX_GENMASK                      = 0x3
+	RTAX_IFA                          = 0x5
+	RTAX_IFP                          = 0x4
+	RTAX_LABEL                        = 0xa
+	RTAX_MAX                          = 0xf
+	RTAX_NETMASK                      = 0x2
+	RTAX_SEARCH                       = 0xe
+	RTAX_SRC                          = 0x8
+	RTAX_SRCMASK                      = 0x9
+	RTAX_STATIC                       = 0xd
+	RTA_AUTHOR                        = 0x40
+	RTA_BFD                           = 0x800
+	RTA_BRD                           = 0x80
+	RTA_DNS                           = 0x1000
+	RTA_DST                           = 0x1
+	RTA_GATEWAY                       = 0x2
+	RTA_GENMASK                       = 0x8
+	RTA_IFA                           = 0x20
+	RTA_IFP                           = 0x10
+	RTA_LABEL                         = 0x400
+	RTA_NETMASK                       = 0x4
+	RTA_SEARCH                        = 0x4000
+	RTA_SRC                           = 0x100
+	RTA_SRCMASK                       = 0x200
+	RTA_STATIC                        = 0x2000
+	RTF_ANNOUNCE                      = 0x4000
+	RTF_BFD                           = 0x1000000
+	RTF_BLACKHOLE                     = 0x1000
+	RTF_BROADCAST                     = 0x400000
+	RTF_CACHED                        = 0x20000
+	RTF_CLONED                        = 0x10000
+	RTF_CLONING                       = 0x100
+	RTF_CONNECTED                     = 0x800000
+	RTF_DONE                          = 0x40
+	RTF_DYNAMIC                       = 0x10
+	RTF_FMASK                         = 0x110fc08
+	RTF_GATEWAY                       = 0x2
+	RTF_HOST                          = 0x4
+	RTF_LLINFO                        = 0x400
+	RTF_LOCAL                         = 0x200000
+	RTF_MODIFIED                      = 0x20
+	RTF_MPATH                         = 0x40000
+	RTF_MPLS                          = 0x100000
+	RTF_MULTICAST                     = 0x200
+	RTF_PERMANENT_ARP                 = 0x2000
+	RTF_PROTO1                        = 0x8000
+	RTF_PROTO2                        = 0x4000
+	RTF_PROTO3                        = 0x2000
+	RTF_REJECT                        = 0x8
+	RTF_STATIC                        = 0x800
+	RTF_UP                            = 0x1
+	RTF_USETRAILERS                   = 0x8000
+	RTM_80211INFO                     = 0x15
+	RTM_ADD                           = 0x1
+	RTM_BFD                           = 0x12
+	RTM_CHANGE                        = 0x3
+	RTM_CHGADDRATTR                   = 0x14
+	RTM_DELADDR                       = 0xd
+	RTM_DELETE                        = 0x2
+	RTM_DESYNC                        = 0x10
+	RTM_GET                           = 0x4
+	RTM_IFANNOUNCE                    = 0xf
+	RTM_IFINFO                        = 0xe
+	RTM_INVALIDATE                    = 0x11
+	RTM_LOSING                        = 0x5
+	RTM_MAXSIZE                       = 0x800
+	RTM_MISS                          = 0x7
+	RTM_NEWADDR                       = 0xc
+	RTM_PROPOSAL                      = 0x13
+	RTM_REDIRECT                      = 0x6
+	RTM_RESOLVE                       = 0xb
+	RTM_RTTUNIT                       = 0xf4240
+	RTM_VERSION                       = 0x5
+	RTV_EXPIRE                        = 0x4
+	RTV_HOPCOUNT                      = 0x2
+	RTV_MTU                           = 0x1
+	RTV_RPIPE                         = 0x8
+	RTV_RTT                           = 0x40
+	RTV_RTTVAR                        = 0x80
+	RTV_SPIPE                         = 0x10
+	RTV_SSTHRESH                      = 0x20
+	RT_TABLEID_BITS                   = 0x8
+	RT_TABLEID_MASK                   = 0xff
+	RT_TABLEID_MAX                    = 0xff
+	RUSAGE_CHILDREN                   = -0x1
+	RUSAGE_SELF                       = 0x0
+	RUSAGE_THREAD                     = 0x1
+	SCM_RIGHTS                        = 0x1
+	SCM_TIMESTAMP                     = 0x4
+	SHUT_RD                           = 0x0
+	SHUT_RDWR                         = 0x2
+	SHUT_WR                           = 0x1
+	SIOCADDMULTI                      = 0x80206931
+	SIOCAIFADDR                       = 0x8040691a
+	SIOCAIFGROUP                      = 0x80286987
+	SIOCATMARK                        = 0x40047307
+	SIOCBRDGADD                       = 0x8060693c
+	SIOCBRDGADDL                      = 0x80606949
+	SIOCBRDGADDS                      = 0x80606941
+	SIOCBRDGARL                       = 0x808c694d
+	SIOCBRDGDADDR                     = 0x81286947
+	SIOCBRDGDEL                       = 0x8060693d
+	SIOCBRDGDELS                      = 0x80606942
+	SIOCBRDGFLUSH                     = 0x80606948
+	SIOCBRDGFRL                       = 0x808c694e
+	SIOCBRDGGCACHE                    = 0xc0186941
+	SIOCBRDGGFD                       = 0xc0186952
+	SIOCBRDGGHT                       = 0xc0186951
+	SIOCBRDGGIFFLGS                   = 0xc060693e
+	SIOCBRDGGMA                       = 0xc0186953
+	SIOCBRDGGPARAM                    = 0xc0406958
+	SIOCBRDGGPRI                      = 0xc0186950
+	SIOCBRDGGRL                       = 0xc030694f
+	SIOCBRDGGTO                       = 0xc0186946
+	SIOCBRDGIFS                       = 0xc0606942
+	SIOCBRDGRTS                       = 0xc0206943
+	SIOCBRDGSADDR                     = 0xc1286944
+	SIOCBRDGSCACHE                    = 0x80186940
+	SIOCBRDGSFD                       = 0x80186952
+	SIOCBRDGSHT                       = 0x80186951
+	SIOCBRDGSIFCOST                   = 0x80606955
+	SIOCBRDGSIFFLGS                   = 0x8060693f
+	SIOCBRDGSIFPRIO                   = 0x80606954
+	SIOCBRDGSIFPROT                   = 0x8060694a
+	SIOCBRDGSMA                       = 0x80186953
+	SIOCBRDGSPRI                      = 0x80186950
+	SIOCBRDGSPROTO                    = 0x8018695a
+	SIOCBRDGSTO                       = 0x80186945
+	SIOCBRDGSTXHC                     = 0x80186959
+	SIOCDELLABEL                      = 0x80206997
+	SIOCDELMULTI                      = 0x80206932
+	SIOCDIFADDR                       = 0x80206919
+	SIOCDIFGROUP                      = 0x80286989
+	SIOCDIFPARENT                     = 0x802069b4
+	SIOCDIFPHYADDR                    = 0x80206949
+	SIOCDPWE3NEIGHBOR                 = 0x802069de
+	SIOCDVNETID                       = 0x802069af
+	SIOCGETKALIVE                     = 0xc01869a4
+	SIOCGETLABEL                      = 0x8020699a
+	SIOCGETMPWCFG                     = 0xc02069ae
+	SIOCGETPFLOW                      = 0xc02069fe
+	SIOCGETPFSYNC                     = 0xc02069f8
+	SIOCGETSGCNT                      = 0xc0207534
+	SIOCGETVIFCNT                     = 0xc0287533
+	SIOCGETVLAN                       = 0xc0206990
+	SIOCGIFADDR                       = 0xc0206921
+	SIOCGIFBRDADDR                    = 0xc0206923
+	SIOCGIFCONF                       = 0xc0106924
+	SIOCGIFDATA                       = 0xc020691b
+	SIOCGIFDESCR                      = 0xc0206981
+	SIOCGIFDSTADDR                    = 0xc0206922
+	SIOCGIFFLAGS                      = 0xc0206911
+	SIOCGIFGATTR                      = 0xc028698b
+	SIOCGIFGENERIC                    = 0xc020693a
+	SIOCGIFGLIST                      = 0xc028698d
+	SIOCGIFGMEMB                      = 0xc028698a
+	SIOCGIFGROUP                      = 0xc0286988
+	SIOCGIFHARDMTU                    = 0xc02069a5
+	SIOCGIFLLPRIO                     = 0xc02069b6
+	SIOCGIFMEDIA                      = 0xc0406938
+	SIOCGIFMETRIC                     = 0xc0206917
+	SIOCGIFMTU                        = 0xc020697e
+	SIOCGIFNETMASK                    = 0xc0206925
+	SIOCGIFPAIR                       = 0xc02069b1
+	SIOCGIFPARENT                     = 0xc02069b3
+	SIOCGIFPRIORITY                   = 0xc020699c
+	SIOCGIFRDOMAIN                    = 0xc02069a0
+	SIOCGIFRTLABEL                    = 0xc0206983
+	SIOCGIFRXR                        = 0x802069aa
+	SIOCGIFSFFPAGE                    = 0xc1126939
+	SIOCGIFXFLAGS                     = 0xc020699e
+	SIOCGLIFPHYADDR                   = 0xc218694b
+	SIOCGLIFPHYDF                     = 0xc02069c2
+	SIOCGLIFPHYECN                    = 0xc02069c8
+	SIOCGLIFPHYRTABLE                 = 0xc02069a2
+	SIOCGLIFPHYTTL                    = 0xc02069a9
+	SIOCGPGRP                         = 0x40047309
+	SIOCGPWE3                         = 0xc0206998
+	SIOCGPWE3CTRLWORD                 = 0xc02069dc
+	SIOCGPWE3FAT                      = 0xc02069dd
+	SIOCGPWE3NEIGHBOR                 = 0xc21869de
+	SIOCGSPPPPARAMS                   = 0xc0206994
+	SIOCGTXHPRIO                      = 0xc02069c6
+	SIOCGUMBINFO                      = 0xc02069be
+	SIOCGUMBPARAM                     = 0xc02069c0
+	SIOCGVH                           = 0xc02069f6
+	SIOCGVNETFLOWID                   = 0xc02069c4
+	SIOCGVNETID                       = 0xc02069a7
+	SIOCIFAFATTACH                    = 0x801169ab
+	SIOCIFAFDETACH                    = 0x801169ac
+	SIOCIFCREATE                      = 0x8020697a
+	SIOCIFDESTROY                     = 0x80206979
+	SIOCIFGCLONERS                    = 0xc0106978
+	SIOCSETKALIVE                     = 0x801869a3
+	SIOCSETLABEL                      = 0x80206999
+	SIOCSETMPWCFG                     = 0x802069ad
+	SIOCSETPFLOW                      = 0x802069fd
+	SIOCSETPFSYNC                     = 0x802069f7
+	SIOCSETVLAN                       = 0x8020698f
+	SIOCSIFADDR                       = 0x8020690c
+	SIOCSIFBRDADDR                    = 0x80206913
+	SIOCSIFDESCR                      = 0x80206980
+	SIOCSIFDSTADDR                    = 0x8020690e
+	SIOCSIFFLAGS                      = 0x80206910
+	SIOCSIFGATTR                      = 0x8028698c
+	SIOCSIFGENERIC                    = 0x80206939
+	SIOCSIFLLADDR                     = 0x8020691f
+	SIOCSIFLLPRIO                     = 0x802069b5
+	SIOCSIFMEDIA                      = 0xc0206937
+	SIOCSIFMETRIC                     = 0x80206918
+	SIOCSIFMTU                        = 0x8020697f
+	SIOCSIFNETMASK                    = 0x80206916
+	SIOCSIFPAIR                       = 0x802069b0
+	SIOCSIFPARENT                     = 0x802069b2
+	SIOCSIFPRIORITY                   = 0x8020699b
+	SIOCSIFRDOMAIN                    = 0x8020699f
+	SIOCSIFRTLABEL                    = 0x80206982
+	SIOCSIFXFLAGS                     = 0x8020699d
+	SIOCSLIFPHYADDR                   = 0x8218694a
+	SIOCSLIFPHYDF                     = 0x802069c1
+	SIOCSLIFPHYECN                    = 0x802069c7
+	SIOCSLIFPHYRTABLE                 = 0x802069a1
+	SIOCSLIFPHYTTL                    = 0x802069a8
+	SIOCSPGRP                         = 0x80047308
+	SIOCSPWE3CTRLWORD                 = 0x802069dc
+	SIOCSPWE3FAT                      = 0x802069dd
+	SIOCSPWE3NEIGHBOR                 = 0x821869de
+	SIOCSSPPPPARAMS                   = 0x80206993
+	SIOCSTXHPRIO                      = 0x802069c5
+	SIOCSUMBPARAM                     = 0x802069bf
+	SIOCSVH                           = 0xc02069f5
+	SIOCSVNETFLOWID                   = 0x802069c3
+	SIOCSVNETID                       = 0x802069a6
+	SIOCSWGDPID                       = 0xc018695b
+	SIOCSWGMAXFLOW                    = 0xc0186960
+	SIOCSWGMAXGROUP                   = 0xc018695d
+	SIOCSWSDPID                       = 0x8018695c
+	SIOCSWSPORTNO                     = 0xc060695f
+	SOCK_CLOEXEC                      = 0x8000
+	SOCK_DGRAM                        = 0x2
+	SOCK_DNS                          = 0x1000
+	SOCK_NONBLOCK                     = 0x4000
+	SOCK_RAW                          = 0x3
+	SOCK_RDM                          = 0x4
+	SOCK_SEQPACKET                    = 0x5
+	SOCK_STREAM                       = 0x1
+	SOL_SOCKET                        = 0xffff
+	SOMAXCONN                         = 0x80
+	SO_ACCEPTCONN                     = 0x2
+	SO_BINDANY                        = 0x1000
+	SO_BROADCAST                      = 0x20
+	SO_DEBUG                          = 0x1
+	SO_DONTROUTE                      = 0x10
+	SO_ERROR                          = 0x1007
+	SO_KEEPALIVE                      = 0x8
+	SO_LINGER                         = 0x80
+	SO_NETPROC                        = 0x1020
+	SO_OOBINLINE                      = 0x100
+	SO_PEERCRED                       = 0x1022
+	SO_RCVBUF                         = 0x1002
+	SO_RCVLOWAT                       = 0x1004
+	SO_RCVTIMEO                       = 0x1006
+	SO_REUSEADDR                      = 0x4
+	SO_REUSEPORT                      = 0x200
+	SO_RTABLE                         = 0x1021
+	SO_SNDBUF                         = 0x1001
+	SO_SNDLOWAT                       = 0x1003
+	SO_SNDTIMEO                       = 0x1005
+	SO_SPLICE                         = 0x1023
+	SO_TIMESTAMP                      = 0x800
+	SO_TYPE                           = 0x1008
+	SO_USELOOPBACK                    = 0x40
+	SO_ZEROIZE                        = 0x2000
+	S_BLKSIZE                         = 0x200
+	S_IEXEC                           = 0x40
+	S_IFBLK                           = 0x6000
+	S_IFCHR                           = 0x2000
+	S_IFDIR                           = 0x4000
+	S_IFIFO                           = 0x1000
+	S_IFLNK                           = 0xa000
+	S_IFMT                            = 0xf000
+	S_IFREG                           = 0x8000
+	S_IFSOCK                          = 0xc000
+	S_IREAD                           = 0x100
+	S_IRGRP                           = 0x20
+	S_IROTH                           = 0x4
+	S_IRUSR                           = 0x100
+	S_IRWXG                           = 0x38
+	S_IRWXO                           = 0x7
+	S_IRWXU                           = 0x1c0
+	S_ISGID                           = 0x400
+	S_ISTXT                           = 0x200
+	S_ISUID                           = 0x800
+	S_ISVTX                           = 0x200
+	S_IWGRP                           = 0x10
+	S_IWOTH                           = 0x2
+	S_IWRITE                          = 0x80
+	S_IWUSR                           = 0x80
+	S_IXGRP                           = 0x8
+	S_IXOTH                           = 0x1
+	S_IXUSR                           = 0x40
+	TCIFLUSH                          = 0x1
+	TCIOFF                            = 0x3
+	TCIOFLUSH                         = 0x3
+	TCION                             = 0x4
+	TCOFLUSH                          = 0x2
+	TCOOFF                            = 0x1
+	TCOON                             = 0x2
+	TCP_MAXBURST                      = 0x4
+	TCP_MAXSEG                        = 0x2
+	TCP_MAXWIN                        = 0xffff
+	TCP_MAX_SACK                      = 0x3
+	TCP_MAX_WINSHIFT                  = 0xe
+	TCP_MD5SIG                        = 0x4
+	TCP_MSS                           = 0x200
+	TCP_NODELAY                       = 0x1
+	TCP_NOPUSH                        = 0x10
+	TCP_SACK_ENABLE                   = 0x8
+	TCSAFLUSH                         = 0x2
+	TIMER_ABSTIME                     = 0x1
+	TIMER_RELTIME                     = 0x0
+	TIOCCBRK                          = 0x2000747a
+	TIOCCDTR                          = 0x20007478
+	TIOCCHKVERAUTH                    = 0x2000741e
+	TIOCCLRVERAUTH                    = 0x2000741d
+	TIOCCONS                          = 0x80047462
+	TIOCDRAIN                         = 0x2000745e
+	TIOCEXCL                          = 0x2000740d
+	TIOCEXT                           = 0x80047460
+	TIOCFLAG_CLOCAL                   = 0x2
+	TIOCFLAG_CRTSCTS                  = 0x4
+	TIOCFLAG_MDMBUF                   = 0x8
+	TIOCFLAG_PPS                      = 0x10
+	TIOCFLAG_SOFTCAR                  = 0x1
+	TIOCFLUSH                         = 0x80047410
+	TIOCGETA                          = 0x402c7413
+	TIOCGETD                          = 0x4004741a
+	TIOCGFLAGS                        = 0x4004745d
+	TIOCGPGRP                         = 0x40047477
+	TIOCGSID                          = 0x40047463
+	TIOCGTSTAMP                       = 0x4010745b
+	TIOCGWINSZ                        = 0x40087468
+	TIOCMBIC                          = 0x8004746b
+	TIOCMBIS                          = 0x8004746c
+	TIOCMGET                          = 0x4004746a
+	TIOCMODG                          = 0x4004746a
+	TIOCMODS                          = 0x8004746d
+	TIOCMSET                          = 0x8004746d
+	TIOCM_CAR                         = 0x40
+	TIOCM_CD                          = 0x40
+	TIOCM_CTS                         = 0x20
+	TIOCM_DSR                         = 0x100
+	TIOCM_DTR                         = 0x2
+	TIOCM_LE                          = 0x1
+	TIOCM_RI                          = 0x80
+	TIOCM_RNG                         = 0x80
+	TIOCM_RTS                         = 0x4
+	TIOCM_SR                          = 0x10
+	TIOCM_ST                          = 0x8
+	TIOCNOTTY                         = 0x20007471
+	TIOCNXCL                          = 0x2000740e
+	TIOCOUTQ                          = 0x40047473
+	TIOCPKT                           = 0x80047470
+	TIOCPKT_DATA                      = 0x0
+	TIOCPKT_DOSTOP                    = 0x20
+	TIOCPKT_FLUSHREAD                 = 0x1
+	TIOCPKT_FLUSHWRITE                = 0x2
+	TIOCPKT_IOCTL                     = 0x40
+	TIOCPKT_NOSTOP                    = 0x10
+	TIOCPKT_START                     = 0x8
+	TIOCPKT_STOP                      = 0x4
+	TIOCREMOTE                        = 0x80047469
+	TIOCSBRK                          = 0x2000747b
+	TIOCSCTTY                         = 0x20007461
+	TIOCSDTR                          = 0x20007479
+	TIOCSETA                          = 0x802c7414
+	TIOCSETAF                         = 0x802c7416
+	TIOCSETAW                         = 0x802c7415
+	TIOCSETD                          = 0x8004741b
+	TIOCSETVERAUTH                    = 0x8004741c
+	TIOCSFLAGS                        = 0x8004745c
+	TIOCSIG                           = 0x8004745f
+	TIOCSPGRP                         = 0x80047476
+	TIOCSTART                         = 0x2000746e
+	TIOCSTAT                          = 0x20007465
+	TIOCSTOP                          = 0x2000746f
+	TIOCSTSTAMP                       = 0x8008745a
+	TIOCSWINSZ                        = 0x80087467
+	TIOCUCNTL                         = 0x80047466
+	TIOCUCNTL_CBRK                    = 0x7a
+	TIOCUCNTL_SBRK                    = 0x7b
+	TOSTOP                            = 0x400000
+	UTIME_NOW                         = -0x2
+	UTIME_OMIT                        = -0x1
+	VDISCARD                          = 0xf
+	VDSUSP                            = 0xb
+	VEOF                              = 0x0
+	VEOL                              = 0x1
+	VEOL2                             = 0x2
+	VERASE                            = 0x3
+	VINTR                             = 0x8
+	VKILL                             = 0x5
+	VLNEXT                            = 0xe
+	VMIN                              = 0x10
+	VM_ANONMIN                        = 0x7
+	VM_LOADAVG                        = 0x2
+	VM_MALLOC_CONF                    = 0xc
+	VM_MAXID                          = 0xd
+	VM_MAXSLP                         = 0xa
+	VM_METER                          = 0x1
+	VM_NKMEMPAGES                     = 0x6
+	VM_PSSTRINGS                      = 0x3
+	VM_SWAPENCRYPT                    = 0x5
+	VM_USPACE                         = 0xb
+	VM_UVMEXP                         = 0x4
+	VM_VNODEMIN                       = 0x9
+	VM_VTEXTMIN                       = 0x8
+	VQUIT                             = 0x9
+	VREPRINT                          = 0x6
+	VSTART                            = 0xc
+	VSTATUS                           = 0x12
+	VSTOP                             = 0xd
+	VSUSP                             = 0xa
+	VTIME                             = 0x11
+	VWERASE                           = 0x4
+	WALTSIG                           = 0x4
+	WCONTINUED                        = 0x8
+	WCOREFLAG                         = 0x80
+	WNOHANG                           = 0x1
+	WUNTRACED                         = 0x2
+	XCASE                             = 0x1000000
+)
+
+// Errors
+const (
+	E2BIG           = syscall.Errno(0x7)
+	EACCES          = syscall.Errno(0xd)
+	EADDRINUSE      = syscall.Errno(0x30)
+	EADDRNOTAVAIL   = syscall.Errno(0x31)
+	EAFNOSUPPORT    = syscall.Errno(0x2f)
+	EAGAIN          = syscall.Errno(0x23)
+	EALREADY        = syscall.Errno(0x25)
+	EAUTH           = syscall.Errno(0x50)
+	EBADF           = syscall.Errno(0x9)
+	EBADMSG         = syscall.Errno(0x5c)
+	EBADRPC         = syscall.Errno(0x48)
+	EBUSY           = syscall.Errno(0x10)
+	ECANCELED       = syscall.Errno(0x58)
+	ECHILD          = syscall.Errno(0xa)
+	ECONNABORTED    = syscall.Errno(0x35)
+	ECONNREFUSED    = syscall.Errno(0x3d)
+	ECONNRESET      = syscall.Errno(0x36)
+	EDEADLK         = syscall.Errno(0xb)
+	EDESTADDRREQ    = syscall.Errno(0x27)
+	EDOM            = syscall.Errno(0x21)
+	EDQUOT          = syscall.Errno(0x45)
+	EEXIST          = syscall.Errno(0x11)
+	EFAULT          = syscall.Errno(0xe)
+	EFBIG           = syscall.Errno(0x1b)
+	EFTYPE          = syscall.Errno(0x4f)
+	EHOSTDOWN       = syscall.Errno(0x40)
+	EHOSTUNREACH    = syscall.Errno(0x41)
+	EIDRM           = syscall.Errno(0x59)
+	EILSEQ          = syscall.Errno(0x54)
+	EINPROGRESS     = syscall.Errno(0x24)
+	EINTR           = syscall.Errno(0x4)
+	EINVAL          = syscall.Errno(0x16)
+	EIO             = syscall.Errno(0x5)
+	EIPSEC          = syscall.Errno(0x52)
+	EISCONN         = syscall.Errno(0x38)
+	EISDIR          = syscall.Errno(0x15)
+	ELAST           = syscall.Errno(0x5f)
+	ELOOP           = syscall.Errno(0x3e)
+	EMEDIUMTYPE     = syscall.Errno(0x56)
+	EMFILE          = syscall.Errno(0x18)
+	EMLINK          = syscall.Errno(0x1f)
+	EMSGSIZE        = syscall.Errno(0x28)
+	ENAMETOOLONG    = syscall.Errno(0x3f)
+	ENEEDAUTH       = syscall.Errno(0x51)
+	ENETDOWN        = syscall.Errno(0x32)
+	ENETRESET       = syscall.Errno(0x34)
+	ENETUNREACH     = syscall.Errno(0x33)
+	ENFILE          = syscall.Errno(0x17)
+	ENOATTR         = syscall.Errno(0x53)
+	ENOBUFS         = syscall.Errno(0x37)
+	ENODEV          = syscall.Errno(0x13)
+	ENOENT          = syscall.Errno(0x2)
+	ENOEXEC         = syscall.Errno(0x8)
+	ENOLCK          = syscall.Errno(0x4d)
+	ENOMEDIUM       = syscall.Errno(0x55)
+	ENOMEM          = syscall.Errno(0xc)
+	ENOMSG          = syscall.Errno(0x5a)
+	ENOPROTOOPT     = syscall.Errno(0x2a)
+	ENOSPC          = syscall.Errno(0x1c)
+	ENOSYS          = syscall.Errno(0x4e)
+	ENOTBLK         = syscall.Errno(0xf)
+	ENOTCONN        = syscall.Errno(0x39)
+	ENOTDIR         = syscall.Errno(0x14)
+	ENOTEMPTY       = syscall.Errno(0x42)
+	ENOTRECOVERABLE = syscall.Errno(0x5d)
+	ENOTSOCK        = syscall.Errno(0x26)
+	ENOTSUP         = syscall.Errno(0x5b)
+	ENOTTY          = syscall.Errno(0x19)
+	ENXIO           = syscall.Errno(0x6)
+	EOPNOTSUPP      = syscall.Errno(0x2d)
+	EOVERFLOW       = syscall.Errno(0x57)
+	EOWNERDEAD      = syscall.Errno(0x5e)
+	EPERM           = syscall.Errno(0x1)
+	EPFNOSUPPORT    = syscall.Errno(0x2e)
+	EPIPE           = syscall.Errno(0x20)
+	EPROCLIM        = syscall.Errno(0x43)
+	EPROCUNAVAIL    = syscall.Errno(0x4c)
+	EPROGMISMATCH   = syscall.Errno(0x4b)
+	EPROGUNAVAIL    = syscall.Errno(0x4a)
+	EPROTO          = syscall.Errno(0x5f)
+	EPROTONOSUPPORT = syscall.Errno(0x2b)
+	EPROTOTYPE      = syscall.Errno(0x29)
+	ERANGE          = syscall.Errno(0x22)
+	EREMOTE         = syscall.Errno(0x47)
+	EROFS           = syscall.Errno(0x1e)
+	ERPCMISMATCH    = syscall.Errno(0x49)
+	ESHUTDOWN       = syscall.Errno(0x3a)
+	ESOCKTNOSUPPORT = syscall.Errno(0x2c)
+	ESPIPE          = syscall.Errno(0x1d)
+	ESRCH           = syscall.Errno(0x3)
+	ESTALE          = syscall.Errno(0x46)
+	ETIMEDOUT       = syscall.Errno(0x3c)
+	ETOOMANYREFS    = syscall.Errno(0x3b)
+	ETXTBSY         = syscall.Errno(0x1a)
+	EUSERS          = syscall.Errno(0x44)
+	EWOULDBLOCK     = syscall.Errno(0x23)
+	EXDEV           = syscall.Errno(0x12)
+)
+
+// Signals
+const (
+	SIGABRT   = syscall.Signal(0x6)
+	SIGALRM   = syscall.Signal(0xe)
+	SIGBUS    = syscall.Signal(0xa)
+	SIGCHLD   = syscall.Signal(0x14)
+	SIGCONT   = syscall.Signal(0x13)
+	SIGEMT    = syscall.Signal(0x7)
+	SIGFPE    = syscall.Signal(0x8)
+	SIGHUP    = syscall.Signal(0x1)
+	SIGILL    = syscall.Signal(0x4)
+	SIGINFO   = syscall.Signal(0x1d)
+	SIGINT    = syscall.Signal(0x2)
+	SIGIO     = syscall.Signal(0x17)
+	SIGIOT    = syscall.Signal(0x6)
+	SIGKILL   = syscall.Signal(0x9)
+	SIGPIPE   = syscall.Signal(0xd)
+	SIGPROF   = syscall.Signal(0x1b)
+	SIGQUIT   = syscall.Signal(0x3)
+	SIGSEGV   = syscall.Signal(0xb)
+	SIGSTOP   = syscall.Signal(0x11)
+	SIGSYS    = syscall.Signal(0xc)
+	SIGTERM   = syscall.Signal(0xf)
+	SIGTHR    = syscall.Signal(0x20)
+	SIGTRAP   = syscall.Signal(0x5)
+	SIGTSTP   = syscall.Signal(0x12)
+	SIGTTIN   = syscall.Signal(0x15)
+	SIGTTOU   = syscall.Signal(0x16)
+	SIGURG    = syscall.Signal(0x10)
+	SIGUSR1   = syscall.Signal(0x1e)
+	SIGUSR2   = syscall.Signal(0x1f)
+	SIGVTALRM = syscall.Signal(0x1a)
+	SIGWINCH  = syscall.Signal(0x1c)
+	SIGXCPU   = syscall.Signal(0x18)
+	SIGXFSZ   = syscall.Signal(0x19)
+)
+
+// Error table
+var errorList = [...]struct {
+	num  syscall.Errno
+	name string
+	desc string
+}{
+	{1, "EPERM", "operation not permitted"},
+	{2, "ENOENT", "no such file or directory"},
+	{3, "ESRCH", "no such process"},
+	{4, "EINTR", "interrupted system call"},
+	{5, "EIO", "input/output error"},
+	{6, "ENXIO", "device not configured"},
+	{7, "E2BIG", "argument list too long"},
+	{8, "ENOEXEC", "exec format error"},
+	{9, "EBADF", "bad file descriptor"},
+	{10, "ECHILD", "no child processes"},
+	{11, "EDEADLK", "resource deadlock avoided"},
+	{12, "ENOMEM", "cannot allocate memory"},
+	{13, "EACCES", "permission denied"},
+	{14, "EFAULT", "bad address"},
+	{15, "ENOTBLK", "block device required"},
+	{16, "EBUSY", "device busy"},
+	{17, "EEXIST", "file exists"},
+	{18, "EXDEV", "cross-device link"},
+	{19, "ENODEV", "operation not supported by device"},
+	{20, "ENOTDIR", "not a directory"},
+	{21, "EISDIR", "is a directory"},
+	{22, "EINVAL", "invalid argument"},
+	{23, "ENFILE", "too many open files in system"},
+	{24, "EMFILE", "too many open files"},
+	{25, "ENOTTY", "inappropriate ioctl for device"},
+	{26, "ETXTBSY", "text file busy"},
+	{27, "EFBIG", "file too large"},
+	{28, "ENOSPC", "no space left on device"},
+	{29, "ESPIPE", "illegal seek"},
+	{30, "EROFS", "read-only file system"},
+	{31, "EMLINK", "too many links"},
+	{32, "EPIPE", "broken pipe"},
+	{33, "EDOM", "numerical argument out of domain"},
+	{34, "ERANGE", "result too large"},
+	{35, "EAGAIN", "resource temporarily unavailable"},
+	{36, "EINPROGRESS", "operation now in progress"},
+	{37, "EALREADY", "operation already in progress"},
+	{38, "ENOTSOCK", "socket operation on non-socket"},
+	{39, "EDESTADDRREQ", "destination address required"},
+	{40, "EMSGSIZE", "message too long"},
+	{41, "EPROTOTYPE", "protocol wrong type for socket"},
+	{42, "ENOPROTOOPT", "protocol not available"},
+	{43, "EPROTONOSUPPORT", "protocol not supported"},
+	{44, "ESOCKTNOSUPPORT", "socket type not supported"},
+	{45, "EOPNOTSUPP", "operation not supported"},
+	{46, "EPFNOSUPPORT", "protocol family not supported"},
+	{47, "EAFNOSUPPORT", "address family not supported by protocol family"},
+	{48, "EADDRINUSE", "address already in use"},
+	{49, "EADDRNOTAVAIL", "can't assign requested address"},
+	{50, "ENETDOWN", "network is down"},
+	{51, "ENETUNREACH", "network is unreachable"},
+	{52, "ENETRESET", "network dropped connection on reset"},
+	{53, "ECONNABORTED", "software caused connection abort"},
+	{54, "ECONNRESET", "connection reset by peer"},
+	{55, "ENOBUFS", "no buffer space available"},
+	{56, "EISCONN", "socket is already connected"},
+	{57, "ENOTCONN", "socket is not connected"},
+	{58, "ESHUTDOWN", "can't send after socket shutdown"},
+	{59, "ETOOMANYREFS", "too many references: can't splice"},
+	{60, "ETIMEDOUT", "operation timed out"},
+	{61, "ECONNREFUSED", "connection refused"},
+	{62, "ELOOP", "too many levels of symbolic links"},
+	{63, "ENAMETOOLONG", "file name too long"},
+	{64, "EHOSTDOWN", "host is down"},
+	{65, "EHOSTUNREACH", "no route to host"},
+	{66, "ENOTEMPTY", "directory not empty"},
+	{67, "EPROCLIM", "too many processes"},
+	{68, "EUSERS", "too many users"},
+	{69, "EDQUOT", "disk quota exceeded"},
+	{70, "ESTALE", "stale NFS file handle"},
+	{71, "EREMOTE", "too many levels of remote in path"},
+	{72, "EBADRPC", "RPC struct is bad"},
+	{73, "ERPCMISMATCH", "RPC version wrong"},
+	{74, "EPROGUNAVAIL", "RPC program not available"},
+	{75, "EPROGMISMATCH", "program version wrong"},
+	{76, "EPROCUNAVAIL", "bad procedure for program"},
+	{77, "ENOLCK", "no locks available"},
+	{78, "ENOSYS", "function not implemented"},
+	{79, "EFTYPE", "inappropriate file type or format"},
+	{80, "EAUTH", "authentication error"},
+	{81, "ENEEDAUTH", "need authenticator"},
+	{82, "EIPSEC", "IPsec processing failure"},
+	{83, "ENOATTR", "attribute not found"},
+	{84, "EILSEQ", "illegal byte sequence"},
+	{85, "ENOMEDIUM", "no medium found"},
+	{86, "EMEDIUMTYPE", "wrong medium type"},
+	{87, "EOVERFLOW", "value too large to be stored in data type"},
+	{88, "ECANCELED", "operation canceled"},
+	{89, "EIDRM", "identifier removed"},
+	{90, "ENOMSG", "no message of desired type"},
+	{91, "ENOTSUP", "not supported"},
+	{92, "EBADMSG", "bad message"},
+	{93, "ENOTRECOVERABLE", "state not recoverable"},
+	{94, "EOWNERDEAD", "previous owner died"},
+	{95, "ELAST", "protocol error"},
+}
+
+// Signal table
+var signalList = [...]struct {
+	num  syscall.Signal
+	name string
+	desc string
+}{
+	{1, "SIGHUP", "hangup"},
+	{2, "SIGINT", "interrupt"},
+	{3, "SIGQUIT", "quit"},
+	{4, "SIGILL", "illegal instruction"},
+	{5, "SIGTRAP", "trace/BPT trap"},
+	{6, "SIGABRT", "abort trap"},
+	{7, "SIGEMT", "EMT trap"},
+	{8, "SIGFPE", "floating point exception"},
+	{9, "SIGKILL", "killed"},
+	{10, "SIGBUS", "bus error"},
+	{11, "SIGSEGV", "segmentation fault"},
+	{12, "SIGSYS", "bad system call"},
+	{13, "SIGPIPE", "broken pipe"},
+	{14, "SIGALRM", "alarm clock"},
+	{15, "SIGTERM", "terminated"},
+	{16, "SIGURG", "urgent I/O condition"},
+	{17, "SIGSTOP", "suspended (signal)"},
+	{18, "SIGTSTP", "suspended"},
+	{19, "SIGCONT", "continued"},
+	{20, "SIGCHLD", "child exited"},
+	{21, "SIGTTIN", "stopped (tty input)"},
+	{22, "SIGTTOU", "stopped (tty output)"},
+	{23, "SIGIO", "I/O possible"},
+	{24, "SIGXCPU", "cputime limit exceeded"},
+	{25, "SIGXFSZ", "filesize limit exceeded"},
+	{26, "SIGVTALRM", "virtual timer expired"},
+	{27, "SIGPROF", "profiling timer expired"},
+	{28, "SIGWINCH", "window size changes"},
+	{29, "SIGINFO", "information request"},
+	{30, "SIGUSR1", "user defined signal 1"},
+	{31, "SIGUSR2", "user defined signal 2"},
+	{32, "SIGTHR", "thread AST"},
+}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go
index 79f6e05..ed657ff 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go
@@ -83,6 +83,8 @@ int lstat(uintptr_t, uintptr_t);
 int pause();
 int pread64(int, uintptr_t, size_t, long long);
 int pwrite64(int, uintptr_t, size_t, long long);
+#define c_select select
+int select(int, uintptr_t, uintptr_t, uintptr_t, uintptr_t);
 int pselect(int, uintptr_t, uintptr_t, uintptr_t, uintptr_t, uintptr_t);
 int setregid(int, int);
 int setreuid(int, int);
@@ -103,8 +105,8 @@ int getpeername(int, uintptr_t, uintptr_t);
 int getsockname(int, uintptr_t, uintptr_t);
 int recvfrom(int, uintptr_t, size_t, int, uintptr_t, uintptr_t);
 int sendto(int, uintptr_t, size_t, int, uintptr_t, uintptr_t);
-int recvmsg(int, uintptr_t, int);
-int sendmsg(int, uintptr_t, int);
+int nrecvmsg(int, uintptr_t, int);
+int nsendmsg(int, uintptr_t, int);
 int munmap(uintptr_t, uintptr_t);
 int madvise(uintptr_t, size_t, int);
 int mprotect(uintptr_t, size_t, int);
@@ -118,6 +120,8 @@ int poll(uintptr_t, int, int);
 int gettimeofday(uintptr_t, uintptr_t);
 int time(uintptr_t);
 int utime(uintptr_t, uintptr_t);
+unsigned long long getsystemcfg(int);
+int umount(uintptr_t);
 int getrlimit64(int, uintptr_t);
 int setrlimit64(int, uintptr_t);
 long long lseek64(int, long long, int);
@@ -855,7 +859,7 @@ func Fchown(fd int, uid int, gid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Fstat(fd int, stat *Stat_t) (err error) {
+func fstat(fd int, stat *Stat_t) (err error) {
 	r0, er := C.fstat(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(stat))))
 	if r0 == -1 && er != nil {
 		err = er
@@ -865,7 +869,7 @@ func Fstat(fd int, stat *Stat_t) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) {
+func fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) {
 	_p0 := uintptr(unsafe.Pointer(C.CString(path)))
 	r0, er := C.fstatat(C.int(dirfd), C.uintptr_t(_p0), C.uintptr_t(uintptr(unsafe.Pointer(stat))), C.int(flags))
 	if r0 == -1 && er != nil {
@@ -949,7 +953,7 @@ func Listen(s int, n int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Lstat(path string, stat *Stat_t) (err error) {
+func lstat(path string, stat *Stat_t) (err error) {
 	_p0 := uintptr(unsafe.Pointer(C.CString(path)))
 	r0, er := C.lstat(C.uintptr_t(_p0), C.uintptr_t(uintptr(unsafe.Pointer(stat))))
 	if r0 == -1 && er != nil {
@@ -1004,6 +1008,17 @@ func Pwrite(fd int, p []byte, offset int64) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) {
+	r0, er := C.c_select(C.int(nfd), C.uintptr_t(uintptr(unsafe.Pointer(r))), C.uintptr_t(uintptr(unsafe.Pointer(w))), C.uintptr_t(uintptr(unsafe.Pointer(e))), C.uintptr_t(uintptr(unsafe.Pointer(timeout))))
+	n = int(r0)
+	if r0 == -1 && er != nil {
+		err = er
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, er := C.pselect(C.int(nfd), C.uintptr_t(uintptr(unsafe.Pointer(r))), C.uintptr_t(uintptr(unsafe.Pointer(w))), C.uintptr_t(uintptr(unsafe.Pointer(e))), C.uintptr_t(uintptr(unsafe.Pointer(timeout))), C.uintptr_t(uintptr(unsafe.Pointer(sigmask))))
 	n = int(r0)
@@ -1056,9 +1071,9 @@ func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n i
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Stat(path string, stat *Stat_t) (err error) {
+func stat(path string, statptr *Stat_t) (err error) {
 	_p0 := uintptr(unsafe.Pointer(C.CString(path)))
-	r0, er := C.stat(C.uintptr_t(_p0), C.uintptr_t(uintptr(unsafe.Pointer(stat))))
+	r0, er := C.stat(C.uintptr_t(_p0), C.uintptr_t(uintptr(unsafe.Pointer(statptr))))
 	if r0 == -1 && er != nil {
 		err = er
 	}
@@ -1225,7 +1240,7 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
 func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) {
-	r0, er := C.recvmsg(C.int(s), C.uintptr_t(uintptr(unsafe.Pointer(msg))), C.int(flags))
+	r0, er := C.nrecvmsg(C.int(s), C.uintptr_t(uintptr(unsafe.Pointer(msg))), C.int(flags))
 	n = int(r0)
 	if r0 == -1 && er != nil {
 		err = er
@@ -1236,7 +1251,7 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) {
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
 func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) {
-	r0, er := C.sendmsg(C.int(s), C.uintptr_t(uintptr(unsafe.Pointer(msg))), C.int(flags))
+	r0, er := C.nsendmsg(C.int(s), C.uintptr_t(uintptr(unsafe.Pointer(msg))), C.int(flags))
 	n = int(r0)
 	if r0 == -1 && er != nil {
 		err = er
@@ -1409,6 +1424,25 @@ func Utime(path string, buf *Utimbuf) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Getsystemcfg(label int) (n uint64) {
+	r0, _ := C.getsystemcfg(C.int(label))
+	n = uint64(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func umount(target string) (err error) {
+	_p0 := uintptr(unsafe.Pointer(C.CString(target)))
+	r0, er := C.umount(C.uintptr_t(_p0))
+	if r0 == -1 && er != nil {
+		err = er
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Getrlimit(resource int, rlim *Rlimit) (err error) {
 	r0, er := C.getrlimit64(C.int(resource), C.uintptr_t(uintptr(unsafe.Pointer(rlim))))
 	if r0 == -1 && er != nil {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go
index 52802bf..664b293 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go
@@ -803,7 +803,7 @@ func Fchown(fd int, uid int, gid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Fstat(fd int, stat *Stat_t) (err error) {
+func fstat(fd int, stat *Stat_t) (err error) {
 	_, e1 := callfstat(fd, uintptr(unsafe.Pointer(stat)))
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -813,7 +813,7 @@ func Fstat(fd int, stat *Stat_t) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) {
+func fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
 	if err != nil {
@@ -905,7 +905,7 @@ func Listen(s int, n int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Lstat(path string, stat *Stat_t) (err error) {
+func lstat(path string, stat *Stat_t) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
 	if err != nil {
@@ -960,6 +960,17 @@ func Pwrite(fd int, p []byte, offset int64) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) {
+	r0, e1 := callselect(nfd, uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, e1 := callpselect(nfd, uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)))
 	n = int(r0)
@@ -1012,13 +1023,13 @@ func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n i
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Stat(path string, stat *Stat_t) (err error) {
+func stat(path string, statptr *Stat_t) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
 	if err != nil {
 		return
 	}
-	_, e1 := callstat(uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)))
+	_, e1 := callstat(uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(statptr)))
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
@@ -1189,7 +1200,7 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
 func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) {
-	r0, e1 := callrecvmsg(s, uintptr(unsafe.Pointer(msg)), flags)
+	r0, e1 := callnrecvmsg(s, uintptr(unsafe.Pointer(msg)), flags)
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -1200,7 +1211,7 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) {
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
 func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) {
-	r0, e1 := callsendmsg(s, uintptr(unsafe.Pointer(msg)), flags)
+	r0, e1 := callnsendmsg(s, uintptr(unsafe.Pointer(msg)), flags)
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -1375,6 +1386,21 @@ func Getsystemcfg(label int) (n uint64) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func umount(target string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(target)
+	if err != nil {
+		return
+	}
+	_, e1 := callumount(uintptr(unsafe.Pointer(_p0)))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Getrlimit(resource int, rlim *Rlimit) (err error) {
 	_, e1 := callgetrlimit(resource, uintptr(unsafe.Pointer(rlim)))
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go
index a2b24e4..4b3a8ad 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go
@@ -85,6 +85,7 @@ import (
 //go:cgo_import_dynamic libc_pause pause "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_pread64 pread64 "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_pwrite64 pwrite64 "libc.a/shr_64.o"
+//go:cgo_import_dynamic libc_select select "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_pselect pselect "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_setregid setregid "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_setreuid setreuid "libc.a/shr_64.o"
@@ -105,8 +106,8 @@ import (
 //go:cgo_import_dynamic libc_getsockname getsockname "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_recvfrom recvfrom "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_sendto sendto "libc.a/shr_64.o"
-//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.a/shr_64.o"
-//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.a/shr_64.o"
+//go:cgo_import_dynamic libc_nrecvmsg nrecvmsg "libc.a/shr_64.o"
+//go:cgo_import_dynamic libc_nsendmsg nsendmsg "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_munmap munmap "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_madvise madvise "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_mprotect mprotect "libc.a/shr_64.o"
@@ -121,6 +122,7 @@ import (
 //go:cgo_import_dynamic libc_time time "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_utime utime "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_getsystemcfg getsystemcfg "libc.a/shr_64.o"
+//go:cgo_import_dynamic libc_umount umount "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_setrlimit setrlimit "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_lseek lseek "libc.a/shr_64.o"
@@ -201,6 +203,7 @@ import (
 //go:linkname libc_pause libc_pause
 //go:linkname libc_pread64 libc_pread64
 //go:linkname libc_pwrite64 libc_pwrite64
+//go:linkname libc_select libc_select
 //go:linkname libc_pselect libc_pselect
 //go:linkname libc_setregid libc_setregid
 //go:linkname libc_setreuid libc_setreuid
@@ -221,8 +224,8 @@ import (
 //go:linkname libc_getsockname libc_getsockname
 //go:linkname libc_recvfrom libc_recvfrom
 //go:linkname libc_sendto libc_sendto
-//go:linkname libc_recvmsg libc_recvmsg
-//go:linkname libc_sendmsg libc_sendmsg
+//go:linkname libc_nrecvmsg libc_nrecvmsg
+//go:linkname libc_nsendmsg libc_nsendmsg
 //go:linkname libc_munmap libc_munmap
 //go:linkname libc_madvise libc_madvise
 //go:linkname libc_mprotect libc_mprotect
@@ -237,6 +240,7 @@ import (
 //go:linkname libc_time libc_time
 //go:linkname libc_utime libc_utime
 //go:linkname libc_getsystemcfg libc_getsystemcfg
+//go:linkname libc_umount libc_umount
 //go:linkname libc_getrlimit libc_getrlimit
 //go:linkname libc_setrlimit libc_setrlimit
 //go:linkname libc_lseek libc_lseek
@@ -320,6 +324,7 @@ var (
 	libc_pause,
 	libc_pread64,
 	libc_pwrite64,
+	libc_select,
 	libc_pselect,
 	libc_setregid,
 	libc_setreuid,
@@ -340,8 +345,8 @@ var (
 	libc_getsockname,
 	libc_recvfrom,
 	libc_sendto,
-	libc_recvmsg,
-	libc_sendmsg,
+	libc_nrecvmsg,
+	libc_nsendmsg,
 	libc_munmap,
 	libc_madvise,
 	libc_mprotect,
@@ -356,6 +361,7 @@ var (
 	libc_time,
 	libc_utime,
 	libc_getsystemcfg,
+	libc_umount,
 	libc_getrlimit,
 	libc_setrlimit,
 	libc_lseek,
@@ -893,6 +899,13 @@ func callpwrite64(fd int, _p0 uintptr, _lenp0 int, offset int64) (r1 uintptr, e1
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func callselect(nfd int, r uintptr, w uintptr, e uintptr, timeout uintptr) (r1 uintptr, e1 Errno) {
+	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_select)), 5, uintptr(nfd), r, w, e, timeout, 0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func callpselect(nfd int, r uintptr, w uintptr, e uintptr, timeout uintptr, sigmask uintptr) (r1 uintptr, e1 Errno) {
 	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_pselect)), 6, uintptr(nfd), r, w, e, timeout, sigmask)
 	return
@@ -928,8 +941,8 @@ func callsplice(rfd int, roff uintptr, wfd int, woff uintptr, len int, flags int
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callstat(_p0 uintptr, stat uintptr) (r1 uintptr, e1 Errno) {
-	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_stat)), 2, _p0, stat, 0, 0, 0, 0)
+func callstat(_p0 uintptr, statptr uintptr) (r1 uintptr, e1 Errno) {
+	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_stat)), 2, _p0, statptr, 0, 0, 0, 0)
 	return
 }
 
@@ -1033,15 +1046,15 @@ func callsendto(s int, _p0 uintptr, _lenp0 int, flags int, to uintptr, addrlen u
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callrecvmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
-	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_recvmsg)), 3, uintptr(s), msg, uintptr(flags), 0, 0, 0)
+func callnrecvmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
+	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_nrecvmsg)), 3, uintptr(s), msg, uintptr(flags), 0, 0, 0)
 	return
 }
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callsendmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
-	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_sendmsg)), 3, uintptr(s), msg, uintptr(flags), 0, 0, 0)
+func callnsendmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
+	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_nsendmsg)), 3, uintptr(s), msg, uintptr(flags), 0, 0, 0)
 	return
 }
 
@@ -1145,6 +1158,13 @@ func callgetsystemcfg(label int) (r1 uintptr, e1 Errno) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func callumount(_p0 uintptr) (r1 uintptr, e1 Errno) {
+	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_umount)), 1, _p0, 0, 0, 0, 0, 0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) {
 	r1, _, e1 = rawSyscall6(uintptr(unsafe.Pointer(&libc_getrlimit)), 2, uintptr(resource), rlim, 0, 0, 0, 0)
 	return
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go
index 5491c89..cde4dbc 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go
@@ -83,6 +83,8 @@ int lstat(uintptr_t, uintptr_t);
 int pause();
 int pread64(int, uintptr_t, size_t, long long);
 int pwrite64(int, uintptr_t, size_t, long long);
+#define c_select select
+int select(int, uintptr_t, uintptr_t, uintptr_t, uintptr_t);
 int pselect(int, uintptr_t, uintptr_t, uintptr_t, uintptr_t, uintptr_t);
 int setregid(int, int);
 int setreuid(int, int);
@@ -103,8 +105,8 @@ int getpeername(int, uintptr_t, uintptr_t);
 int getsockname(int, uintptr_t, uintptr_t);
 int recvfrom(int, uintptr_t, size_t, int, uintptr_t, uintptr_t);
 int sendto(int, uintptr_t, size_t, int, uintptr_t, uintptr_t);
-int recvmsg(int, uintptr_t, int);
-int sendmsg(int, uintptr_t, int);
+int nrecvmsg(int, uintptr_t, int);
+int nsendmsg(int, uintptr_t, int);
 int munmap(uintptr_t, uintptr_t);
 int madvise(uintptr_t, size_t, int);
 int mprotect(uintptr_t, size_t, int);
@@ -119,6 +121,7 @@ int gettimeofday(uintptr_t, uintptr_t);
 int time(uintptr_t);
 int utime(uintptr_t, uintptr_t);
 unsigned long long getsystemcfg(int);
+int umount(uintptr_t);
 int getrlimit(int, uintptr_t);
 int setrlimit(int, uintptr_t);
 long long lseek(int, long long, int);
@@ -732,6 +735,14 @@ func callpwrite64(fd int, _p0 uintptr, _lenp0 int, offset int64) (r1 uintptr, e1
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func callselect(nfd int, r uintptr, w uintptr, e uintptr, timeout uintptr) (r1 uintptr, e1 Errno) {
+	r1 = uintptr(C.c_select(C.int(nfd), C.uintptr_t(r), C.uintptr_t(w), C.uintptr_t(e), C.uintptr_t(timeout)))
+	e1 = syscall.GetErrno()
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func callpselect(nfd int, r uintptr, w uintptr, e uintptr, timeout uintptr, sigmask uintptr) (r1 uintptr, e1 Errno) {
 	r1 = uintptr(C.pselect(C.int(nfd), C.uintptr_t(r), C.uintptr_t(w), C.uintptr_t(e), C.uintptr_t(timeout), C.uintptr_t(sigmask)))
 	e1 = syscall.GetErrno()
@@ -772,8 +783,8 @@ func callsplice(rfd int, roff uintptr, wfd int, woff uintptr, len int, flags int
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callstat(_p0 uintptr, stat uintptr) (r1 uintptr, e1 Errno) {
-	r1 = uintptr(C.stat(C.uintptr_t(_p0), C.uintptr_t(stat)))
+func callstat(_p0 uintptr, statptr uintptr) (r1 uintptr, e1 Errno) {
+	r1 = uintptr(C.stat(C.uintptr_t(_p0), C.uintptr_t(statptr)))
 	e1 = syscall.GetErrno()
 	return
 }
@@ -892,16 +903,16 @@ func callsendto(s int, _p0 uintptr, _lenp0 int, flags int, to uintptr, addrlen u
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callrecvmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
-	r1 = uintptr(C.recvmsg(C.int(s), C.uintptr_t(msg), C.int(flags)))
+func callnrecvmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
+	r1 = uintptr(C.nrecvmsg(C.int(s), C.uintptr_t(msg), C.int(flags)))
 	e1 = syscall.GetErrno()
 	return
 }
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callsendmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
-	r1 = uintptr(C.sendmsg(C.int(s), C.uintptr_t(msg), C.int(flags)))
+func callnsendmsg(s int, msg uintptr, flags int) (r1 uintptr, e1 Errno) {
+	r1 = uintptr(C.nsendmsg(C.int(s), C.uintptr_t(msg), C.int(flags)))
 	e1 = syscall.GetErrno()
 	return
 }
@@ -1020,6 +1031,14 @@ func callgetsystemcfg(label int) (r1 uintptr, e1 Errno) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func callumount(_p0 uintptr) (r1 uintptr, e1 Errno) {
+	r1 = uintptr(C.umount(C.uintptr_t(_p0)))
+	e1 = syscall.GetErrno()
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) {
 	r1 = uintptr(C.getrlimit(C.int(resource), C.uintptr_t(rlim)))
 	e1 = syscall.GetErrno()
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go
index ae9f1a2..cdfe931 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go
@@ -749,6 +749,23 @@ func Ftruncate(fd int, length int64) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Getdents(fd int, buf []byte) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(buf) > 0 {
+		_p0 = unsafe.Pointer(&buf[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall(SYS_GETDENTS, uintptr(fd), uintptr(_p0), uintptr(len(buf)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go
index 80903e4..a783306 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go
@@ -387,6 +387,16 @@ func pipe2(p *[2]_C_int, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptrace(request int, pid int, addr uintptr, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Getcwd(buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
@@ -1019,7 +1029,7 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdirentries_freebsd12(fd int, buf []byte, basep *uintptr) (n int, err error) {
+func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go
index cd250ff..f995520 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go
@@ -387,6 +387,16 @@ func pipe2(p *[2]_C_int, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptrace(request int, pid int, addr uintptr, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Getcwd(buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
@@ -1019,7 +1029,7 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdirentries_freebsd12(fd int, buf []byte, basep *uintptr) (n int, err error) {
+func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go
index 290a9c2..d681acd 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go
@@ -387,6 +387,16 @@ func pipe2(p *[2]_C_int, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptrace(request int, pid int, addr uintptr, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Getcwd(buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
@@ -1019,7 +1029,7 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdirentries_freebsd12(fd int, buf []byte, basep *uintptr) (n int, err error) {
+func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go
index c6df9d2..5049b2e 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go
@@ -404,6 +404,16 @@ func Getcwd(buf []byte) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptrace(request int, pid int, addr uintptr, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -1019,7 +1029,7 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdirentries_freebsd12(fd int, buf []byte, basep *uintptr) (n int, err error) {
+func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go
index 9855afa..c5e46e4 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func pipe(p *[2]_C_int) (err error) {
 	_, _, e1 := RawSyscall(SYS_PIPE, uintptr(unsafe.Pointer(p)), 0, 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go
index 773e251..da8819e 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go
index ccea621..6ad9be6 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func pipe(p *[2]_C_int) (err error) {
 	_, _, e1 := RawSyscall(SYS_PIPE, uintptr(unsafe.Pointer(p)), 0, 0)
 	if e1 != 0 {
@@ -2340,3 +2390,18 @@ func armSyncFileRange(fd int, flags int, off int64, n int64) (err error) {
 	}
 	return
 }
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(cmdline)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_KEXEC_FILE_LOAD, uintptr(kernelFd), uintptr(initrdFd), uintptr(cmdlineLen), uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go
index 712c7a3..f883317 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(events) > 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go
index 68b3251..8eebc6c 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go
index a8be407..ecf62a6 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go
index 1351028..1ba0f7b 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go
index 327b4f9..20012b2 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go
index c145bd3..2b520de 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go
index cd8179c..d9f044c 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go
index 2e90cf0..9feed65 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(events) > 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go
index fe9c7e1..0a65150 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := Syscall(SYS_DUP2, uintptr(oldfd), uintptr(newfd), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go
index d4a2100..e27f669 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go
@@ -408,6 +408,26 @@ func Adjtimex(buf *Timex) (state int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Capget(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPGET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Capset(hdr *CapUserHeader, data *CapUserData) (err error) {
+	_, _, e1 := Syscall(SYS_CAPSET, uintptr(unsafe.Pointer(hdr)), uintptr(unsafe.Pointer(data)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Chdir(path string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1381,8 +1401,12 @@ func Setxattr(path string, attr string, data []byte, flags int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Signalfd(fd int, mask *Sigset_t, flags int) {
-	SyscallNoError(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(mask)), uintptr(flags))
+func signalfd(fd int, sigmask *Sigset_t, maskSize uintptr, flags int) (newfd int, err error) {
+	r0, _, e1 := Syscall6(SYS_SIGNALFD4, uintptr(fd), uintptr(unsafe.Pointer(sigmask)), uintptr(maskSize), uintptr(flags), 0, 0)
+	newfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
 	return
 }
 
@@ -1679,6 +1703,32 @@ func faccessat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func nameToHandleAt(dirFD int, pathname string, fh *fileHandle, mountID *_C_int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(pathname)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_NAME_TO_HANDLE_AT, uintptr(dirFD), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(fh)), uintptr(unsafe.Pointer(mountID)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func openByHandleAt(mountFD int, fh *fileHandle, flags int) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_OPEN_BY_HANDLE_AT, uintptr(mountFD), uintptr(unsafe.Pointer(fh)), uintptr(flags))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(events) > 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go
index 642db76..7e05826 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go
@@ -389,7 +389,7 @@ func pipe() (fd1 int, fd2 int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdents(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go
index 59585fe..d94d076 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go
@@ -389,7 +389,7 @@ func pipe() (fd1 int, fd2 int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdents(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go
index 6ec3143..cf5bf3d 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go
@@ -389,7 +389,7 @@ func pipe() (fd1 int, fd2 int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdents(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go
index 603d144..243a931 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go
@@ -389,7 +389,7 @@ func pipe() (fd1 int, fd2 int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdents(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
index 6a489fa..a9532d0 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
@@ -387,7 +387,7 @@ func pipe(p *[2]_C_int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdents(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
index 30cba43..0cb9f01 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
@@ -387,7 +387,7 @@ func pipe(p *[2]_C_int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdents(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
index fa1beda..6fc99b5 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
@@ -387,7 +387,7 @@ func pipe(p *[2]_C_int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func getdents(fd int, buf []byte) (n int, err error) {
+func Getdents(fd int, buf []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(buf) > 0 {
 		_p0 = unsafe.Pointer(&buf[0])
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
new file mode 100644
index 0000000..27878a7
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
@@ -0,0 +1,1692 @@
+// go run mksyscall.go -openbsd -tags openbsd,arm64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_arm64.go
+// Code generated by the command above; see README.md. DO NOT EDIT.
+
+// +build openbsd,arm64
+
+package unix
+
+import (
+	"syscall"
+	"unsafe"
+)
+
+var _ syscall.Errno
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getgroups(ngid int, gid *_Gid_t) (n int, err error) {
+	r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0)
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func setgroups(ngid int, gid *_Gid_t) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) {
+	r0, _, e1 := Syscall6(SYS_WAIT4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0)
+	wpid = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) {
+	_, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) {
+	_, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func socket(domain int, typ int, proto int) (fd int, err error) {
+	r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) {
+	_, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) {
+	_, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) {
+	_, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) {
+	_, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Shutdown(s int, how int) (err error) {
+	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(s), uintptr(how), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) {
+	_, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(p) > 0 {
+		_p0 = unsafe.Pointer(&p[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) {
+	var _p0 unsafe.Pointer
+	if len(buf) > 0 {
+		_p0 = unsafe.Pointer(&buf[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) {
+	r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) {
+	r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) {
+	r0, _, e1 := Syscall6(SYS_KEVENT, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
+	var _p0 unsafe.Pointer
+	if len(mib) > 0 {
+		_p0 = unsafe.Pointer(&mib[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func utimes(path string, timeval *[2]Timeval) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_UTIMES, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func futimes(fd int, timeval *[2]Timeval) (err error) {
+	_, _, e1 := Syscall(SYS_FUTIMES, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntl(fd int, cmd int, arg int) (val int, err error) {
+	r0, _, e1 := Syscall(SYS_FCNTL, uintptr(fd), uintptr(cmd), uintptr(arg))
+	val = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func poll(fds *PollFd, nfds int, timeout int) (n int, err error) {
+	r0, _, e1 := Syscall(SYS_POLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Madvise(b []byte, behav int) (err error) {
+	var _p0 unsafe.Pointer
+	if len(b) > 0 {
+		_p0 = unsafe.Pointer(&b[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall(SYS_MADVISE, uintptr(_p0), uintptr(len(b)), uintptr(behav))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mlock(b []byte) (err error) {
+	var _p0 unsafe.Pointer
+	if len(b) > 0 {
+		_p0 = unsafe.Pointer(&b[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall(SYS_MLOCK, uintptr(_p0), uintptr(len(b)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mlockall(flags int) (err error) {
+	_, _, e1 := Syscall(SYS_MLOCKALL, uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mprotect(b []byte, prot int) (err error) {
+	var _p0 unsafe.Pointer
+	if len(b) > 0 {
+		_p0 = unsafe.Pointer(&b[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Msync(b []byte, flags int) (err error) {
+	var _p0 unsafe.Pointer
+	if len(b) > 0 {
+		_p0 = unsafe.Pointer(&b[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Munlock(b []byte) (err error) {
+	var _p0 unsafe.Pointer
+	if len(b) > 0 {
+		_p0 = unsafe.Pointer(&b[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall(SYS_MUNLOCK, uintptr(_p0), uintptr(len(b)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Munlockall() (err error) {
+	_, _, e1 := Syscall(SYS_MUNLOCKALL, 0, 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pipe(p *[2]_C_int) (err error) {
+	_, _, e1 := RawSyscall(SYS_PIPE, uintptr(unsafe.Pointer(p)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getdents(fd int, buf []byte) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(buf) > 0 {
+		_p0 = unsafe.Pointer(&buf[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall(SYS_GETDENTS, uintptr(fd), uintptr(_p0), uintptr(len(buf)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getcwd(buf []byte) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(buf) > 0 {
+		_p0 = unsafe.Pointer(&buf[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall(SYS___GETCWD, uintptr(_p0), uintptr(len(buf)), 0)
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func ioctl(fd int, req uint, arg uintptr) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
+	r0, _, e1 := Syscall6(SYS_PPOLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Access(path string, mode uint32) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_ACCESS, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Adjtime(delta *Timeval, olddelta *Timeval) (err error) {
+	_, _, e1 := Syscall(SYS_ADJTIME, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Chdir(path string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_CHDIR, uintptr(unsafe.Pointer(_p0)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Chflags(path string, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_CHFLAGS, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Chmod(path string, mode uint32) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_CHMOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Chown(path string, uid int, gid int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_CHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Chroot(path string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_CHROOT, uintptr(unsafe.Pointer(_p0)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Close(fd int) (err error) {
+	_, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Dup(fd int) (nfd int, err error) {
+	r0, _, e1 := Syscall(SYS_DUP, uintptr(fd), 0, 0)
+	nfd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Dup2(from int, to int) (err error) {
+	_, _, e1 := Syscall(SYS_DUP2, uintptr(from), uintptr(to), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Exit(code int) {
+	Syscall(SYS_EXIT, uintptr(code), 0, 0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_FACCESSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fchdir(fd int) (err error) {
+	_, _, e1 := Syscall(SYS_FCHDIR, uintptr(fd), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fchflags(fd int, flags int) (err error) {
+	_, _, e1 := Syscall(SYS_FCHFLAGS, uintptr(fd), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fchmod(fd int, mode uint32) (err error) {
+	_, _, e1 := Syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_FCHMODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fchown(fd int, uid int, gid int) (err error) {
+	_, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_FCHOWNAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Flock(fd int, how int) (err error) {
+	_, _, e1 := Syscall(SYS_FLOCK, uintptr(fd), uintptr(how), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fpathconf(fd int, name int) (val int, err error) {
+	r0, _, e1 := Syscall(SYS_FPATHCONF, uintptr(fd), uintptr(name), 0)
+	val = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fstat(fd int, stat *Stat_t) (err error) {
+	_, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fstatfs(fd int, stat *Statfs_t) (err error) {
+	_, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Fsync(fd int) (err error) {
+	_, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Ftruncate(fd int, length int64) (err error) {
+	_, _, e1 := Syscall(SYS_FTRUNCATE, uintptr(fd), 0, uintptr(length))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getegid() (egid int) {
+	r0, _, _ := RawSyscall(SYS_GETEGID, 0, 0, 0)
+	egid = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Geteuid() (uid int) {
+	r0, _, _ := RawSyscall(SYS_GETEUID, 0, 0, 0)
+	uid = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getgid() (gid int) {
+	r0, _, _ := RawSyscall(SYS_GETGID, 0, 0, 0)
+	gid = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getpgid(pid int) (pgid int, err error) {
+	r0, _, e1 := RawSyscall(SYS_GETPGID, uintptr(pid), 0, 0)
+	pgid = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getpgrp() (pgrp int) {
+	r0, _, _ := RawSyscall(SYS_GETPGRP, 0, 0, 0)
+	pgrp = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getpid() (pid int) {
+	r0, _, _ := RawSyscall(SYS_GETPID, 0, 0, 0)
+	pid = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getppid() (ppid int) {
+	r0, _, _ := RawSyscall(SYS_GETPPID, 0, 0, 0)
+	ppid = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getpriority(which int, who int) (prio int, err error) {
+	r0, _, e1 := Syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0)
+	prio = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getrlimit(which int, lim *Rlimit) (err error) {
+	_, _, e1 := RawSyscall(SYS_GETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getrtable() (rtable int, err error) {
+	r0, _, e1 := RawSyscall(SYS_GETRTABLE, 0, 0, 0)
+	rtable = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getrusage(who int, rusage *Rusage) (err error) {
+	_, _, e1 := RawSyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getsid(pid int) (sid int, err error) {
+	r0, _, e1 := RawSyscall(SYS_GETSID, uintptr(pid), 0, 0)
+	sid = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Gettimeofday(tv *Timeval) (err error) {
+	_, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Getuid() (uid int) {
+	r0, _, _ := RawSyscall(SYS_GETUID, 0, 0, 0)
+	uid = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Issetugid() (tainted bool) {
+	r0, _, _ := Syscall(SYS_ISSETUGID, 0, 0, 0)
+	tainted = bool(r0 != 0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Kill(pid int, signum syscall.Signal) (err error) {
+	_, _, e1 := Syscall(SYS_KILL, uintptr(pid), uintptr(signum), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Kqueue() (fd int, err error) {
+	r0, _, e1 := Syscall(SYS_KQUEUE, 0, 0, 0)
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Lchown(path string, uid int, gid int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_LCHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Link(path string, link string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	var _p1 *byte
+	_p1, err = BytePtrFromString(link)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	var _p1 *byte
+	_p1, err = BytePtrFromString(link)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_LINKAT, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Listen(s int, backlog int) (err error) {
+	_, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(backlog), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Lstat(path string, stat *Stat_t) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mkdir(path string, mode uint32) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_MKDIR, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mkdirat(dirfd int, path string, mode uint32) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_MKDIRAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mkfifo(path string, mode uint32) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_MKFIFO, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mkfifoat(dirfd int, path string, mode uint32) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_MKFIFOAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mknod(path string, mode uint32, dev int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_MKNODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Nanosleep(time *Timespec, leftover *Timespec) (err error) {
+	_, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Open(path string, mode int, perm uint32) (fd int, err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	r0, _, e1 := Syscall(SYS_OPEN, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm))
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	r0, _, e1 := Syscall6(SYS_OPENAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0)
+	fd = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Pathconf(path string, name int) (val int, err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	r0, _, e1 := Syscall(SYS_PATHCONF, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0)
+	val = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Pread(fd int, p []byte, offset int64) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(p) > 0 {
+		_p0 = unsafe.Pointer(&p[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0)
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Pwrite(fd int, p []byte, offset int64) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(p) > 0 {
+		_p0 = unsafe.Pointer(&p[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), 0, uintptr(offset), 0)
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func read(fd int, p []byte) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(p) > 0 {
+		_p0 = unsafe.Pointer(&p[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Readlink(path string, buf []byte) (n int, err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	var _p1 unsafe.Pointer
+	if len(buf) > 0 {
+		_p1 = unsafe.Pointer(&buf[0])
+	} else {
+		_p1 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall(SYS_READLINK, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	var _p1 unsafe.Pointer
+	if len(buf) > 0 {
+		_p1 = unsafe.Pointer(&buf[0])
+	} else {
+		_p1 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall6(SYS_READLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0)
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Rename(from string, to string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(from)
+	if err != nil {
+		return
+	}
+	var _p1 *byte
+	_p1, err = BytePtrFromString(to)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_RENAME, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Renameat(fromfd int, from string, tofd int, to string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(from)
+	if err != nil {
+		return
+	}
+	var _p1 *byte
+	_p1, err = BytePtrFromString(to)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_RENAMEAT, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Revoke(path string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_REVOKE, uintptr(unsafe.Pointer(_p0)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Rmdir(path string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_RMDIR, uintptr(unsafe.Pointer(_p0)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Seek(fd int, offset int64, whence int) (newoffset int64, err error) {
+	r0, _, e1 := Syscall6(SYS_LSEEK, uintptr(fd), 0, uintptr(offset), uintptr(whence), 0, 0)
+	newoffset = int64(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Select(n int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (err error) {
+	_, _, e1 := Syscall6(SYS_SELECT, uintptr(n), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setegid(egid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETEGID, uintptr(egid), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Seteuid(euid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETEUID, uintptr(euid), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setgid(gid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETGID, uintptr(gid), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setlogin(name string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(name)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_SETLOGIN, uintptr(unsafe.Pointer(_p0)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setpgid(pid int, pgid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setpriority(which int, who int, prio int) (err error) {
+	_, _, e1 := Syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setregid(rgid int, egid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setreuid(ruid int, euid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setresgid(rgid int, egid int, sgid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setresuid(ruid int, euid int, suid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setrlimit(which int, lim *Rlimit) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setrtable(rtable int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETRTABLE, uintptr(rtable), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setsid() (pid int, err error) {
+	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
+	pid = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Settimeofday(tp *Timeval) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETTIMEOFDAY, uintptr(unsafe.Pointer(tp)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Setuid(uid int) (err error) {
+	_, _, e1 := RawSyscall(SYS_SETUID, uintptr(uid), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Stat(path string, stat *Stat_t) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Statfs(path string, stat *Statfs_t) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Symlink(path string, link string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	var _p1 *byte
+	_p1, err = BytePtrFromString(link)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_SYMLINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(oldpath)
+	if err != nil {
+		return
+	}
+	var _p1 *byte
+	_p1, err = BytePtrFromString(newpath)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_SYMLINKAT, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1)))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Sync() (err error) {
+	_, _, e1 := Syscall(SYS_SYNC, 0, 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Truncate(path string, length int64) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), 0, uintptr(length))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Umask(newmask int) (oldmask int) {
+	r0, _, _ := Syscall(SYS_UMASK, uintptr(newmask), 0, 0)
+	oldmask = int(r0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Unlink(path string) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_UNLINK, uintptr(unsafe.Pointer(_p0)), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Unlinkat(dirfd int, path string, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_UNLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Unmount(path string, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall(SYS_UNMOUNT, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func write(fd int, p []byte) (n int, err error) {
+	var _p0 unsafe.Pointer
+	if len(p) > 0 {
+		_p0 = unsafe.Pointer(&p[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) {
+	r0, _, e1 := Syscall9(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), 0, uintptr(pos), 0, 0)
+	ret = uintptr(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func munmap(addr uintptr, length uintptr) (err error) {
+	_, _, e1 := Syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
+	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
+	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go
index b005031..37dcc74 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go
@@ -1,6 +1,8 @@
 // mksysctl_openbsd.pl
 // Code generated by the command above; DO NOT EDIT.
 
+// +build 386,openbsd
+
 package unix
 
 type mibentry struct {
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go
index d014451..fe6caa6 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go
@@ -1,4 +1,4 @@
-// mksysctl_openbsd.pl
+// go run mksysctl_openbsd.go
 // Code generated by the command above; DO NOT EDIT.
 
 // +build amd64,openbsd
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go
index b005031..6eb8c0b 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go
@@ -1,6 +1,8 @@
-// mksysctl_openbsd.pl
+// go run mksysctl_openbsd.go
 // Code generated by the command above; DO NOT EDIT.
 
+// +build arm,openbsd
+
 package unix
 
 type mibentry struct {
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go
new file mode 100644
index 0000000..ba4304f
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go
@@ -0,0 +1,275 @@
+// go run mksysctl_openbsd.go
+// Code generated by the command above; DO NOT EDIT.
+
+// +build arm64,openbsd
+
+package unix
+
+type mibentry struct {
+	ctlname string
+	ctloid  []_C_int
+}
+
+var sysctlMib = []mibentry{
+	{"ddb.console", []_C_int{9, 6}},
+	{"ddb.log", []_C_int{9, 7}},
+	{"ddb.max_line", []_C_int{9, 3}},
+	{"ddb.max_width", []_C_int{9, 2}},
+	{"ddb.panic", []_C_int{9, 5}},
+	{"ddb.profile", []_C_int{9, 9}},
+	{"ddb.radix", []_C_int{9, 1}},
+	{"ddb.tab_stop_width", []_C_int{9, 4}},
+	{"ddb.trigger", []_C_int{9, 8}},
+	{"fs.posix.setuid", []_C_int{3, 1, 1}},
+	{"hw.allowpowerdown", []_C_int{6, 22}},
+	{"hw.byteorder", []_C_int{6, 4}},
+	{"hw.cpuspeed", []_C_int{6, 12}},
+	{"hw.diskcount", []_C_int{6, 10}},
+	{"hw.disknames", []_C_int{6, 8}},
+	{"hw.diskstats", []_C_int{6, 9}},
+	{"hw.machine", []_C_int{6, 1}},
+	{"hw.model", []_C_int{6, 2}},
+	{"hw.ncpu", []_C_int{6, 3}},
+	{"hw.ncpufound", []_C_int{6, 21}},
+	{"hw.ncpuonline", []_C_int{6, 25}},
+	{"hw.pagesize", []_C_int{6, 7}},
+	{"hw.perfpolicy", []_C_int{6, 23}},
+	{"hw.physmem", []_C_int{6, 19}},
+	{"hw.product", []_C_int{6, 15}},
+	{"hw.serialno", []_C_int{6, 17}},
+	{"hw.setperf", []_C_int{6, 13}},
+	{"hw.smt", []_C_int{6, 24}},
+	{"hw.usermem", []_C_int{6, 20}},
+	{"hw.uuid", []_C_int{6, 18}},
+	{"hw.vendor", []_C_int{6, 14}},
+	{"hw.version", []_C_int{6, 16}},
+	{"kern.allowkmem", []_C_int{1, 52}},
+	{"kern.argmax", []_C_int{1, 8}},
+	{"kern.audio", []_C_int{1, 84}},
+	{"kern.boottime", []_C_int{1, 21}},
+	{"kern.bufcachepercent", []_C_int{1, 72}},
+	{"kern.ccpu", []_C_int{1, 45}},
+	{"kern.clockrate", []_C_int{1, 12}},
+	{"kern.consdev", []_C_int{1, 75}},
+	{"kern.cp_time", []_C_int{1, 40}},
+	{"kern.cp_time2", []_C_int{1, 71}},
+	{"kern.cpustats", []_C_int{1, 85}},
+	{"kern.domainname", []_C_int{1, 22}},
+	{"kern.file", []_C_int{1, 73}},
+	{"kern.forkstat", []_C_int{1, 42}},
+	{"kern.fscale", []_C_int{1, 46}},
+	{"kern.fsync", []_C_int{1, 33}},
+	{"kern.global_ptrace", []_C_int{1, 81}},
+	{"kern.hostid", []_C_int{1, 11}},
+	{"kern.hostname", []_C_int{1, 10}},
+	{"kern.intrcnt.nintrcnt", []_C_int{1, 63, 1}},
+	{"kern.job_control", []_C_int{1, 19}},
+	{"kern.malloc.buckets", []_C_int{1, 39, 1}},
+	{"kern.malloc.kmemnames", []_C_int{1, 39, 3}},
+	{"kern.maxclusters", []_C_int{1, 67}},
+	{"kern.maxfiles", []_C_int{1, 7}},
+	{"kern.maxlocksperuid", []_C_int{1, 70}},
+	{"kern.maxpartitions", []_C_int{1, 23}},
+	{"kern.maxproc", []_C_int{1, 6}},
+	{"kern.maxthread", []_C_int{1, 25}},
+	{"kern.maxvnodes", []_C_int{1, 5}},
+	{"kern.mbstat", []_C_int{1, 59}},
+	{"kern.msgbuf", []_C_int{1, 48}},
+	{"kern.msgbufsize", []_C_int{1, 38}},
+	{"kern.nchstats", []_C_int{1, 41}},
+	{"kern.netlivelocks", []_C_int{1, 76}},
+	{"kern.nfiles", []_C_int{1, 56}},
+	{"kern.ngroups", []_C_int{1, 18}},
+	{"kern.nosuidcoredump", []_C_int{1, 32}},
+	{"kern.nprocs", []_C_int{1, 47}},
+	{"kern.nselcoll", []_C_int{1, 43}},
+	{"kern.nthreads", []_C_int{1, 26}},
+	{"kern.numvnodes", []_C_int{1, 58}},
+	{"kern.osrelease", []_C_int{1, 2}},
+	{"kern.osrevision", []_C_int{1, 3}},
+	{"kern.ostype", []_C_int{1, 1}},
+	{"kern.osversion", []_C_int{1, 27}},
+	{"kern.pool_debug", []_C_int{1, 77}},
+	{"kern.posix1version", []_C_int{1, 17}},
+	{"kern.proc", []_C_int{1, 66}},
+	{"kern.rawpartition", []_C_int{1, 24}},
+	{"kern.saved_ids", []_C_int{1, 20}},
+	{"kern.securelevel", []_C_int{1, 9}},
+	{"kern.seminfo", []_C_int{1, 61}},
+	{"kern.shminfo", []_C_int{1, 62}},
+	{"kern.somaxconn", []_C_int{1, 28}},
+	{"kern.sominconn", []_C_int{1, 29}},
+	{"kern.splassert", []_C_int{1, 54}},
+	{"kern.stackgap_random", []_C_int{1, 50}},
+	{"kern.sysvipc_info", []_C_int{1, 51}},
+	{"kern.sysvmsg", []_C_int{1, 34}},
+	{"kern.sysvsem", []_C_int{1, 35}},
+	{"kern.sysvshm", []_C_int{1, 36}},
+	{"kern.timecounter.choice", []_C_int{1, 69, 4}},
+	{"kern.timecounter.hardware", []_C_int{1, 69, 3}},
+	{"kern.timecounter.tick", []_C_int{1, 69, 1}},
+	{"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}},
+	{"kern.tty.tk_cancc", []_C_int{1, 44, 4}},
+	{"kern.tty.tk_nin", []_C_int{1, 44, 1}},
+	{"kern.tty.tk_nout", []_C_int{1, 44, 2}},
+	{"kern.tty.tk_rawcc", []_C_int{1, 44, 3}},
+	{"kern.tty.ttyinfo", []_C_int{1, 44, 5}},
+	{"kern.ttycount", []_C_int{1, 57}},
+	{"kern.version", []_C_int{1, 4}},
+	{"kern.watchdog.auto", []_C_int{1, 64, 2}},
+	{"kern.watchdog.period", []_C_int{1, 64, 1}},
+	{"kern.witnesswatch", []_C_int{1, 53}},
+	{"kern.wxabort", []_C_int{1, 74}},
+	{"net.bpf.bufsize", []_C_int{4, 31, 1}},
+	{"net.bpf.maxbufsize", []_C_int{4, 31, 2}},
+	{"net.inet.ah.enable", []_C_int{4, 2, 51, 1}},
+	{"net.inet.ah.stats", []_C_int{4, 2, 51, 2}},
+	{"net.inet.carp.allow", []_C_int{4, 2, 112, 1}},
+	{"net.inet.carp.log", []_C_int{4, 2, 112, 3}},
+	{"net.inet.carp.preempt", []_C_int{4, 2, 112, 2}},
+	{"net.inet.carp.stats", []_C_int{4, 2, 112, 4}},
+	{"net.inet.divert.recvspace", []_C_int{4, 2, 258, 1}},
+	{"net.inet.divert.sendspace", []_C_int{4, 2, 258, 2}},
+	{"net.inet.divert.stats", []_C_int{4, 2, 258, 3}},
+	{"net.inet.esp.enable", []_C_int{4, 2, 50, 1}},
+	{"net.inet.esp.stats", []_C_int{4, 2, 50, 4}},
+	{"net.inet.esp.udpencap", []_C_int{4, 2, 50, 2}},
+	{"net.inet.esp.udpencap_port", []_C_int{4, 2, 50, 3}},
+	{"net.inet.etherip.allow", []_C_int{4, 2, 97, 1}},
+	{"net.inet.etherip.stats", []_C_int{4, 2, 97, 2}},
+	{"net.inet.gre.allow", []_C_int{4, 2, 47, 1}},
+	{"net.inet.gre.wccp", []_C_int{4, 2, 47, 2}},
+	{"net.inet.icmp.bmcastecho", []_C_int{4, 2, 1, 2}},
+	{"net.inet.icmp.errppslimit", []_C_int{4, 2, 1, 3}},
+	{"net.inet.icmp.maskrepl", []_C_int{4, 2, 1, 1}},
+	{"net.inet.icmp.rediraccept", []_C_int{4, 2, 1, 4}},
+	{"net.inet.icmp.redirtimeout", []_C_int{4, 2, 1, 5}},
+	{"net.inet.icmp.stats", []_C_int{4, 2, 1, 7}},
+	{"net.inet.icmp.tstamprepl", []_C_int{4, 2, 1, 6}},
+	{"net.inet.igmp.stats", []_C_int{4, 2, 2, 1}},
+	{"net.inet.ip.arpdown", []_C_int{4, 2, 0, 40}},
+	{"net.inet.ip.arpqueued", []_C_int{4, 2, 0, 36}},
+	{"net.inet.ip.arptimeout", []_C_int{4, 2, 0, 39}},
+	{"net.inet.ip.encdebug", []_C_int{4, 2, 0, 12}},
+	{"net.inet.ip.forwarding", []_C_int{4, 2, 0, 1}},
+	{"net.inet.ip.ifq.congestion", []_C_int{4, 2, 0, 30, 4}},
+	{"net.inet.ip.ifq.drops", []_C_int{4, 2, 0, 30, 3}},
+	{"net.inet.ip.ifq.len", []_C_int{4, 2, 0, 30, 1}},
+	{"net.inet.ip.ifq.maxlen", []_C_int{4, 2, 0, 30, 2}},
+	{"net.inet.ip.maxqueue", []_C_int{4, 2, 0, 11}},
+	{"net.inet.ip.mforwarding", []_C_int{4, 2, 0, 31}},
+	{"net.inet.ip.mrtmfc", []_C_int{4, 2, 0, 37}},
+	{"net.inet.ip.mrtproto", []_C_int{4, 2, 0, 34}},
+	{"net.inet.ip.mrtstats", []_C_int{4, 2, 0, 35}},
+	{"net.inet.ip.mrtvif", []_C_int{4, 2, 0, 38}},
+	{"net.inet.ip.mtu", []_C_int{4, 2, 0, 4}},
+	{"net.inet.ip.mtudisc", []_C_int{4, 2, 0, 27}},
+	{"net.inet.ip.mtudisctimeout", []_C_int{4, 2, 0, 28}},
+	{"net.inet.ip.multipath", []_C_int{4, 2, 0, 32}},
+	{"net.inet.ip.portfirst", []_C_int{4, 2, 0, 7}},
+	{"net.inet.ip.porthifirst", []_C_int{4, 2, 0, 9}},
+	{"net.inet.ip.porthilast", []_C_int{4, 2, 0, 10}},
+	{"net.inet.ip.portlast", []_C_int{4, 2, 0, 8}},
+	{"net.inet.ip.redirect", []_C_int{4, 2, 0, 2}},
+	{"net.inet.ip.sourceroute", []_C_int{4, 2, 0, 5}},
+	{"net.inet.ip.stats", []_C_int{4, 2, 0, 33}},
+	{"net.inet.ip.ttl", []_C_int{4, 2, 0, 3}},
+	{"net.inet.ipcomp.enable", []_C_int{4, 2, 108, 1}},
+	{"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}},
+	{"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}},
+	{"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}},
+	{"net.inet.mobileip.allow", []_C_int{4, 2, 55, 1}},
+	{"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}},
+	{"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}},
+	{"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}},
+	{"net.inet.tcp.baddynamic", []_C_int{4, 2, 6, 6}},
+	{"net.inet.tcp.drop", []_C_int{4, 2, 6, 19}},
+	{"net.inet.tcp.ecn", []_C_int{4, 2, 6, 14}},
+	{"net.inet.tcp.ident", []_C_int{4, 2, 6, 9}},
+	{"net.inet.tcp.keepidle", []_C_int{4, 2, 6, 3}},
+	{"net.inet.tcp.keepinittime", []_C_int{4, 2, 6, 2}},
+	{"net.inet.tcp.keepintvl", []_C_int{4, 2, 6, 4}},
+	{"net.inet.tcp.mssdflt", []_C_int{4, 2, 6, 11}},
+	{"net.inet.tcp.reasslimit", []_C_int{4, 2, 6, 18}},
+	{"net.inet.tcp.rfc1323", []_C_int{4, 2, 6, 1}},
+	{"net.inet.tcp.rfc3390", []_C_int{4, 2, 6, 17}},
+	{"net.inet.tcp.rootonly", []_C_int{4, 2, 6, 24}},
+	{"net.inet.tcp.rstppslimit", []_C_int{4, 2, 6, 12}},
+	{"net.inet.tcp.sack", []_C_int{4, 2, 6, 10}},
+	{"net.inet.tcp.sackholelimit", []_C_int{4, 2, 6, 20}},
+	{"net.inet.tcp.slowhz", []_C_int{4, 2, 6, 5}},
+	{"net.inet.tcp.stats", []_C_int{4, 2, 6, 21}},
+	{"net.inet.tcp.synbucketlimit", []_C_int{4, 2, 6, 16}},
+	{"net.inet.tcp.syncachelimit", []_C_int{4, 2, 6, 15}},
+	{"net.inet.tcp.synhashsize", []_C_int{4, 2, 6, 25}},
+	{"net.inet.tcp.synuselimit", []_C_int{4, 2, 6, 23}},
+	{"net.inet.udp.baddynamic", []_C_int{4, 2, 17, 2}},
+	{"net.inet.udp.checksum", []_C_int{4, 2, 17, 1}},
+	{"net.inet.udp.recvspace", []_C_int{4, 2, 17, 3}},
+	{"net.inet.udp.rootonly", []_C_int{4, 2, 17, 6}},
+	{"net.inet.udp.sendspace", []_C_int{4, 2, 17, 4}},
+	{"net.inet.udp.stats", []_C_int{4, 2, 17, 5}},
+	{"net.inet6.divert.recvspace", []_C_int{4, 24, 86, 1}},
+	{"net.inet6.divert.sendspace", []_C_int{4, 24, 86, 2}},
+	{"net.inet6.divert.stats", []_C_int{4, 24, 86, 3}},
+	{"net.inet6.icmp6.errppslimit", []_C_int{4, 24, 30, 14}},
+	{"net.inet6.icmp6.mtudisc_hiwat", []_C_int{4, 24, 30, 16}},
+	{"net.inet6.icmp6.mtudisc_lowat", []_C_int{4, 24, 30, 17}},
+	{"net.inet6.icmp6.nd6_debug", []_C_int{4, 24, 30, 18}},
+	{"net.inet6.icmp6.nd6_delay", []_C_int{4, 24, 30, 8}},
+	{"net.inet6.icmp6.nd6_maxnudhint", []_C_int{4, 24, 30, 15}},
+	{"net.inet6.icmp6.nd6_mmaxtries", []_C_int{4, 24, 30, 10}},
+	{"net.inet6.icmp6.nd6_umaxtries", []_C_int{4, 24, 30, 9}},
+	{"net.inet6.icmp6.redirtimeout", []_C_int{4, 24, 30, 3}},
+	{"net.inet6.ip6.auto_flowlabel", []_C_int{4, 24, 17, 17}},
+	{"net.inet6.ip6.dad_count", []_C_int{4, 24, 17, 16}},
+	{"net.inet6.ip6.dad_pending", []_C_int{4, 24, 17, 49}},
+	{"net.inet6.ip6.defmcasthlim", []_C_int{4, 24, 17, 18}},
+	{"net.inet6.ip6.forwarding", []_C_int{4, 24, 17, 1}},
+	{"net.inet6.ip6.forwsrcrt", []_C_int{4, 24, 17, 5}},
+	{"net.inet6.ip6.hdrnestlimit", []_C_int{4, 24, 17, 15}},
+	{"net.inet6.ip6.hlim", []_C_int{4, 24, 17, 3}},
+	{"net.inet6.ip6.log_interval", []_C_int{4, 24, 17, 14}},
+	{"net.inet6.ip6.maxdynroutes", []_C_int{4, 24, 17, 48}},
+	{"net.inet6.ip6.maxfragpackets", []_C_int{4, 24, 17, 9}},
+	{"net.inet6.ip6.maxfrags", []_C_int{4, 24, 17, 41}},
+	{"net.inet6.ip6.mforwarding", []_C_int{4, 24, 17, 42}},
+	{"net.inet6.ip6.mrtmfc", []_C_int{4, 24, 17, 53}},
+	{"net.inet6.ip6.mrtmif", []_C_int{4, 24, 17, 52}},
+	{"net.inet6.ip6.mrtproto", []_C_int{4, 24, 17, 8}},
+	{"net.inet6.ip6.mtudisctimeout", []_C_int{4, 24, 17, 50}},
+	{"net.inet6.ip6.multicast_mtudisc", []_C_int{4, 24, 17, 44}},
+	{"net.inet6.ip6.multipath", []_C_int{4, 24, 17, 43}},
+	{"net.inet6.ip6.neighborgcthresh", []_C_int{4, 24, 17, 45}},
+	{"net.inet6.ip6.redirect", []_C_int{4, 24, 17, 2}},
+	{"net.inet6.ip6.soiikey", []_C_int{4, 24, 17, 54}},
+	{"net.inet6.ip6.sourcecheck", []_C_int{4, 24, 17, 10}},
+	{"net.inet6.ip6.sourcecheck_logint", []_C_int{4, 24, 17, 11}},
+	{"net.inet6.ip6.use_deprecated", []_C_int{4, 24, 17, 21}},
+	{"net.key.sadb_dump", []_C_int{4, 30, 1}},
+	{"net.key.spd_dump", []_C_int{4, 30, 2}},
+	{"net.mpls.ifq.congestion", []_C_int{4, 33, 3, 4}},
+	{"net.mpls.ifq.drops", []_C_int{4, 33, 3, 3}},
+	{"net.mpls.ifq.len", []_C_int{4, 33, 3, 1}},
+	{"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}},
+	{"net.mpls.mapttl_ip", []_C_int{4, 33, 5}},
+	{"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}},
+	{"net.mpls.maxloop_inkernel", []_C_int{4, 33, 4}},
+	{"net.mpls.ttl", []_C_int{4, 33, 2}},
+	{"net.pflow.stats", []_C_int{4, 34, 1}},
+	{"net.pipex.enable", []_C_int{4, 35, 1}},
+	{"vm.anonmin", []_C_int{2, 7}},
+	{"vm.loadavg", []_C_int{2, 2}},
+	{"vm.malloc_conf", []_C_int{2, 12}},
+	{"vm.maxslp", []_C_int{2, 10}},
+	{"vm.nkmempages", []_C_int{2, 6}},
+	{"vm.psstrings", []_C_int{2, 3}},
+	{"vm.swapencrypt.enable", []_C_int{2, 5, 0}},
+	{"vm.swapencrypt.keyscreated", []_C_int{2, 5, 1}},
+	{"vm.swapencrypt.keysdeleted", []_C_int{2, 5, 2}},
+	{"vm.uspace", []_C_int{2, 11}},
+	{"vm.uvmexp", []_C_int{2, 4}},
+	{"vm.vmmeter", []_C_int{2, 1}},
+	{"vm.vnodemin", []_C_int{2, 9}},
+	{"vm.vtextmin", []_C_int{2, 8}},
+}
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go
index 55c3a32..9474974 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go
@@ -1,4 +1,4 @@
-// go run mksysnum.go https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master
+// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 // +build 386,freebsd
@@ -118,8 +118,6 @@ const (
 	SYS_SEMSYS                   = 169 // { int semsys(int which, int a2, int a3, int a4, int a5); }
 	SYS_MSGSYS                   = 170 // { int msgsys(int which, int a2, int a3, int a4, int a5, int a6); }
 	SYS_SHMSYS                   = 171 // { int shmsys(int which, int a2, int a3, int a4); }
-	SYS_FREEBSD6_PREAD           = 173 // { ssize_t freebsd6_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); }
-	SYS_FREEBSD6_PWRITE          = 174 // { ssize_t freebsd6_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); }
 	SYS_SETFIB                   = 175 // { int setfib(int fibnum); }
 	SYS_NTP_ADJTIME              = 176 // { int ntp_adjtime(struct timex *tp); }
 	SYS_SETGID                   = 181 // { int setgid(gid_t gid); }
@@ -133,10 +131,6 @@ const (
 	SYS_GETRLIMIT                = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int
 	SYS_SETRLIMIT                = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int
 	SYS_GETDIRENTRIES            = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); }
-	SYS_FREEBSD6_MMAP            = 197 // { caddr_t freebsd6_mmap(caddr_t addr, size_t len, int prot, int flags, int fd, int pad, off_t pos); }
-	SYS_FREEBSD6_LSEEK           = 199 // { off_t freebsd6_lseek(int fd, int pad, off_t offset, int whence); }
-	SYS_FREEBSD6_TRUNCATE        = 200 // { int freebsd6_truncate(char *path, int pad, off_t length); }
-	SYS_FREEBSD6_FTRUNCATE       = 201 // { int freebsd6_ftruncate(int fd, int pad, off_t length); }
 	SYS___SYSCTL                 = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int
 	SYS_MLOCK                    = 203 // { int mlock(const void *addr, size_t len); }
 	SYS_MUNLOCK                  = 204 // { int munlock(const void *addr, size_t len); }
@@ -164,6 +158,7 @@ const (
 	SYS_FFCLOCK_GETCOUNTER       = 241 // { int ffclock_getcounter(ffcounter *ffcount); }
 	SYS_FFCLOCK_SETESTIMATE      = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); }
 	SYS_FFCLOCK_GETESTIMATE      = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); }
+	SYS_CLOCK_NANOSLEEP          = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); }
 	SYS_CLOCK_GETCPUCLOCKID2     = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); }
 	SYS_NTP_GETTIME              = 248 // { int ntp_gettime(struct ntptimeval *ntvp); }
 	SYS_MINHERIT                 = 250 // { int minherit(void *addr, size_t len, int inherit); }
@@ -197,13 +192,10 @@ const (
 	SYS_GETSID                   = 310 // { int getsid(pid_t pid); }
 	SYS_SETRESUID                = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); }
 	SYS_SETRESGID                = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); }
-	SYS_AIO_RETURN               = 314 // { int aio_return(struct aiocb *aiocbp); }
+	SYS_AIO_RETURN               = 314 // { ssize_t aio_return(struct aiocb *aiocbp); }
 	SYS_AIO_SUSPEND              = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); }
 	SYS_AIO_CANCEL               = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); }
 	SYS_AIO_ERROR                = 317 // { int aio_error(struct aiocb *aiocbp); }
-	SYS_OAIO_READ                = 318 // { int oaio_read(struct oaiocb *aiocbp); }
-	SYS_OAIO_WRITE               = 319 // { int oaio_write(struct oaiocb *aiocbp); }
-	SYS_OLIO_LISTIO              = 320 // { int olio_listio(int mode, struct oaiocb * const *acb_list, int nent, struct osigevent *sig); }
 	SYS_YIELD                    = 321 // { int yield(void); }
 	SYS_MLOCKALL                 = 324 // { int mlockall(int how); }
 	SYS_MUNLOCKALL               = 325 // { int munlockall(void); }
@@ -236,7 +228,7 @@ const (
 	SYS_EXTATTR_SET_FILE         = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
 	SYS_EXTATTR_GET_FILE         = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
 	SYS_EXTATTR_DELETE_FILE      = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); }
-	SYS_AIO_WAITCOMPLETE         = 359 // { int aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); }
+	SYS_AIO_WAITCOMPLETE         = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); }
 	SYS_GETRESUID                = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); }
 	SYS_GETRESGID                = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); }
 	SYS_KQUEUE                   = 362 // { int kqueue(void); }
@@ -258,7 +250,7 @@ const (
 	SYS_UUIDGEN                  = 392 // { int uuidgen(struct uuid *store, int count); }
 	SYS_SENDFILE                 = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); }
 	SYS_MAC_SYSCALL              = 394 // { int mac_syscall(const char *policy, int call, void *arg); }
-	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, long bufsize, int flags); }
+	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); }
 	SYS_STATFS                   = 396 // { int statfs(char *path, struct statfs *buf); }
 	SYS_FSTATFS                  = 397 // { int fstatfs(int fd, struct statfs *buf); }
 	SYS_FHSTATFS                 = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); }
@@ -293,8 +285,6 @@ const (
 	SYS_THR_EXIT                 = 431 // { void thr_exit(long *state); }
 	SYS_THR_SELF                 = 432 // { int thr_self(long *id); }
 	SYS_THR_KILL                 = 433 // { int thr_kill(long id, int sig); }
-	SYS__UMTX_LOCK               = 434 // { int _umtx_lock(struct umtx *umtx); }
-	SYS__UMTX_UNLOCK             = 435 // { int _umtx_unlock(struct umtx *umtx); }
 	SYS_JAIL_ATTACH              = 436 // { int jail_attach(int jid); }
 	SYS_EXTATTR_LIST_FD          = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); }
 	SYS_EXTATTR_LIST_FILE        = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); }
@@ -400,4 +390,7 @@ const (
 	SYS_PPOLL                    = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); }
 	SYS_FUTIMENS                 = 546 // { int futimens(int fd, struct timespec *times); }
 	SYS_UTIMENSAT                = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); }
+	SYS_NUMA_GETAFFINITY         = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); }
+	SYS_NUMA_SETAFFINITY         = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); }
+	SYS_FDATASYNC                = 550 // { int fdatasync(int fd); }
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go
index b39be6c..48a7bea 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go
@@ -1,4 +1,4 @@
-// go run mksysnum.go https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master
+// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 // +build amd64,freebsd
@@ -118,8 +118,6 @@ const (
 	SYS_SEMSYS                   = 169 // { int semsys(int which, int a2, int a3, int a4, int a5); }
 	SYS_MSGSYS                   = 170 // { int msgsys(int which, int a2, int a3, int a4, int a5, int a6); }
 	SYS_SHMSYS                   = 171 // { int shmsys(int which, int a2, int a3, int a4); }
-	SYS_FREEBSD6_PREAD           = 173 // { ssize_t freebsd6_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); }
-	SYS_FREEBSD6_PWRITE          = 174 // { ssize_t freebsd6_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); }
 	SYS_SETFIB                   = 175 // { int setfib(int fibnum); }
 	SYS_NTP_ADJTIME              = 176 // { int ntp_adjtime(struct timex *tp); }
 	SYS_SETGID                   = 181 // { int setgid(gid_t gid); }
@@ -133,10 +131,6 @@ const (
 	SYS_GETRLIMIT                = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int
 	SYS_SETRLIMIT                = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int
 	SYS_GETDIRENTRIES            = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); }
-	SYS_FREEBSD6_MMAP            = 197 // { caddr_t freebsd6_mmap(caddr_t addr, size_t len, int prot, int flags, int fd, int pad, off_t pos); }
-	SYS_FREEBSD6_LSEEK           = 199 // { off_t freebsd6_lseek(int fd, int pad, off_t offset, int whence); }
-	SYS_FREEBSD6_TRUNCATE        = 200 // { int freebsd6_truncate(char *path, int pad, off_t length); }
-	SYS_FREEBSD6_FTRUNCATE       = 201 // { int freebsd6_ftruncate(int fd, int pad, off_t length); }
 	SYS___SYSCTL                 = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int
 	SYS_MLOCK                    = 203 // { int mlock(const void *addr, size_t len); }
 	SYS_MUNLOCK                  = 204 // { int munlock(const void *addr, size_t len); }
@@ -164,6 +158,7 @@ const (
 	SYS_FFCLOCK_GETCOUNTER       = 241 // { int ffclock_getcounter(ffcounter *ffcount); }
 	SYS_FFCLOCK_SETESTIMATE      = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); }
 	SYS_FFCLOCK_GETESTIMATE      = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); }
+	SYS_CLOCK_NANOSLEEP          = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); }
 	SYS_CLOCK_GETCPUCLOCKID2     = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); }
 	SYS_NTP_GETTIME              = 248 // { int ntp_gettime(struct ntptimeval *ntvp); }
 	SYS_MINHERIT                 = 250 // { int minherit(void *addr, size_t len, int inherit); }
@@ -197,13 +192,10 @@ const (
 	SYS_GETSID                   = 310 // { int getsid(pid_t pid); }
 	SYS_SETRESUID                = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); }
 	SYS_SETRESGID                = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); }
-	SYS_AIO_RETURN               = 314 // { int aio_return(struct aiocb *aiocbp); }
+	SYS_AIO_RETURN               = 314 // { ssize_t aio_return(struct aiocb *aiocbp); }
 	SYS_AIO_SUSPEND              = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); }
 	SYS_AIO_CANCEL               = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); }
 	SYS_AIO_ERROR                = 317 // { int aio_error(struct aiocb *aiocbp); }
-	SYS_OAIO_READ                = 318 // { int oaio_read(struct oaiocb *aiocbp); }
-	SYS_OAIO_WRITE               = 319 // { int oaio_write(struct oaiocb *aiocbp); }
-	SYS_OLIO_LISTIO              = 320 // { int olio_listio(int mode, struct oaiocb * const *acb_list, int nent, struct osigevent *sig); }
 	SYS_YIELD                    = 321 // { int yield(void); }
 	SYS_MLOCKALL                 = 324 // { int mlockall(int how); }
 	SYS_MUNLOCKALL               = 325 // { int munlockall(void); }
@@ -236,7 +228,7 @@ const (
 	SYS_EXTATTR_SET_FILE         = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
 	SYS_EXTATTR_GET_FILE         = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
 	SYS_EXTATTR_DELETE_FILE      = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); }
-	SYS_AIO_WAITCOMPLETE         = 359 // { int aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); }
+	SYS_AIO_WAITCOMPLETE         = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); }
 	SYS_GETRESUID                = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); }
 	SYS_GETRESGID                = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); }
 	SYS_KQUEUE                   = 362 // { int kqueue(void); }
@@ -258,7 +250,7 @@ const (
 	SYS_UUIDGEN                  = 392 // { int uuidgen(struct uuid *store, int count); }
 	SYS_SENDFILE                 = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); }
 	SYS_MAC_SYSCALL              = 394 // { int mac_syscall(const char *policy, int call, void *arg); }
-	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, long bufsize, int flags); }
+	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); }
 	SYS_STATFS                   = 396 // { int statfs(char *path, struct statfs *buf); }
 	SYS_FSTATFS                  = 397 // { int fstatfs(int fd, struct statfs *buf); }
 	SYS_FHSTATFS                 = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); }
@@ -293,8 +285,6 @@ const (
 	SYS_THR_EXIT                 = 431 // { void thr_exit(long *state); }
 	SYS_THR_SELF                 = 432 // { int thr_self(long *id); }
 	SYS_THR_KILL                 = 433 // { int thr_kill(long id, int sig); }
-	SYS__UMTX_LOCK               = 434 // { int _umtx_lock(struct umtx *umtx); }
-	SYS__UMTX_UNLOCK             = 435 // { int _umtx_unlock(struct umtx *umtx); }
 	SYS_JAIL_ATTACH              = 436 // { int jail_attach(int jid); }
 	SYS_EXTATTR_LIST_FD          = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); }
 	SYS_EXTATTR_LIST_FILE        = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); }
@@ -400,4 +390,7 @@ const (
 	SYS_PPOLL                    = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); }
 	SYS_FUTIMENS                 = 546 // { int futimens(int fd, struct timespec *times); }
 	SYS_UTIMENSAT                = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); }
+	SYS_NUMA_GETAFFINITY         = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); }
+	SYS_NUMA_SETAFFINITY         = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); }
+	SYS_FDATASYNC                = 550 // { int fdatasync(int fd); }
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go
index 44ffd4c..4a6dfd4 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go
@@ -1,4 +1,4 @@
-// go run mksysnum.go https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master
+// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 // +build arm,freebsd
@@ -118,8 +118,6 @@ const (
 	SYS_SEMSYS                   = 169 // { int semsys(int which, int a2, int a3, int a4, int a5); }
 	SYS_MSGSYS                   = 170 // { int msgsys(int which, int a2, int a3, int a4, int a5, int a6); }
 	SYS_SHMSYS                   = 171 // { int shmsys(int which, int a2, int a3, int a4); }
-	SYS_FREEBSD6_PREAD           = 173 // { ssize_t freebsd6_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); }
-	SYS_FREEBSD6_PWRITE          = 174 // { ssize_t freebsd6_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); }
 	SYS_SETFIB                   = 175 // { int setfib(int fibnum); }
 	SYS_NTP_ADJTIME              = 176 // { int ntp_adjtime(struct timex *tp); }
 	SYS_SETGID                   = 181 // { int setgid(gid_t gid); }
@@ -133,10 +131,6 @@ const (
 	SYS_GETRLIMIT                = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int
 	SYS_SETRLIMIT                = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int
 	SYS_GETDIRENTRIES            = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); }
-	SYS_FREEBSD6_MMAP            = 197 // { caddr_t freebsd6_mmap(caddr_t addr, size_t len, int prot, int flags, int fd, int pad, off_t pos); }
-	SYS_FREEBSD6_LSEEK           = 199 // { off_t freebsd6_lseek(int fd, int pad, off_t offset, int whence); }
-	SYS_FREEBSD6_TRUNCATE        = 200 // { int freebsd6_truncate(char *path, int pad, off_t length); }
-	SYS_FREEBSD6_FTRUNCATE       = 201 // { int freebsd6_ftruncate(int fd, int pad, off_t length); }
 	SYS___SYSCTL                 = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int
 	SYS_MLOCK                    = 203 // { int mlock(const void *addr, size_t len); }
 	SYS_MUNLOCK                  = 204 // { int munlock(const void *addr, size_t len); }
@@ -164,6 +158,7 @@ const (
 	SYS_FFCLOCK_GETCOUNTER       = 241 // { int ffclock_getcounter(ffcounter *ffcount); }
 	SYS_FFCLOCK_SETESTIMATE      = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); }
 	SYS_FFCLOCK_GETESTIMATE      = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); }
+	SYS_CLOCK_NANOSLEEP          = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); }
 	SYS_CLOCK_GETCPUCLOCKID2     = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); }
 	SYS_NTP_GETTIME              = 248 // { int ntp_gettime(struct ntptimeval *ntvp); }
 	SYS_MINHERIT                 = 250 // { int minherit(void *addr, size_t len, int inherit); }
@@ -197,13 +192,10 @@ const (
 	SYS_GETSID                   = 310 // { int getsid(pid_t pid); }
 	SYS_SETRESUID                = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); }
 	SYS_SETRESGID                = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); }
-	SYS_AIO_RETURN               = 314 // { int aio_return(struct aiocb *aiocbp); }
+	SYS_AIO_RETURN               = 314 // { ssize_t aio_return(struct aiocb *aiocbp); }
 	SYS_AIO_SUSPEND              = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); }
 	SYS_AIO_CANCEL               = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); }
 	SYS_AIO_ERROR                = 317 // { int aio_error(struct aiocb *aiocbp); }
-	SYS_OAIO_READ                = 318 // { int oaio_read(struct oaiocb *aiocbp); }
-	SYS_OAIO_WRITE               = 319 // { int oaio_write(struct oaiocb *aiocbp); }
-	SYS_OLIO_LISTIO              = 320 // { int olio_listio(int mode, struct oaiocb * const *acb_list, int nent, struct osigevent *sig); }
 	SYS_YIELD                    = 321 // { int yield(void); }
 	SYS_MLOCKALL                 = 324 // { int mlockall(int how); }
 	SYS_MUNLOCKALL               = 325 // { int munlockall(void); }
@@ -236,7 +228,7 @@ const (
 	SYS_EXTATTR_SET_FILE         = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
 	SYS_EXTATTR_GET_FILE         = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
 	SYS_EXTATTR_DELETE_FILE      = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); }
-	SYS_AIO_WAITCOMPLETE         = 359 // { int aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); }
+	SYS_AIO_WAITCOMPLETE         = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); }
 	SYS_GETRESUID                = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); }
 	SYS_GETRESGID                = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); }
 	SYS_KQUEUE                   = 362 // { int kqueue(void); }
@@ -258,7 +250,7 @@ const (
 	SYS_UUIDGEN                  = 392 // { int uuidgen(struct uuid *store, int count); }
 	SYS_SENDFILE                 = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); }
 	SYS_MAC_SYSCALL              = 394 // { int mac_syscall(const char *policy, int call, void *arg); }
-	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, long bufsize, int flags); }
+	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); }
 	SYS_STATFS                   = 396 // { int statfs(char *path, struct statfs *buf); }
 	SYS_FSTATFS                  = 397 // { int fstatfs(int fd, struct statfs *buf); }
 	SYS_FHSTATFS                 = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); }
@@ -293,8 +285,6 @@ const (
 	SYS_THR_EXIT                 = 431 // { void thr_exit(long *state); }
 	SYS_THR_SELF                 = 432 // { int thr_self(long *id); }
 	SYS_THR_KILL                 = 433 // { int thr_kill(long id, int sig); }
-	SYS__UMTX_LOCK               = 434 // { int _umtx_lock(struct umtx *umtx); }
-	SYS__UMTX_UNLOCK             = 435 // { int _umtx_unlock(struct umtx *umtx); }
 	SYS_JAIL_ATTACH              = 436 // { int jail_attach(int jid); }
 	SYS_EXTATTR_LIST_FD          = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); }
 	SYS_EXTATTR_LIST_FILE        = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); }
@@ -400,4 +390,7 @@ const (
 	SYS_PPOLL                    = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); }
 	SYS_FUTIMENS                 = 546 // { int futimens(int fd, struct timespec *times); }
 	SYS_UTIMENSAT                = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); }
+	SYS_NUMA_GETAFFINITY         = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); }
+	SYS_NUMA_SETAFFINITY         = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); }
+	SYS_FDATASYNC                = 550 // { int fdatasync(int fd); }
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go
index 9f21e95..3e51af8 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go
@@ -1,4 +1,4 @@
-// go run mksysnum.go https://svn.freebsd.org/base/stable/10/sys/kern/syscalls.master
+// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 // +build arm64,freebsd
@@ -7,13 +7,13 @@ package unix
 
 const (
 	// SYS_NOSYS = 0;  // { int nosys(void); } syscall nosys_args int
-	SYS_EXIT                     = 1   // { void sys_exit(int rval); } exit \
+	SYS_EXIT                     = 1   // { void sys_exit(int rval); } exit sys_exit_args void
 	SYS_FORK                     = 2   // { int fork(void); }
-	SYS_READ                     = 3   // { ssize_t read(int fd, void *buf, \
-	SYS_WRITE                    = 4   // { ssize_t write(int fd, const void *buf, \
+	SYS_READ                     = 3   // { ssize_t read(int fd, void *buf, size_t nbyte); }
+	SYS_WRITE                    = 4   // { ssize_t write(int fd, const void *buf, size_t nbyte); }
 	SYS_OPEN                     = 5   // { int open(char *path, int flags, int mode); }
 	SYS_CLOSE                    = 6   // { int close(int fd); }
-	SYS_WAIT4                    = 7   // { int wait4(int pid, int *status, \
+	SYS_WAIT4                    = 7   // { int wait4(int pid, int *status, int options, struct rusage *rusage); }
 	SYS_LINK                     = 9   // { int link(char *path, char *link); }
 	SYS_UNLINK                   = 10  // { int unlink(char *path); }
 	SYS_CHDIR                    = 12  // { int chdir(char *path); }
@@ -21,20 +21,20 @@ const (
 	SYS_MKNOD                    = 14  // { int mknod(char *path, int mode, int dev); }
 	SYS_CHMOD                    = 15  // { int chmod(char *path, int mode); }
 	SYS_CHOWN                    = 16  // { int chown(char *path, int uid, int gid); }
-	SYS_OBREAK                   = 17  // { int obreak(char *nsize); } break \
+	SYS_OBREAK                   = 17  // { int obreak(char *nsize); } break obreak_args int
 	SYS_GETPID                   = 20  // { pid_t getpid(void); }
-	SYS_MOUNT                    = 21  // { int mount(char *type, char *path, \
+	SYS_MOUNT                    = 21  // { int mount(char *type, char *path, int flags, caddr_t data); }
 	SYS_UNMOUNT                  = 22  // { int unmount(char *path, int flags); }
 	SYS_SETUID                   = 23  // { int setuid(uid_t uid); }
 	SYS_GETUID                   = 24  // { uid_t getuid(void); }
 	SYS_GETEUID                  = 25  // { uid_t geteuid(void); }
-	SYS_PTRACE                   = 26  // { int ptrace(int req, pid_t pid, \
-	SYS_RECVMSG                  = 27  // { int recvmsg(int s, struct msghdr *msg, \
-	SYS_SENDMSG                  = 28  // { int sendmsg(int s, struct msghdr *msg, \
-	SYS_RECVFROM                 = 29  // { int recvfrom(int s, caddr_t buf, \
-	SYS_ACCEPT                   = 30  // { int accept(int s, \
-	SYS_GETPEERNAME              = 31  // { int getpeername(int fdes, \
-	SYS_GETSOCKNAME              = 32  // { int getsockname(int fdes, \
+	SYS_PTRACE                   = 26  // { int ptrace(int req, pid_t pid, caddr_t addr, int data); }
+	SYS_RECVMSG                  = 27  // { int recvmsg(int s, struct msghdr *msg, int flags); }
+	SYS_SENDMSG                  = 28  // { int sendmsg(int s, struct msghdr *msg, int flags); }
+	SYS_RECVFROM                 = 29  // { int recvfrom(int s, caddr_t buf, size_t len, int flags, struct sockaddr * __restrict from, __socklen_t * __restrict fromlenaddr); }
+	SYS_ACCEPT                   = 30  // { int accept(int s, struct sockaddr * __restrict name, __socklen_t * __restrict anamelen); }
+	SYS_GETPEERNAME              = 31  // { int getpeername(int fdes, struct sockaddr * __restrict asa, __socklen_t * __restrict alen); }
+	SYS_GETSOCKNAME              = 32  // { int getsockname(int fdes, struct sockaddr * __restrict asa, __socklen_t * __restrict alen); }
 	SYS_ACCESS                   = 33  // { int access(char *path, int amode); }
 	SYS_CHFLAGS                  = 34  // { int chflags(const char *path, u_long flags); }
 	SYS_FCHFLAGS                 = 35  // { int fchflags(int fd, u_long flags); }
@@ -42,56 +42,57 @@ const (
 	SYS_KILL                     = 37  // { int kill(int pid, int signum); }
 	SYS_GETPPID                  = 39  // { pid_t getppid(void); }
 	SYS_DUP                      = 41  // { int dup(u_int fd); }
+	SYS_PIPE                     = 42  // { int pipe(void); }
 	SYS_GETEGID                  = 43  // { gid_t getegid(void); }
-	SYS_PROFIL                   = 44  // { int profil(caddr_t samples, size_t size, \
-	SYS_KTRACE                   = 45  // { int ktrace(const char *fname, int ops, \
+	SYS_PROFIL                   = 44  // { int profil(caddr_t samples, size_t size, size_t offset, u_int scale); }
+	SYS_KTRACE                   = 45  // { int ktrace(const char *fname, int ops, int facs, int pid); }
 	SYS_GETGID                   = 47  // { gid_t getgid(void); }
-	SYS_GETLOGIN                 = 49  // { int getlogin(char *namebuf, u_int \
+	SYS_GETLOGIN                 = 49  // { int getlogin(char *namebuf, u_int namelen); }
 	SYS_SETLOGIN                 = 50  // { int setlogin(char *namebuf); }
 	SYS_ACCT                     = 51  // { int acct(char *path); }
-	SYS_SIGALTSTACK              = 53  // { int sigaltstack(stack_t *ss, \
-	SYS_IOCTL                    = 54  // { int ioctl(int fd, u_long com, \
+	SYS_SIGALTSTACK              = 53  // { int sigaltstack(stack_t *ss, stack_t *oss); }
+	SYS_IOCTL                    = 54  // { int ioctl(int fd, u_long com, caddr_t data); }
 	SYS_REBOOT                   = 55  // { int reboot(int opt); }
 	SYS_REVOKE                   = 56  // { int revoke(char *path); }
 	SYS_SYMLINK                  = 57  // { int symlink(char *path, char *link); }
-	SYS_READLINK                 = 58  // { ssize_t readlink(char *path, char *buf, \
-	SYS_EXECVE                   = 59  // { int execve(char *fname, char **argv, \
-	SYS_UMASK                    = 60  // { int umask(int newmask); } umask umask_args \
+	SYS_READLINK                 = 58  // { ssize_t readlink(char *path, char *buf, size_t count); }
+	SYS_EXECVE                   = 59  // { int execve(char *fname, char **argv, char **envv); }
+	SYS_UMASK                    = 60  // { int umask(int newmask); } umask umask_args int
 	SYS_CHROOT                   = 61  // { int chroot(char *path); }
-	SYS_MSYNC                    = 65  // { int msync(void *addr, size_t len, \
+	SYS_MSYNC                    = 65  // { int msync(void *addr, size_t len, int flags); }
 	SYS_VFORK                    = 66  // { int vfork(void); }
 	SYS_SBRK                     = 69  // { int sbrk(int incr); }
 	SYS_SSTK                     = 70  // { int sstk(int incr); }
-	SYS_OVADVISE                 = 72  // { int ovadvise(int anom); } vadvise \
+	SYS_OVADVISE                 = 72  // { int ovadvise(int anom); } vadvise ovadvise_args int
 	SYS_MUNMAP                   = 73  // { int munmap(void *addr, size_t len); }
-	SYS_MPROTECT                 = 74  // { int mprotect(const void *addr, size_t len, \
-	SYS_MADVISE                  = 75  // { int madvise(void *addr, size_t len, \
-	SYS_MINCORE                  = 78  // { int mincore(const void *addr, size_t len, \
-	SYS_GETGROUPS                = 79  // { int getgroups(u_int gidsetsize, \
-	SYS_SETGROUPS                = 80  // { int setgroups(u_int gidsetsize, \
+	SYS_MPROTECT                 = 74  // { int mprotect(const void *addr, size_t len, int prot); }
+	SYS_MADVISE                  = 75  // { int madvise(void *addr, size_t len, int behav); }
+	SYS_MINCORE                  = 78  // { int mincore(const void *addr, size_t len, char *vec); }
+	SYS_GETGROUPS                = 79  // { int getgroups(u_int gidsetsize, gid_t *gidset); }
+	SYS_SETGROUPS                = 80  // { int setgroups(u_int gidsetsize, gid_t *gidset); }
 	SYS_GETPGRP                  = 81  // { int getpgrp(void); }
 	SYS_SETPGID                  = 82  // { int setpgid(int pid, int pgid); }
-	SYS_SETITIMER                = 83  // { int setitimer(u_int which, struct \
+	SYS_SETITIMER                = 83  // { int setitimer(u_int which, struct itimerval *itv, struct itimerval *oitv); }
 	SYS_SWAPON                   = 85  // { int swapon(char *name); }
-	SYS_GETITIMER                = 86  // { int getitimer(u_int which, \
+	SYS_GETITIMER                = 86  // { int getitimer(u_int which, struct itimerval *itv); }
 	SYS_GETDTABLESIZE            = 89  // { int getdtablesize(void); }
 	SYS_DUP2                     = 90  // { int dup2(u_int from, u_int to); }
 	SYS_FCNTL                    = 92  // { int fcntl(int fd, int cmd, long arg); }
-	SYS_SELECT                   = 93  // { int select(int nd, fd_set *in, fd_set *ou, \
+	SYS_SELECT                   = 93  // { int select(int nd, fd_set *in, fd_set *ou, fd_set *ex, struct timeval *tv); }
 	SYS_FSYNC                    = 95  // { int fsync(int fd); }
-	SYS_SETPRIORITY              = 96  // { int setpriority(int which, int who, \
-	SYS_SOCKET                   = 97  // { int socket(int domain, int type, \
-	SYS_CONNECT                  = 98  // { int connect(int s, caddr_t name, \
+	SYS_SETPRIORITY              = 96  // { int setpriority(int which, int who, int prio); }
+	SYS_SOCKET                   = 97  // { int socket(int domain, int type, int protocol); }
+	SYS_CONNECT                  = 98  // { int connect(int s, caddr_t name, int namelen); }
 	SYS_GETPRIORITY              = 100 // { int getpriority(int which, int who); }
-	SYS_BIND                     = 104 // { int bind(int s, caddr_t name, \
-	SYS_SETSOCKOPT               = 105 // { int setsockopt(int s, int level, int name, \
+	SYS_BIND                     = 104 // { int bind(int s, caddr_t name, int namelen); }
+	SYS_SETSOCKOPT               = 105 // { int setsockopt(int s, int level, int name, caddr_t val, int valsize); }
 	SYS_LISTEN                   = 106 // { int listen(int s, int backlog); }
-	SYS_GETTIMEOFDAY             = 116 // { int gettimeofday(struct timeval *tp, \
-	SYS_GETRUSAGE                = 117 // { int getrusage(int who, \
-	SYS_GETSOCKOPT               = 118 // { int getsockopt(int s, int level, int name, \
-	SYS_READV                    = 120 // { int readv(int fd, struct iovec *iovp, \
-	SYS_WRITEV                   = 121 // { int writev(int fd, struct iovec *iovp, \
-	SYS_SETTIMEOFDAY             = 122 // { int settimeofday(struct timeval *tv, \
+	SYS_GETTIMEOFDAY             = 116 // { int gettimeofday(struct timeval *tp, struct timezone *tzp); }
+	SYS_GETRUSAGE                = 117 // { int getrusage(int who, struct rusage *rusage); }
+	SYS_GETSOCKOPT               = 118 // { int getsockopt(int s, int level, int name, caddr_t val, int *avalsize); }
+	SYS_READV                    = 120 // { int readv(int fd, struct iovec *iovp, u_int iovcnt); }
+	SYS_WRITEV                   = 121 // { int writev(int fd, struct iovec *iovp, u_int iovcnt); }
+	SYS_SETTIMEOFDAY             = 122 // { int settimeofday(struct timeval *tv, struct timezone *tzp); }
 	SYS_FCHOWN                   = 123 // { int fchown(int fd, int uid, int gid); }
 	SYS_FCHMOD                   = 124 // { int fchmod(int fd, int mode); }
 	SYS_SETREUID                 = 126 // { int setreuid(int ruid, int euid); }
@@ -99,24 +100,24 @@ const (
 	SYS_RENAME                   = 128 // { int rename(char *from, char *to); }
 	SYS_FLOCK                    = 131 // { int flock(int fd, int how); }
 	SYS_MKFIFO                   = 132 // { int mkfifo(char *path, int mode); }
-	SYS_SENDTO                   = 133 // { int sendto(int s, caddr_t buf, size_t len, \
+	SYS_SENDTO                   = 133 // { int sendto(int s, caddr_t buf, size_t len, int flags, caddr_t to, int tolen); }
 	SYS_SHUTDOWN                 = 134 // { int shutdown(int s, int how); }
-	SYS_SOCKETPAIR               = 135 // { int socketpair(int domain, int type, \
+	SYS_SOCKETPAIR               = 135 // { int socketpair(int domain, int type, int protocol, int *rsv); }
 	SYS_MKDIR                    = 136 // { int mkdir(char *path, int mode); }
 	SYS_RMDIR                    = 137 // { int rmdir(char *path); }
-	SYS_UTIMES                   = 138 // { int utimes(char *path, \
-	SYS_ADJTIME                  = 140 // { int adjtime(struct timeval *delta, \
+	SYS_UTIMES                   = 138 // { int utimes(char *path, struct timeval *tptr); }
+	SYS_ADJTIME                  = 140 // { int adjtime(struct timeval *delta, struct timeval *olddelta); }
 	SYS_SETSID                   = 147 // { int setsid(void); }
-	SYS_QUOTACTL                 = 148 // { int quotactl(char *path, int cmd, int uid, \
+	SYS_QUOTACTL                 = 148 // { int quotactl(char *path, int cmd, int uid, caddr_t arg); }
 	SYS_NLM_SYSCALL              = 154 // { int nlm_syscall(int debug_level, int grace_period, int addr_count, char **addrs); }
 	SYS_NFSSVC                   = 155 // { int nfssvc(int flag, caddr_t argp); }
-	SYS_LGETFH                   = 160 // { int lgetfh(char *fname, \
-	SYS_GETFH                    = 161 // { int getfh(char *fname, \
+	SYS_LGETFH                   = 160 // { int lgetfh(char *fname, struct fhandle *fhp); }
+	SYS_GETFH                    = 161 // { int getfh(char *fname, struct fhandle *fhp); }
 	SYS_SYSARCH                  = 165 // { int sysarch(int op, char *parms); }
-	SYS_RTPRIO                   = 166 // { int rtprio(int function, pid_t pid, \
-	SYS_SEMSYS                   = 169 // { int semsys(int which, int a2, int a3, \
-	SYS_MSGSYS                   = 170 // { int msgsys(int which, int a2, int a3, \
-	SYS_SHMSYS                   = 171 // { int shmsys(int which, int a2, int a3, \
+	SYS_RTPRIO                   = 166 // { int rtprio(int function, pid_t pid, struct rtprio *rtp); }
+	SYS_SEMSYS                   = 169 // { int semsys(int which, int a2, int a3, int a4, int a5); }
+	SYS_MSGSYS                   = 170 // { int msgsys(int which, int a2, int a3, int a4, int a5, int a6); }
+	SYS_SHMSYS                   = 171 // { int shmsys(int which, int a2, int a3, int a4); }
 	SYS_SETFIB                   = 175 // { int setfib(int fibnum); }
 	SYS_NTP_ADJTIME              = 176 // { int ntp_adjtime(struct timex *tp); }
 	SYS_SETGID                   = 181 // { int setgid(gid_t gid); }
@@ -127,269 +128,269 @@ const (
 	SYS_LSTAT                    = 190 // { int lstat(char *path, struct stat *ub); }
 	SYS_PATHCONF                 = 191 // { int pathconf(char *path, int name); }
 	SYS_FPATHCONF                = 192 // { int fpathconf(int fd, int name); }
-	SYS_GETRLIMIT                = 194 // { int getrlimit(u_int which, \
-	SYS_SETRLIMIT                = 195 // { int setrlimit(u_int which, \
-	SYS_GETDIRENTRIES            = 196 // { int getdirentries(int fd, char *buf, \
-	SYS___SYSCTL                 = 202 // { int __sysctl(int *name, u_int namelen, \
+	SYS_GETRLIMIT                = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int
+	SYS_SETRLIMIT                = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int
+	SYS_GETDIRENTRIES            = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); }
+	SYS___SYSCTL                 = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int
 	SYS_MLOCK                    = 203 // { int mlock(const void *addr, size_t len); }
 	SYS_MUNLOCK                  = 204 // { int munlock(const void *addr, size_t len); }
 	SYS_UNDELETE                 = 205 // { int undelete(char *path); }
 	SYS_FUTIMES                  = 206 // { int futimes(int fd, struct timeval *tptr); }
 	SYS_GETPGID                  = 207 // { int getpgid(pid_t pid); }
-	SYS_POLL                     = 209 // { int poll(struct pollfd *fds, u_int nfds, \
-	SYS_SEMGET                   = 221 // { int semget(key_t key, int nsems, \
-	SYS_SEMOP                    = 222 // { int semop(int semid, struct sembuf *sops, \
+	SYS_POLL                     = 209 // { int poll(struct pollfd *fds, u_int nfds, int timeout); }
+	SYS_SEMGET                   = 221 // { int semget(key_t key, int nsems, int semflg); }
+	SYS_SEMOP                    = 222 // { int semop(int semid, struct sembuf *sops, size_t nsops); }
 	SYS_MSGGET                   = 225 // { int msgget(key_t key, int msgflg); }
-	SYS_MSGSND                   = 226 // { int msgsnd(int msqid, const void *msgp, \
-	SYS_MSGRCV                   = 227 // { int msgrcv(int msqid, void *msgp, \
-	SYS_SHMAT                    = 228 // { int shmat(int shmid, const void *shmaddr, \
+	SYS_MSGSND                   = 226 // { int msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); }
+	SYS_MSGRCV                   = 227 // { int msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); }
+	SYS_SHMAT                    = 228 // { int shmat(int shmid, const void *shmaddr, int shmflg); }
 	SYS_SHMDT                    = 230 // { int shmdt(const void *shmaddr); }
-	SYS_SHMGET                   = 231 // { int shmget(key_t key, size_t size, \
-	SYS_CLOCK_GETTIME            = 232 // { int clock_gettime(clockid_t clock_id, \
-	SYS_CLOCK_SETTIME            = 233 // { int clock_settime( \
-	SYS_CLOCK_GETRES             = 234 // { int clock_getres(clockid_t clock_id, \
-	SYS_KTIMER_CREATE            = 235 // { int ktimer_create(clockid_t clock_id, \
+	SYS_SHMGET                   = 231 // { int shmget(key_t key, size_t size, int shmflg); }
+	SYS_CLOCK_GETTIME            = 232 // { int clock_gettime(clockid_t clock_id, struct timespec *tp); }
+	SYS_CLOCK_SETTIME            = 233 // { int clock_settime( clockid_t clock_id, const struct timespec *tp); }
+	SYS_CLOCK_GETRES             = 234 // { int clock_getres(clockid_t clock_id, struct timespec *tp); }
+	SYS_KTIMER_CREATE            = 235 // { int ktimer_create(clockid_t clock_id, struct sigevent *evp, int *timerid); }
 	SYS_KTIMER_DELETE            = 236 // { int ktimer_delete(int timerid); }
-	SYS_KTIMER_SETTIME           = 237 // { int ktimer_settime(int timerid, int flags, \
-	SYS_KTIMER_GETTIME           = 238 // { int ktimer_gettime(int timerid, struct \
+	SYS_KTIMER_SETTIME           = 237 // { int ktimer_settime(int timerid, int flags, const struct itimerspec *value, struct itimerspec *ovalue); }
+	SYS_KTIMER_GETTIME           = 238 // { int ktimer_gettime(int timerid, struct itimerspec *value); }
 	SYS_KTIMER_GETOVERRUN        = 239 // { int ktimer_getoverrun(int timerid); }
-	SYS_NANOSLEEP                = 240 // { int nanosleep(const struct timespec *rqtp, \
+	SYS_NANOSLEEP                = 240 // { int nanosleep(const struct timespec *rqtp, struct timespec *rmtp); }
 	SYS_FFCLOCK_GETCOUNTER       = 241 // { int ffclock_getcounter(ffcounter *ffcount); }
-	SYS_FFCLOCK_SETESTIMATE      = 242 // { int ffclock_setestimate( \
-	SYS_FFCLOCK_GETESTIMATE      = 243 // { int ffclock_getestimate( \
-	SYS_CLOCK_NANOSLEEP          = 244 // { int clock_nanosleep(clockid_t clock_id, \
-	SYS_CLOCK_GETCPUCLOCKID2     = 247 // { int clock_getcpuclockid2(id_t id,\
+	SYS_FFCLOCK_SETESTIMATE      = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); }
+	SYS_FFCLOCK_GETESTIMATE      = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); }
+	SYS_CLOCK_NANOSLEEP          = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); }
+	SYS_CLOCK_GETCPUCLOCKID2     = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); }
 	SYS_NTP_GETTIME              = 248 // { int ntp_gettime(struct ntptimeval *ntvp); }
-	SYS_MINHERIT                 = 250 // { int minherit(void *addr, size_t len, \
+	SYS_MINHERIT                 = 250 // { int minherit(void *addr, size_t len, int inherit); }
 	SYS_RFORK                    = 251 // { int rfork(int flags); }
-	SYS_OPENBSD_POLL             = 252 // { int openbsd_poll(struct pollfd *fds, \
+	SYS_OPENBSD_POLL             = 252 // { int openbsd_poll(struct pollfd *fds, u_int nfds, int timeout); }
 	SYS_ISSETUGID                = 253 // { int issetugid(void); }
 	SYS_LCHOWN                   = 254 // { int lchown(char *path, int uid, int gid); }
 	SYS_AIO_READ                 = 255 // { int aio_read(struct aiocb *aiocbp); }
 	SYS_AIO_WRITE                = 256 // { int aio_write(struct aiocb *aiocbp); }
-	SYS_LIO_LISTIO               = 257 // { int lio_listio(int mode, \
-	SYS_GETDENTS                 = 272 // { int getdents(int fd, char *buf, \
+	SYS_LIO_LISTIO               = 257 // { int lio_listio(int mode, struct aiocb * const *acb_list, int nent, struct sigevent *sig); }
+	SYS_GETDENTS                 = 272 // { int getdents(int fd, char *buf, size_t count); }
 	SYS_LCHMOD                   = 274 // { int lchmod(char *path, mode_t mode); }
-	SYS_LUTIMES                  = 276 // { int lutimes(char *path, \
+	SYS_LUTIMES                  = 276 // { int lutimes(char *path, struct timeval *tptr); }
 	SYS_NSTAT                    = 278 // { int nstat(char *path, struct nstat *ub); }
 	SYS_NFSTAT                   = 279 // { int nfstat(int fd, struct nstat *sb); }
 	SYS_NLSTAT                   = 280 // { int nlstat(char *path, struct nstat *ub); }
-	SYS_PREADV                   = 289 // { ssize_t preadv(int fd, struct iovec *iovp, \
-	SYS_PWRITEV                  = 290 // { ssize_t pwritev(int fd, struct iovec *iovp, \
-	SYS_FHOPEN                   = 298 // { int fhopen(const struct fhandle *u_fhp, \
-	SYS_FHSTAT                   = 299 // { int fhstat(const struct fhandle *u_fhp, \
+	SYS_PREADV                   = 289 // { ssize_t preadv(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); }
+	SYS_PWRITEV                  = 290 // { ssize_t pwritev(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); }
+	SYS_FHOPEN                   = 298 // { int fhopen(const struct fhandle *u_fhp, int flags); }
+	SYS_FHSTAT                   = 299 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); }
 	SYS_MODNEXT                  = 300 // { int modnext(int modid); }
-	SYS_MODSTAT                  = 301 // { int modstat(int modid, \
+	SYS_MODSTAT                  = 301 // { int modstat(int modid, struct module_stat *stat); }
 	SYS_MODFNEXT                 = 302 // { int modfnext(int modid); }
 	SYS_MODFIND                  = 303 // { int modfind(const char *name); }
 	SYS_KLDLOAD                  = 304 // { int kldload(const char *file); }
 	SYS_KLDUNLOAD                = 305 // { int kldunload(int fileid); }
 	SYS_KLDFIND                  = 306 // { int kldfind(const char *file); }
 	SYS_KLDNEXT                  = 307 // { int kldnext(int fileid); }
-	SYS_KLDSTAT                  = 308 // { int kldstat(int fileid, struct \
+	SYS_KLDSTAT                  = 308 // { int kldstat(int fileid, struct kld_file_stat* stat); }
 	SYS_KLDFIRSTMOD              = 309 // { int kldfirstmod(int fileid); }
 	SYS_GETSID                   = 310 // { int getsid(pid_t pid); }
-	SYS_SETRESUID                = 311 // { int setresuid(uid_t ruid, uid_t euid, \
-	SYS_SETRESGID                = 312 // { int setresgid(gid_t rgid, gid_t egid, \
+	SYS_SETRESUID                = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); }
+	SYS_SETRESGID                = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); }
 	SYS_AIO_RETURN               = 314 // { ssize_t aio_return(struct aiocb *aiocbp); }
-	SYS_AIO_SUSPEND              = 315 // { int aio_suspend( \
-	SYS_AIO_CANCEL               = 316 // { int aio_cancel(int fd, \
+	SYS_AIO_SUSPEND              = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); }
+	SYS_AIO_CANCEL               = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); }
 	SYS_AIO_ERROR                = 317 // { int aio_error(struct aiocb *aiocbp); }
 	SYS_YIELD                    = 321 // { int yield(void); }
 	SYS_MLOCKALL                 = 324 // { int mlockall(int how); }
 	SYS_MUNLOCKALL               = 325 // { int munlockall(void); }
 	SYS___GETCWD                 = 326 // { int __getcwd(char *buf, u_int buflen); }
-	SYS_SCHED_SETPARAM           = 327 // { int sched_setparam (pid_t pid, \
-	SYS_SCHED_GETPARAM           = 328 // { int sched_getparam (pid_t pid, struct \
-	SYS_SCHED_SETSCHEDULER       = 329 // { int sched_setscheduler (pid_t pid, int \
+	SYS_SCHED_SETPARAM           = 327 // { int sched_setparam (pid_t pid, const struct sched_param *param); }
+	SYS_SCHED_GETPARAM           = 328 // { int sched_getparam (pid_t pid, struct sched_param *param); }
+	SYS_SCHED_SETSCHEDULER       = 329 // { int sched_setscheduler (pid_t pid, int policy, const struct sched_param *param); }
 	SYS_SCHED_GETSCHEDULER       = 330 // { int sched_getscheduler (pid_t pid); }
 	SYS_SCHED_YIELD              = 331 // { int sched_yield (void); }
 	SYS_SCHED_GET_PRIORITY_MAX   = 332 // { int sched_get_priority_max (int policy); }
 	SYS_SCHED_GET_PRIORITY_MIN   = 333 // { int sched_get_priority_min (int policy); }
-	SYS_SCHED_RR_GET_INTERVAL    = 334 // { int sched_rr_get_interval (pid_t pid, \
+	SYS_SCHED_RR_GET_INTERVAL    = 334 // { int sched_rr_get_interval (pid_t pid, struct timespec *interval); }
 	SYS_UTRACE                   = 335 // { int utrace(const void *addr, size_t len); }
-	SYS_KLDSYM                   = 337 // { int kldsym(int fileid, int cmd, \
+	SYS_KLDSYM                   = 337 // { int kldsym(int fileid, int cmd, void *data); }
 	SYS_JAIL                     = 338 // { int jail(struct jail *jail); }
-	SYS_SIGPROCMASK              = 340 // { int sigprocmask(int how, \
+	SYS_SIGPROCMASK              = 340 // { int sigprocmask(int how, const sigset_t *set, sigset_t *oset); }
 	SYS_SIGSUSPEND               = 341 // { int sigsuspend(const sigset_t *sigmask); }
 	SYS_SIGPENDING               = 343 // { int sigpending(sigset_t *set); }
-	SYS_SIGTIMEDWAIT             = 345 // { int sigtimedwait(const sigset_t *set, \
-	SYS_SIGWAITINFO              = 346 // { int sigwaitinfo(const sigset_t *set, \
-	SYS___ACL_GET_FILE           = 347 // { int __acl_get_file(const char *path, \
-	SYS___ACL_SET_FILE           = 348 // { int __acl_set_file(const char *path, \
-	SYS___ACL_GET_FD             = 349 // { int __acl_get_fd(int filedes, \
-	SYS___ACL_SET_FD             = 350 // { int __acl_set_fd(int filedes, \
-	SYS___ACL_DELETE_FILE        = 351 // { int __acl_delete_file(const char *path, \
-	SYS___ACL_DELETE_FD          = 352 // { int __acl_delete_fd(int filedes, \
-	SYS___ACL_ACLCHECK_FILE      = 353 // { int __acl_aclcheck_file(const char *path, \
-	SYS___ACL_ACLCHECK_FD        = 354 // { int __acl_aclcheck_fd(int filedes, \
-	SYS_EXTATTRCTL               = 355 // { int extattrctl(const char *path, int cmd, \
-	SYS_EXTATTR_SET_FILE         = 356 // { ssize_t extattr_set_file( \
-	SYS_EXTATTR_GET_FILE         = 357 // { ssize_t extattr_get_file( \
-	SYS_EXTATTR_DELETE_FILE      = 358 // { int extattr_delete_file(const char *path, \
-	SYS_AIO_WAITCOMPLETE         = 359 // { ssize_t aio_waitcomplete( \
-	SYS_GETRESUID                = 360 // { int getresuid(uid_t *ruid, uid_t *euid, \
-	SYS_GETRESGID                = 361 // { int getresgid(gid_t *rgid, gid_t *egid, \
+	SYS_SIGTIMEDWAIT             = 345 // { int sigtimedwait(const sigset_t *set, siginfo_t *info, const struct timespec *timeout); }
+	SYS_SIGWAITINFO              = 346 // { int sigwaitinfo(const sigset_t *set, siginfo_t *info); }
+	SYS___ACL_GET_FILE           = 347 // { int __acl_get_file(const char *path, acl_type_t type, struct acl *aclp); }
+	SYS___ACL_SET_FILE           = 348 // { int __acl_set_file(const char *path, acl_type_t type, struct acl *aclp); }
+	SYS___ACL_GET_FD             = 349 // { int __acl_get_fd(int filedes, acl_type_t type, struct acl *aclp); }
+	SYS___ACL_SET_FD             = 350 // { int __acl_set_fd(int filedes, acl_type_t type, struct acl *aclp); }
+	SYS___ACL_DELETE_FILE        = 351 // { int __acl_delete_file(const char *path, acl_type_t type); }
+	SYS___ACL_DELETE_FD          = 352 // { int __acl_delete_fd(int filedes, acl_type_t type); }
+	SYS___ACL_ACLCHECK_FILE      = 353 // { int __acl_aclcheck_file(const char *path, acl_type_t type, struct acl *aclp); }
+	SYS___ACL_ACLCHECK_FD        = 354 // { int __acl_aclcheck_fd(int filedes, acl_type_t type, struct acl *aclp); }
+	SYS_EXTATTRCTL               = 355 // { int extattrctl(const char *path, int cmd, const char *filename, int attrnamespace, const char *attrname); }
+	SYS_EXTATTR_SET_FILE         = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
+	SYS_EXTATTR_GET_FILE         = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
+	SYS_EXTATTR_DELETE_FILE      = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); }
+	SYS_AIO_WAITCOMPLETE         = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); }
+	SYS_GETRESUID                = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); }
+	SYS_GETRESGID                = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); }
 	SYS_KQUEUE                   = 362 // { int kqueue(void); }
-	SYS_KEVENT                   = 363 // { int kevent(int fd, \
-	SYS_EXTATTR_SET_FD           = 371 // { ssize_t extattr_set_fd(int fd, \
-	SYS_EXTATTR_GET_FD           = 372 // { ssize_t extattr_get_fd(int fd, \
-	SYS_EXTATTR_DELETE_FD        = 373 // { int extattr_delete_fd(int fd, \
+	SYS_KEVENT                   = 363 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); }
+	SYS_EXTATTR_SET_FD           = 371 // { ssize_t extattr_set_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
+	SYS_EXTATTR_GET_FD           = 372 // { ssize_t extattr_get_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
+	SYS_EXTATTR_DELETE_FD        = 373 // { int extattr_delete_fd(int fd, int attrnamespace, const char *attrname); }
 	SYS___SETUGID                = 374 // { int __setugid(int flag); }
 	SYS_EACCESS                  = 376 // { int eaccess(char *path, int amode); }
-	SYS_NMOUNT                   = 378 // { int nmount(struct iovec *iovp, \
+	SYS_NMOUNT                   = 378 // { int nmount(struct iovec *iovp, unsigned int iovcnt, int flags); }
 	SYS___MAC_GET_PROC           = 384 // { int __mac_get_proc(struct mac *mac_p); }
 	SYS___MAC_SET_PROC           = 385 // { int __mac_set_proc(struct mac *mac_p); }
-	SYS___MAC_GET_FD             = 386 // { int __mac_get_fd(int fd, \
-	SYS___MAC_GET_FILE           = 387 // { int __mac_get_file(const char *path_p, \
-	SYS___MAC_SET_FD             = 388 // { int __mac_set_fd(int fd, \
-	SYS___MAC_SET_FILE           = 389 // { int __mac_set_file(const char *path_p, \
-	SYS_KENV                     = 390 // { int kenv(int what, const char *name, \
-	SYS_LCHFLAGS                 = 391 // { int lchflags(const char *path, \
-	SYS_UUIDGEN                  = 392 // { int uuidgen(struct uuid *store, \
-	SYS_SENDFILE                 = 393 // { int sendfile(int fd, int s, off_t offset, \
-	SYS_MAC_SYSCALL              = 394 // { int mac_syscall(const char *policy, \
-	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, \
-	SYS_STATFS                   = 396 // { int statfs(char *path, \
+	SYS___MAC_GET_FD             = 386 // { int __mac_get_fd(int fd, struct mac *mac_p); }
+	SYS___MAC_GET_FILE           = 387 // { int __mac_get_file(const char *path_p, struct mac *mac_p); }
+	SYS___MAC_SET_FD             = 388 // { int __mac_set_fd(int fd, struct mac *mac_p); }
+	SYS___MAC_SET_FILE           = 389 // { int __mac_set_file(const char *path_p, struct mac *mac_p); }
+	SYS_KENV                     = 390 // { int kenv(int what, const char *name, char *value, int len); }
+	SYS_LCHFLAGS                 = 391 // { int lchflags(const char *path, u_long flags); }
+	SYS_UUIDGEN                  = 392 // { int uuidgen(struct uuid *store, int count); }
+	SYS_SENDFILE                 = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); }
+	SYS_MAC_SYSCALL              = 394 // { int mac_syscall(const char *policy, int call, void *arg); }
+	SYS_GETFSSTAT                = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); }
+	SYS_STATFS                   = 396 // { int statfs(char *path, struct statfs *buf); }
 	SYS_FSTATFS                  = 397 // { int fstatfs(int fd, struct statfs *buf); }
-	SYS_FHSTATFS                 = 398 // { int fhstatfs(const struct fhandle *u_fhp, \
+	SYS_FHSTATFS                 = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); }
 	SYS_KSEM_CLOSE               = 400 // { int ksem_close(semid_t id); }
 	SYS_KSEM_POST                = 401 // { int ksem_post(semid_t id); }
 	SYS_KSEM_WAIT                = 402 // { int ksem_wait(semid_t id); }
 	SYS_KSEM_TRYWAIT             = 403 // { int ksem_trywait(semid_t id); }
-	SYS_KSEM_INIT                = 404 // { int ksem_init(semid_t *idp, \
-	SYS_KSEM_OPEN                = 405 // { int ksem_open(semid_t *idp, \
+	SYS_KSEM_INIT                = 404 // { int ksem_init(semid_t *idp, unsigned int value); }
+	SYS_KSEM_OPEN                = 405 // { int ksem_open(semid_t *idp, const char *name, int oflag, mode_t mode, unsigned int value); }
 	SYS_KSEM_UNLINK              = 406 // { int ksem_unlink(const char *name); }
 	SYS_KSEM_GETVALUE            = 407 // { int ksem_getvalue(semid_t id, int *val); }
 	SYS_KSEM_DESTROY             = 408 // { int ksem_destroy(semid_t id); }
-	SYS___MAC_GET_PID            = 409 // { int __mac_get_pid(pid_t pid, \
-	SYS___MAC_GET_LINK           = 410 // { int __mac_get_link(const char *path_p, \
-	SYS___MAC_SET_LINK           = 411 // { int __mac_set_link(const char *path_p, \
-	SYS_EXTATTR_SET_LINK         = 412 // { ssize_t extattr_set_link( \
-	SYS_EXTATTR_GET_LINK         = 413 // { ssize_t extattr_get_link( \
-	SYS_EXTATTR_DELETE_LINK      = 414 // { int extattr_delete_link( \
-	SYS___MAC_EXECVE             = 415 // { int __mac_execve(char *fname, char **argv, \
-	SYS_SIGACTION                = 416 // { int sigaction(int sig, \
-	SYS_SIGRETURN                = 417 // { int sigreturn( \
+	SYS___MAC_GET_PID            = 409 // { int __mac_get_pid(pid_t pid, struct mac *mac_p); }
+	SYS___MAC_GET_LINK           = 410 // { int __mac_get_link(const char *path_p, struct mac *mac_p); }
+	SYS___MAC_SET_LINK           = 411 // { int __mac_set_link(const char *path_p, struct mac *mac_p); }
+	SYS_EXTATTR_SET_LINK         = 412 // { ssize_t extattr_set_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
+	SYS_EXTATTR_GET_LINK         = 413 // { ssize_t extattr_get_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); }
+	SYS_EXTATTR_DELETE_LINK      = 414 // { int extattr_delete_link( const char *path, int attrnamespace, const char *attrname); }
+	SYS___MAC_EXECVE             = 415 // { int __mac_execve(char *fname, char **argv, char **envv, struct mac *mac_p); }
+	SYS_SIGACTION                = 416 // { int sigaction(int sig, const struct sigaction *act, struct sigaction *oact); }
+	SYS_SIGRETURN                = 417 // { int sigreturn( const struct __ucontext *sigcntxp); }
 	SYS_GETCONTEXT               = 421 // { int getcontext(struct __ucontext *ucp); }
-	SYS_SETCONTEXT               = 422 // { int setcontext( \
-	SYS_SWAPCONTEXT              = 423 // { int swapcontext(struct __ucontext *oucp, \
+	SYS_SETCONTEXT               = 422 // { int setcontext( const struct __ucontext *ucp); }
+	SYS_SWAPCONTEXT              = 423 // { int swapcontext(struct __ucontext *oucp, const struct __ucontext *ucp); }
 	SYS_SWAPOFF                  = 424 // { int swapoff(const char *name); }
-	SYS___ACL_GET_LINK           = 425 // { int __acl_get_link(const char *path, \
-	SYS___ACL_SET_LINK           = 426 // { int __acl_set_link(const char *path, \
-	SYS___ACL_DELETE_LINK        = 427 // { int __acl_delete_link(const char *path, \
-	SYS___ACL_ACLCHECK_LINK      = 428 // { int __acl_aclcheck_link(const char *path, \
-	SYS_SIGWAIT                  = 429 // { int sigwait(const sigset_t *set, \
-	SYS_THR_CREATE               = 430 // { int thr_create(ucontext_t *ctx, long *id, \
+	SYS___ACL_GET_LINK           = 425 // { int __acl_get_link(const char *path, acl_type_t type, struct acl *aclp); }
+	SYS___ACL_SET_LINK           = 426 // { int __acl_set_link(const char *path, acl_type_t type, struct acl *aclp); }
+	SYS___ACL_DELETE_LINK        = 427 // { int __acl_delete_link(const char *path, acl_type_t type); }
+	SYS___ACL_ACLCHECK_LINK      = 428 // { int __acl_aclcheck_link(const char *path, acl_type_t type, struct acl *aclp); }
+	SYS_SIGWAIT                  = 429 // { int sigwait(const sigset_t *set, int *sig); }
+	SYS_THR_CREATE               = 430 // { int thr_create(ucontext_t *ctx, long *id, int flags); }
 	SYS_THR_EXIT                 = 431 // { void thr_exit(long *state); }
 	SYS_THR_SELF                 = 432 // { int thr_self(long *id); }
 	SYS_THR_KILL                 = 433 // { int thr_kill(long id, int sig); }
 	SYS_JAIL_ATTACH              = 436 // { int jail_attach(int jid); }
-	SYS_EXTATTR_LIST_FD          = 437 // { ssize_t extattr_list_fd(int fd, \
-	SYS_EXTATTR_LIST_FILE        = 438 // { ssize_t extattr_list_file( \
-	SYS_EXTATTR_LIST_LINK        = 439 // { ssize_t extattr_list_link( \
-	SYS_KSEM_TIMEDWAIT           = 441 // { int ksem_timedwait(semid_t id, \
-	SYS_THR_SUSPEND              = 442 // { int thr_suspend( \
+	SYS_EXTATTR_LIST_FD          = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); }
+	SYS_EXTATTR_LIST_FILE        = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); }
+	SYS_EXTATTR_LIST_LINK        = 439 // { ssize_t extattr_list_link( const char *path, int attrnamespace, void *data, size_t nbytes); }
+	SYS_KSEM_TIMEDWAIT           = 441 // { int ksem_timedwait(semid_t id, const struct timespec *abstime); }
+	SYS_THR_SUSPEND              = 442 // { int thr_suspend( const struct timespec *timeout); }
 	SYS_THR_WAKE                 = 443 // { int thr_wake(long id); }
 	SYS_KLDUNLOADF               = 444 // { int kldunloadf(int fileid, int flags); }
-	SYS_AUDIT                    = 445 // { int audit(const void *record, \
-	SYS_AUDITON                  = 446 // { int auditon(int cmd, void *data, \
+	SYS_AUDIT                    = 445 // { int audit(const void *record, u_int length); }
+	SYS_AUDITON                  = 446 // { int auditon(int cmd, void *data, u_int length); }
 	SYS_GETAUID                  = 447 // { int getauid(uid_t *auid); }
 	SYS_SETAUID                  = 448 // { int setauid(uid_t *auid); }
 	SYS_GETAUDIT                 = 449 // { int getaudit(struct auditinfo *auditinfo); }
 	SYS_SETAUDIT                 = 450 // { int setaudit(struct auditinfo *auditinfo); }
-	SYS_GETAUDIT_ADDR            = 451 // { int getaudit_addr( \
-	SYS_SETAUDIT_ADDR            = 452 // { int setaudit_addr( \
+	SYS_GETAUDIT_ADDR            = 451 // { int getaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); }
+	SYS_SETAUDIT_ADDR            = 452 // { int setaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); }
 	SYS_AUDITCTL                 = 453 // { int auditctl(char *path); }
-	SYS__UMTX_OP                 = 454 // { int _umtx_op(void *obj, int op, \
-	SYS_THR_NEW                  = 455 // { int thr_new(struct thr_param *param, \
+	SYS__UMTX_OP                 = 454 // { int _umtx_op(void *obj, int op, u_long val, void *uaddr1, void *uaddr2); }
+	SYS_THR_NEW                  = 455 // { int thr_new(struct thr_param *param, int param_size); }
 	SYS_SIGQUEUE                 = 456 // { int sigqueue(pid_t pid, int signum, void *value); }
-	SYS_KMQ_OPEN                 = 457 // { int kmq_open(const char *path, int flags, \
-	SYS_KMQ_SETATTR              = 458 // { int kmq_setattr(int mqd,		\
-	SYS_KMQ_TIMEDRECEIVE         = 459 // { int kmq_timedreceive(int mqd,	\
-	SYS_KMQ_TIMEDSEND            = 460 // { int kmq_timedsend(int mqd,		\
-	SYS_KMQ_NOTIFY               = 461 // { int kmq_notify(int mqd,		\
+	SYS_KMQ_OPEN                 = 457 // { int kmq_open(const char *path, int flags, mode_t mode, const struct mq_attr *attr); }
+	SYS_KMQ_SETATTR              = 458 // { int kmq_setattr(int mqd,		const struct mq_attr *attr,		struct mq_attr *oattr); }
+	SYS_KMQ_TIMEDRECEIVE         = 459 // { int kmq_timedreceive(int mqd,	char *msg_ptr, size_t msg_len,	unsigned *msg_prio,			const struct timespec *abs_timeout); }
+	SYS_KMQ_TIMEDSEND            = 460 // { int kmq_timedsend(int mqd,		const char *msg_ptr, size_t msg_len,unsigned msg_prio,			const struct timespec *abs_timeout);}
+	SYS_KMQ_NOTIFY               = 461 // { int kmq_notify(int mqd,		const struct sigevent *sigev); }
 	SYS_KMQ_UNLINK               = 462 // { int kmq_unlink(const char *path); }
 	SYS_ABORT2                   = 463 // { int abort2(const char *why, int nargs, void **args); }
 	SYS_THR_SET_NAME             = 464 // { int thr_set_name(long id, const char *name); }
 	SYS_AIO_FSYNC                = 465 // { int aio_fsync(int op, struct aiocb *aiocbp); }
-	SYS_RTPRIO_THREAD            = 466 // { int rtprio_thread(int function, \
+	SYS_RTPRIO_THREAD            = 466 // { int rtprio_thread(int function, lwpid_t lwpid, struct rtprio *rtp); }
 	SYS_SCTP_PEELOFF             = 471 // { int sctp_peeloff(int sd, uint32_t name); }
-	SYS_SCTP_GENERIC_SENDMSG     = 472 // { int sctp_generic_sendmsg(int sd, caddr_t msg, int mlen, \
-	SYS_SCTP_GENERIC_SENDMSG_IOV = 473 // { int sctp_generic_sendmsg_iov(int sd, struct iovec *iov, int iovlen, \
-	SYS_SCTP_GENERIC_RECVMSG     = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, \
-	SYS_PREAD                    = 475 // { ssize_t pread(int fd, void *buf, \
-	SYS_PWRITE                   = 476 // { ssize_t pwrite(int fd, const void *buf, \
-	SYS_MMAP                     = 477 // { caddr_t mmap(caddr_t addr, size_t len, \
-	SYS_LSEEK                    = 478 // { off_t lseek(int fd, off_t offset, \
+	SYS_SCTP_GENERIC_SENDMSG     = 472 // { int sctp_generic_sendmsg(int sd, caddr_t msg, int mlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); }
+	SYS_SCTP_GENERIC_SENDMSG_IOV = 473 // { int sctp_generic_sendmsg_iov(int sd, struct iovec *iov, int iovlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); }
+	SYS_SCTP_GENERIC_RECVMSG     = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr * from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); }
+	SYS_PREAD                    = 475 // { ssize_t pread(int fd, void *buf, size_t nbyte, off_t offset); }
+	SYS_PWRITE                   = 476 // { ssize_t pwrite(int fd, const void *buf, size_t nbyte, off_t offset); }
+	SYS_MMAP                     = 477 // { caddr_t mmap(caddr_t addr, size_t len, int prot, int flags, int fd, off_t pos); }
+	SYS_LSEEK                    = 478 // { off_t lseek(int fd, off_t offset, int whence); }
 	SYS_TRUNCATE                 = 479 // { int truncate(char *path, off_t length); }
 	SYS_FTRUNCATE                = 480 // { int ftruncate(int fd, off_t length); }
 	SYS_THR_KILL2                = 481 // { int thr_kill2(pid_t pid, long id, int sig); }
-	SYS_SHM_OPEN                 = 482 // { int shm_open(const char *path, int flags, \
+	SYS_SHM_OPEN                 = 482 // { int shm_open(const char *path, int flags, mode_t mode); }
 	SYS_SHM_UNLINK               = 483 // { int shm_unlink(const char *path); }
 	SYS_CPUSET                   = 484 // { int cpuset(cpusetid_t *setid); }
-	SYS_CPUSET_SETID             = 485 // { int cpuset_setid(cpuwhich_t which, id_t id, \
-	SYS_CPUSET_GETID             = 486 // { int cpuset_getid(cpulevel_t level, \
-	SYS_CPUSET_GETAFFINITY       = 487 // { int cpuset_getaffinity(cpulevel_t level, \
-	SYS_CPUSET_SETAFFINITY       = 488 // { int cpuset_setaffinity(cpulevel_t level, \
-	SYS_FACCESSAT                = 489 // { int faccessat(int fd, char *path, int amode, \
-	SYS_FCHMODAT                 = 490 // { int fchmodat(int fd, char *path, mode_t mode, \
-	SYS_FCHOWNAT                 = 491 // { int fchownat(int fd, char *path, uid_t uid, \
-	SYS_FEXECVE                  = 492 // { int fexecve(int fd, char **argv, \
-	SYS_FSTATAT                  = 493 // { int fstatat(int fd, char *path, \
-	SYS_FUTIMESAT                = 494 // { int futimesat(int fd, char *path, \
-	SYS_LINKAT                   = 495 // { int linkat(int fd1, char *path1, int fd2, \
+	SYS_CPUSET_SETID             = 485 // { int cpuset_setid(cpuwhich_t which, id_t id, cpusetid_t setid); }
+	SYS_CPUSET_GETID             = 486 // { int cpuset_getid(cpulevel_t level, cpuwhich_t which, id_t id, cpusetid_t *setid); }
+	SYS_CPUSET_GETAFFINITY       = 487 // { int cpuset_getaffinity(cpulevel_t level, cpuwhich_t which, id_t id, size_t cpusetsize, cpuset_t *mask); }
+	SYS_CPUSET_SETAFFINITY       = 488 // { int cpuset_setaffinity(cpulevel_t level, cpuwhich_t which, id_t id, size_t cpusetsize, const cpuset_t *mask); }
+	SYS_FACCESSAT                = 489 // { int faccessat(int fd, char *path, int amode, int flag); }
+	SYS_FCHMODAT                 = 490 // { int fchmodat(int fd, char *path, mode_t mode, int flag); }
+	SYS_FCHOWNAT                 = 491 // { int fchownat(int fd, char *path, uid_t uid, gid_t gid, int flag); }
+	SYS_FEXECVE                  = 492 // { int fexecve(int fd, char **argv, char **envv); }
+	SYS_FSTATAT                  = 493 // { int fstatat(int fd, char *path, struct stat *buf, int flag); }
+	SYS_FUTIMESAT                = 494 // { int futimesat(int fd, char *path, struct timeval *times); }
+	SYS_LINKAT                   = 495 // { int linkat(int fd1, char *path1, int fd2, char *path2, int flag); }
 	SYS_MKDIRAT                  = 496 // { int mkdirat(int fd, char *path, mode_t mode); }
 	SYS_MKFIFOAT                 = 497 // { int mkfifoat(int fd, char *path, mode_t mode); }
-	SYS_MKNODAT                  = 498 // { int mknodat(int fd, char *path, mode_t mode, \
-	SYS_OPENAT                   = 499 // { int openat(int fd, char *path, int flag, \
-	SYS_READLINKAT               = 500 // { int readlinkat(int fd, char *path, char *buf, \
-	SYS_RENAMEAT                 = 501 // { int renameat(int oldfd, char *old, int newfd, \
-	SYS_SYMLINKAT                = 502 // { int symlinkat(char *path1, int fd, \
+	SYS_MKNODAT                  = 498 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); }
+	SYS_OPENAT                   = 499 // { int openat(int fd, char *path, int flag, mode_t mode); }
+	SYS_READLINKAT               = 500 // { int readlinkat(int fd, char *path, char *buf, size_t bufsize); }
+	SYS_RENAMEAT                 = 501 // { int renameat(int oldfd, char *old, int newfd, char *new); }
+	SYS_SYMLINKAT                = 502 // { int symlinkat(char *path1, int fd, char *path2); }
 	SYS_UNLINKAT                 = 503 // { int unlinkat(int fd, char *path, int flag); }
 	SYS_POSIX_OPENPT             = 504 // { int posix_openpt(int flags); }
 	SYS_GSSD_SYSCALL             = 505 // { int gssd_syscall(char *path); }
-	SYS_JAIL_GET                 = 506 // { int jail_get(struct iovec *iovp, \
-	SYS_JAIL_SET                 = 507 // { int jail_set(struct iovec *iovp, \
+	SYS_JAIL_GET                 = 506 // { int jail_get(struct iovec *iovp, unsigned int iovcnt, int flags); }
+	SYS_JAIL_SET                 = 507 // { int jail_set(struct iovec *iovp, unsigned int iovcnt, int flags); }
 	SYS_JAIL_REMOVE              = 508 // { int jail_remove(int jid); }
 	SYS_CLOSEFROM                = 509 // { int closefrom(int lowfd); }
-	SYS___SEMCTL                 = 510 // { int __semctl(int semid, int semnum, \
-	SYS_MSGCTL                   = 511 // { int msgctl(int msqid, int cmd, \
-	SYS_SHMCTL                   = 512 // { int shmctl(int shmid, int cmd, \
+	SYS___SEMCTL                 = 510 // { int __semctl(int semid, int semnum, int cmd, union semun *arg); }
+	SYS_MSGCTL                   = 511 // { int msgctl(int msqid, int cmd, struct msqid_ds *buf); }
+	SYS_SHMCTL                   = 512 // { int shmctl(int shmid, int cmd, struct shmid_ds *buf); }
 	SYS_LPATHCONF                = 513 // { int lpathconf(char *path, int name); }
-	SYS___CAP_RIGHTS_GET         = 515 // { int __cap_rights_get(int version, \
+	SYS___CAP_RIGHTS_GET         = 515 // { int __cap_rights_get(int version, int fd, cap_rights_t *rightsp); }
 	SYS_CAP_ENTER                = 516 // { int cap_enter(void); }
 	SYS_CAP_GETMODE              = 517 // { int cap_getmode(u_int *modep); }
 	SYS_PDFORK                   = 518 // { int pdfork(int *fdp, int flags); }
 	SYS_PDKILL                   = 519 // { int pdkill(int fd, int signum); }
 	SYS_PDGETPID                 = 520 // { int pdgetpid(int fd, pid_t *pidp); }
-	SYS_PSELECT                  = 522 // { int pselect(int nd, fd_set *in, \
-	SYS_GETLOGINCLASS            = 523 // { int getloginclass(char *namebuf, \
+	SYS_PSELECT                  = 522 // { int pselect(int nd, fd_set *in, fd_set *ou, fd_set *ex, const struct timespec *ts, const sigset_t *sm); }
+	SYS_GETLOGINCLASS            = 523 // { int getloginclass(char *namebuf, size_t namelen); }
 	SYS_SETLOGINCLASS            = 524 // { int setloginclass(const char *namebuf); }
-	SYS_RCTL_GET_RACCT           = 525 // { int rctl_get_racct(const void *inbufp, \
-	SYS_RCTL_GET_RULES           = 526 // { int rctl_get_rules(const void *inbufp, \
-	SYS_RCTL_GET_LIMITS          = 527 // { int rctl_get_limits(const void *inbufp, \
-	SYS_RCTL_ADD_RULE            = 528 // { int rctl_add_rule(const void *inbufp, \
-	SYS_RCTL_REMOVE_RULE         = 529 // { int rctl_remove_rule(const void *inbufp, \
-	SYS_POSIX_FALLOCATE          = 530 // { int posix_fallocate(int fd, \
-	SYS_POSIX_FADVISE            = 531 // { int posix_fadvise(int fd, off_t offset, \
-	SYS_WAIT6                    = 532 // { int wait6(idtype_t idtype, id_t id, \
-	SYS_CAP_RIGHTS_LIMIT         = 533 // { int cap_rights_limit(int fd, \
-	SYS_CAP_IOCTLS_LIMIT         = 534 // { int cap_ioctls_limit(int fd, \
-	SYS_CAP_IOCTLS_GET           = 535 // { ssize_t cap_ioctls_get(int fd, \
-	SYS_CAP_FCNTLS_LIMIT         = 536 // { int cap_fcntls_limit(int fd, \
-	SYS_CAP_FCNTLS_GET           = 537 // { int cap_fcntls_get(int fd, \
-	SYS_BINDAT                   = 538 // { int bindat(int fd, int s, caddr_t name, \
-	SYS_CONNECTAT                = 539 // { int connectat(int fd, int s, caddr_t name, \
-	SYS_CHFLAGSAT                = 540 // { int chflagsat(int fd, const char *path, \
-	SYS_ACCEPT4                  = 541 // { int accept4(int s, \
+	SYS_RCTL_GET_RACCT           = 525 // { int rctl_get_racct(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); }
+	SYS_RCTL_GET_RULES           = 526 // { int rctl_get_rules(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); }
+	SYS_RCTL_GET_LIMITS          = 527 // { int rctl_get_limits(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); }
+	SYS_RCTL_ADD_RULE            = 528 // { int rctl_add_rule(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); }
+	SYS_RCTL_REMOVE_RULE         = 529 // { int rctl_remove_rule(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); }
+	SYS_POSIX_FALLOCATE          = 530 // { int posix_fallocate(int fd, off_t offset, off_t len); }
+	SYS_POSIX_FADVISE            = 531 // { int posix_fadvise(int fd, off_t offset, off_t len, int advice); }
+	SYS_WAIT6                    = 532 // { int wait6(idtype_t idtype, id_t id, int *status, int options, struct __wrusage *wrusage, siginfo_t *info); }
+	SYS_CAP_RIGHTS_LIMIT         = 533 // { int cap_rights_limit(int fd, cap_rights_t *rightsp); }
+	SYS_CAP_IOCTLS_LIMIT         = 534 // { int cap_ioctls_limit(int fd, const u_long *cmds, size_t ncmds); }
+	SYS_CAP_IOCTLS_GET           = 535 // { ssize_t cap_ioctls_get(int fd, u_long *cmds, size_t maxcmds); }
+	SYS_CAP_FCNTLS_LIMIT         = 536 // { int cap_fcntls_limit(int fd, uint32_t fcntlrights); }
+	SYS_CAP_FCNTLS_GET           = 537 // { int cap_fcntls_get(int fd, uint32_t *fcntlrightsp); }
+	SYS_BINDAT                   = 538 // { int bindat(int fd, int s, caddr_t name, int namelen); }
+	SYS_CONNECTAT                = 539 // { int connectat(int fd, int s, caddr_t name, int namelen); }
+	SYS_CHFLAGSAT                = 540 // { int chflagsat(int fd, const char *path, u_long flags, int atflag); }
+	SYS_ACCEPT4                  = 541 // { int accept4(int s, struct sockaddr * __restrict name, __socklen_t * __restrict anamelen, int flags); }
 	SYS_PIPE2                    = 542 // { int pipe2(int *fildes, int flags); }
 	SYS_AIO_MLOCK                = 543 // { int aio_mlock(struct aiocb *aiocbp); }
-	SYS_PROCCTL                  = 544 // { int procctl(idtype_t idtype, id_t id, \
-	SYS_PPOLL                    = 545 // { int ppoll(struct pollfd *fds, u_int nfds, \
-	SYS_FUTIMENS                 = 546 // { int futimens(int fd, \
-	SYS_UTIMENSAT                = 547 // { int utimensat(int fd, \
-	SYS_NUMA_GETAFFINITY         = 548 // { int numa_getaffinity(cpuwhich_t which, \
-	SYS_NUMA_SETAFFINITY         = 549 // { int numa_setaffinity(cpuwhich_t which, \
+	SYS_PROCCTL                  = 544 // { int procctl(idtype_t idtype, id_t id, int com, void *data); }
+	SYS_PPOLL                    = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); }
+	SYS_FUTIMENS                 = 546 // { int futimens(int fd, struct timespec *times); }
+	SYS_UTIMENSAT                = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); }
+	SYS_NUMA_GETAFFINITY         = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); }
+	SYS_NUMA_SETAFFINITY         = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); }
 	SYS_FDATASYNC                = 550 // { int fdatasync(int fd); }
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go
index 8d17873..33b6e4d 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go
@@ -6,387 +6,421 @@
 package unix
 
 const (
-	SYS_RESTART_SYSCALL        = 0
-	SYS_EXIT                   = 1
-	SYS_FORK                   = 2
-	SYS_READ                   = 3
-	SYS_WRITE                  = 4
-	SYS_OPEN                   = 5
-	SYS_CLOSE                  = 6
-	SYS_WAITPID                = 7
-	SYS_CREAT                  = 8
-	SYS_LINK                   = 9
-	SYS_UNLINK                 = 10
-	SYS_EXECVE                 = 11
-	SYS_CHDIR                  = 12
-	SYS_TIME                   = 13
-	SYS_MKNOD                  = 14
-	SYS_CHMOD                  = 15
-	SYS_LCHOWN                 = 16
-	SYS_BREAK                  = 17
-	SYS_OLDSTAT                = 18
-	SYS_LSEEK                  = 19
-	SYS_GETPID                 = 20
-	SYS_MOUNT                  = 21
-	SYS_UMOUNT                 = 22
-	SYS_SETUID                 = 23
-	SYS_GETUID                 = 24
-	SYS_STIME                  = 25
-	SYS_PTRACE                 = 26
-	SYS_ALARM                  = 27
-	SYS_OLDFSTAT               = 28
-	SYS_PAUSE                  = 29
-	SYS_UTIME                  = 30
-	SYS_STTY                   = 31
-	SYS_GTTY                   = 32
-	SYS_ACCESS                 = 33
-	SYS_NICE                   = 34
-	SYS_FTIME                  = 35
-	SYS_SYNC                   = 36
-	SYS_KILL                   = 37
-	SYS_RENAME                 = 38
-	SYS_MKDIR                  = 39
-	SYS_RMDIR                  = 40
-	SYS_DUP                    = 41
-	SYS_PIPE                   = 42
-	SYS_TIMES                  = 43
-	SYS_PROF                   = 44
-	SYS_BRK                    = 45
-	SYS_SETGID                 = 46
-	SYS_GETGID                 = 47
-	SYS_SIGNAL                 = 48
-	SYS_GETEUID                = 49
-	SYS_GETEGID                = 50
-	SYS_ACCT                   = 51
-	SYS_UMOUNT2                = 52
-	SYS_LOCK                   = 53
-	SYS_IOCTL                  = 54
-	SYS_FCNTL                  = 55
-	SYS_MPX                    = 56
-	SYS_SETPGID                = 57
-	SYS_ULIMIT                 = 58
-	SYS_OLDOLDUNAME            = 59
-	SYS_UMASK                  = 60
-	SYS_CHROOT                 = 61
-	SYS_USTAT                  = 62
-	SYS_DUP2                   = 63
-	SYS_GETPPID                = 64
-	SYS_GETPGRP                = 65
-	SYS_SETSID                 = 66
-	SYS_SIGACTION              = 67
-	SYS_SGETMASK               = 68
-	SYS_SSETMASK               = 69
-	SYS_SETREUID               = 70
-	SYS_SETREGID               = 71
-	SYS_SIGSUSPEND             = 72
-	SYS_SIGPENDING             = 73
-	SYS_SETHOSTNAME            = 74
-	SYS_SETRLIMIT              = 75
-	SYS_GETRLIMIT              = 76
-	SYS_GETRUSAGE              = 77
-	SYS_GETTIMEOFDAY           = 78
-	SYS_SETTIMEOFDAY           = 79
-	SYS_GETGROUPS              = 80
-	SYS_SETGROUPS              = 81
-	SYS_SELECT                 = 82
-	SYS_SYMLINK                = 83
-	SYS_OLDLSTAT               = 84
-	SYS_READLINK               = 85
-	SYS_USELIB                 = 86
-	SYS_SWAPON                 = 87
-	SYS_REBOOT                 = 88
-	SYS_READDIR                = 89
-	SYS_MMAP                   = 90
-	SYS_MUNMAP                 = 91
-	SYS_TRUNCATE               = 92
-	SYS_FTRUNCATE              = 93
-	SYS_FCHMOD                 = 94
-	SYS_FCHOWN                 = 95
-	SYS_GETPRIORITY            = 96
-	SYS_SETPRIORITY            = 97
-	SYS_PROFIL                 = 98
-	SYS_STATFS                 = 99
-	SYS_FSTATFS                = 100
-	SYS_IOPERM                 = 101
-	SYS_SOCKETCALL             = 102
-	SYS_SYSLOG                 = 103
-	SYS_SETITIMER              = 104
-	SYS_GETITIMER              = 105
-	SYS_STAT                   = 106
-	SYS_LSTAT                  = 107
-	SYS_FSTAT                  = 108
-	SYS_OLDUNAME               = 109
-	SYS_IOPL                   = 110
-	SYS_VHANGUP                = 111
-	SYS_IDLE                   = 112
-	SYS_VM86OLD                = 113
-	SYS_WAIT4                  = 114
-	SYS_SWAPOFF                = 115
-	SYS_SYSINFO                = 116
-	SYS_IPC                    = 117
-	SYS_FSYNC                  = 118
-	SYS_SIGRETURN              = 119
-	SYS_CLONE                  = 120
-	SYS_SETDOMAINNAME          = 121
-	SYS_UNAME                  = 122
-	SYS_MODIFY_LDT             = 123
-	SYS_ADJTIMEX               = 124
-	SYS_MPROTECT               = 125
-	SYS_SIGPROCMASK            = 126
-	SYS_CREATE_MODULE          = 127
-	SYS_INIT_MODULE            = 128
-	SYS_DELETE_MODULE          = 129
-	SYS_GET_KERNEL_SYMS        = 130
-	SYS_QUOTACTL               = 131
-	SYS_GETPGID                = 132
-	SYS_FCHDIR                 = 133
-	SYS_BDFLUSH                = 134
-	SYS_SYSFS                  = 135
-	SYS_PERSONALITY            = 136
-	SYS_AFS_SYSCALL            = 137
-	SYS_SETFSUID               = 138
-	SYS_SETFSGID               = 139
-	SYS__LLSEEK                = 140
-	SYS_GETDENTS               = 141
-	SYS__NEWSELECT             = 142
-	SYS_FLOCK                  = 143
-	SYS_MSYNC                  = 144
-	SYS_READV                  = 145
-	SYS_WRITEV                 = 146
-	SYS_GETSID                 = 147
-	SYS_FDATASYNC              = 148
-	SYS__SYSCTL                = 149
-	SYS_MLOCK                  = 150
-	SYS_MUNLOCK                = 151
-	SYS_MLOCKALL               = 152
-	SYS_MUNLOCKALL             = 153
-	SYS_SCHED_SETPARAM         = 154
-	SYS_SCHED_GETPARAM         = 155
-	SYS_SCHED_SETSCHEDULER     = 156
-	SYS_SCHED_GETSCHEDULER     = 157
-	SYS_SCHED_YIELD            = 158
-	SYS_SCHED_GET_PRIORITY_MAX = 159
-	SYS_SCHED_GET_PRIORITY_MIN = 160
-	SYS_SCHED_RR_GET_INTERVAL  = 161
-	SYS_NANOSLEEP              = 162
-	SYS_MREMAP                 = 163
-	SYS_SETRESUID              = 164
-	SYS_GETRESUID              = 165
-	SYS_VM86                   = 166
-	SYS_QUERY_MODULE           = 167
-	SYS_POLL                   = 168
-	SYS_NFSSERVCTL             = 169
-	SYS_SETRESGID              = 170
-	SYS_GETRESGID              = 171
-	SYS_PRCTL                  = 172
-	SYS_RT_SIGRETURN           = 173
-	SYS_RT_SIGACTION           = 174
-	SYS_RT_SIGPROCMASK         = 175
-	SYS_RT_SIGPENDING          = 176
-	SYS_RT_SIGTIMEDWAIT        = 177
-	SYS_RT_SIGQUEUEINFO        = 178
-	SYS_RT_SIGSUSPEND          = 179
-	SYS_PREAD64                = 180
-	SYS_PWRITE64               = 181
-	SYS_CHOWN                  = 182
-	SYS_GETCWD                 = 183
-	SYS_CAPGET                 = 184
-	SYS_CAPSET                 = 185
-	SYS_SIGALTSTACK            = 186
-	SYS_SENDFILE               = 187
-	SYS_GETPMSG                = 188
-	SYS_PUTPMSG                = 189
-	SYS_VFORK                  = 190
-	SYS_UGETRLIMIT             = 191
-	SYS_MMAP2                  = 192
-	SYS_TRUNCATE64             = 193
-	SYS_FTRUNCATE64            = 194
-	SYS_STAT64                 = 195
-	SYS_LSTAT64                = 196
-	SYS_FSTAT64                = 197
-	SYS_LCHOWN32               = 198
-	SYS_GETUID32               = 199
-	SYS_GETGID32               = 200
-	SYS_GETEUID32              = 201
-	SYS_GETEGID32              = 202
-	SYS_SETREUID32             = 203
-	SYS_SETREGID32             = 204
-	SYS_GETGROUPS32            = 205
-	SYS_SETGROUPS32            = 206
-	SYS_FCHOWN32               = 207
-	SYS_SETRESUID32            = 208
-	SYS_GETRESUID32            = 209
-	SYS_SETRESGID32            = 210
-	SYS_GETRESGID32            = 211
-	SYS_CHOWN32                = 212
-	SYS_SETUID32               = 213
-	SYS_SETGID32               = 214
-	SYS_SETFSUID32             = 215
-	SYS_SETFSGID32             = 216
-	SYS_PIVOT_ROOT             = 217
-	SYS_MINCORE                = 218
-	SYS_MADVISE                = 219
-	SYS_GETDENTS64             = 220
-	SYS_FCNTL64                = 221
-	SYS_GETTID                 = 224
-	SYS_READAHEAD              = 225
-	SYS_SETXATTR               = 226
-	SYS_LSETXATTR              = 227
-	SYS_FSETXATTR              = 228
-	SYS_GETXATTR               = 229
-	SYS_LGETXATTR              = 230
-	SYS_FGETXATTR              = 231
-	SYS_LISTXATTR              = 232
-	SYS_LLISTXATTR             = 233
-	SYS_FLISTXATTR             = 234
-	SYS_REMOVEXATTR            = 235
-	SYS_LREMOVEXATTR           = 236
-	SYS_FREMOVEXATTR           = 237
-	SYS_TKILL                  = 238
-	SYS_SENDFILE64             = 239
-	SYS_FUTEX                  = 240
-	SYS_SCHED_SETAFFINITY      = 241
-	SYS_SCHED_GETAFFINITY      = 242
-	SYS_SET_THREAD_AREA        = 243
-	SYS_GET_THREAD_AREA        = 244
-	SYS_IO_SETUP               = 245
-	SYS_IO_DESTROY             = 246
-	SYS_IO_GETEVENTS           = 247
-	SYS_IO_SUBMIT              = 248
-	SYS_IO_CANCEL              = 249
-	SYS_FADVISE64              = 250
-	SYS_EXIT_GROUP             = 252
-	SYS_LOOKUP_DCOOKIE         = 253
-	SYS_EPOLL_CREATE           = 254
-	SYS_EPOLL_CTL              = 255
-	SYS_EPOLL_WAIT             = 256
-	SYS_REMAP_FILE_PAGES       = 257
-	SYS_SET_TID_ADDRESS        = 258
-	SYS_TIMER_CREATE           = 259
-	SYS_TIMER_SETTIME          = 260
-	SYS_TIMER_GETTIME          = 261
-	SYS_TIMER_GETOVERRUN       = 262
-	SYS_TIMER_DELETE           = 263
-	SYS_CLOCK_SETTIME          = 264
-	SYS_CLOCK_GETTIME          = 265
-	SYS_CLOCK_GETRES           = 266
-	SYS_CLOCK_NANOSLEEP        = 267
-	SYS_STATFS64               = 268
-	SYS_FSTATFS64              = 269
-	SYS_TGKILL                 = 270
-	SYS_UTIMES                 = 271
-	SYS_FADVISE64_64           = 272
-	SYS_VSERVER                = 273
-	SYS_MBIND                  = 274
-	SYS_GET_MEMPOLICY          = 275
-	SYS_SET_MEMPOLICY          = 276
-	SYS_MQ_OPEN                = 277
-	SYS_MQ_UNLINK              = 278
-	SYS_MQ_TIMEDSEND           = 279
-	SYS_MQ_TIMEDRECEIVE        = 280
-	SYS_MQ_NOTIFY              = 281
-	SYS_MQ_GETSETATTR          = 282
-	SYS_KEXEC_LOAD             = 283
-	SYS_WAITID                 = 284
-	SYS_ADD_KEY                = 286
-	SYS_REQUEST_KEY            = 287
-	SYS_KEYCTL                 = 288
-	SYS_IOPRIO_SET             = 289
-	SYS_IOPRIO_GET             = 290
-	SYS_INOTIFY_INIT           = 291
-	SYS_INOTIFY_ADD_WATCH      = 292
-	SYS_INOTIFY_RM_WATCH       = 293
-	SYS_MIGRATE_PAGES          = 294
-	SYS_OPENAT                 = 295
-	SYS_MKDIRAT                = 296
-	SYS_MKNODAT                = 297
-	SYS_FCHOWNAT               = 298
-	SYS_FUTIMESAT              = 299
-	SYS_FSTATAT64              = 300
-	SYS_UNLINKAT               = 301
-	SYS_RENAMEAT               = 302
-	SYS_LINKAT                 = 303
-	SYS_SYMLINKAT              = 304
-	SYS_READLINKAT             = 305
-	SYS_FCHMODAT               = 306
-	SYS_FACCESSAT              = 307
-	SYS_PSELECT6               = 308
-	SYS_PPOLL                  = 309
-	SYS_UNSHARE                = 310
-	SYS_SET_ROBUST_LIST        = 311
-	SYS_GET_ROBUST_LIST        = 312
-	SYS_SPLICE                 = 313
-	SYS_SYNC_FILE_RANGE        = 314
-	SYS_TEE                    = 315
-	SYS_VMSPLICE               = 316
-	SYS_MOVE_PAGES             = 317
-	SYS_GETCPU                 = 318
-	SYS_EPOLL_PWAIT            = 319
-	SYS_UTIMENSAT              = 320
-	SYS_SIGNALFD               = 321
-	SYS_TIMERFD_CREATE         = 322
-	SYS_EVENTFD                = 323
-	SYS_FALLOCATE              = 324
-	SYS_TIMERFD_SETTIME        = 325
-	SYS_TIMERFD_GETTIME        = 326
-	SYS_SIGNALFD4              = 327
-	SYS_EVENTFD2               = 328
-	SYS_EPOLL_CREATE1          = 329
-	SYS_DUP3                   = 330
-	SYS_PIPE2                  = 331
-	SYS_INOTIFY_INIT1          = 332
-	SYS_PREADV                 = 333
-	SYS_PWRITEV                = 334
-	SYS_RT_TGSIGQUEUEINFO      = 335
-	SYS_PERF_EVENT_OPEN        = 336
-	SYS_RECVMMSG               = 337
-	SYS_FANOTIFY_INIT          = 338
-	SYS_FANOTIFY_MARK          = 339
-	SYS_PRLIMIT64              = 340
-	SYS_NAME_TO_HANDLE_AT      = 341
-	SYS_OPEN_BY_HANDLE_AT      = 342
-	SYS_CLOCK_ADJTIME          = 343
-	SYS_SYNCFS                 = 344
-	SYS_SENDMMSG               = 345
-	SYS_SETNS                  = 346
-	SYS_PROCESS_VM_READV       = 347
-	SYS_PROCESS_VM_WRITEV      = 348
-	SYS_KCMP                   = 349
-	SYS_FINIT_MODULE           = 350
-	SYS_SCHED_SETATTR          = 351
-	SYS_SCHED_GETATTR          = 352
-	SYS_RENAMEAT2              = 353
-	SYS_SECCOMP                = 354
-	SYS_GETRANDOM              = 355
-	SYS_MEMFD_CREATE           = 356
-	SYS_BPF                    = 357
-	SYS_EXECVEAT               = 358
-	SYS_SOCKET                 = 359
-	SYS_SOCKETPAIR             = 360
-	SYS_BIND                   = 361
-	SYS_CONNECT                = 362
-	SYS_LISTEN                 = 363
-	SYS_ACCEPT4                = 364
-	SYS_GETSOCKOPT             = 365
-	SYS_SETSOCKOPT             = 366
-	SYS_GETSOCKNAME            = 367
-	SYS_GETPEERNAME            = 368
-	SYS_SENDTO                 = 369
-	SYS_SENDMSG                = 370
-	SYS_RECVFROM               = 371
-	SYS_RECVMSG                = 372
-	SYS_SHUTDOWN               = 373
-	SYS_USERFAULTFD            = 374
-	SYS_MEMBARRIER             = 375
-	SYS_MLOCK2                 = 376
-	SYS_COPY_FILE_RANGE        = 377
-	SYS_PREADV2                = 378
-	SYS_PWRITEV2               = 379
-	SYS_PKEY_MPROTECT          = 380
-	SYS_PKEY_ALLOC             = 381
-	SYS_PKEY_FREE              = 382
-	SYS_STATX                  = 383
-	SYS_ARCH_PRCTL             = 384
-	SYS_IO_PGETEVENTS          = 385
-	SYS_RSEQ                   = 386
+	SYS_RESTART_SYSCALL              = 0
+	SYS_EXIT                         = 1
+	SYS_FORK                         = 2
+	SYS_READ                         = 3
+	SYS_WRITE                        = 4
+	SYS_OPEN                         = 5
+	SYS_CLOSE                        = 6
+	SYS_WAITPID                      = 7
+	SYS_CREAT                        = 8
+	SYS_LINK                         = 9
+	SYS_UNLINK                       = 10
+	SYS_EXECVE                       = 11
+	SYS_CHDIR                        = 12
+	SYS_TIME                         = 13
+	SYS_MKNOD                        = 14
+	SYS_CHMOD                        = 15
+	SYS_LCHOWN                       = 16
+	SYS_BREAK                        = 17
+	SYS_OLDSTAT                      = 18
+	SYS_LSEEK                        = 19
+	SYS_GETPID                       = 20
+	SYS_MOUNT                        = 21
+	SYS_UMOUNT                       = 22
+	SYS_SETUID                       = 23
+	SYS_GETUID                       = 24
+	SYS_STIME                        = 25
+	SYS_PTRACE                       = 26
+	SYS_ALARM                        = 27
+	SYS_OLDFSTAT                     = 28
+	SYS_PAUSE                        = 29
+	SYS_UTIME                        = 30
+	SYS_STTY                         = 31
+	SYS_GTTY                         = 32
+	SYS_ACCESS                       = 33
+	SYS_NICE                         = 34
+	SYS_FTIME                        = 35
+	SYS_SYNC                         = 36
+	SYS_KILL                         = 37
+	SYS_RENAME                       = 38
+	SYS_MKDIR                        = 39
+	SYS_RMDIR                        = 40
+	SYS_DUP                          = 41
+	SYS_PIPE                         = 42
+	SYS_TIMES                        = 43
+	SYS_PROF                         = 44
+	SYS_BRK                          = 45
+	SYS_SETGID                       = 46
+	SYS_GETGID                       = 47
+	SYS_SIGNAL                       = 48
+	SYS_GETEUID                      = 49
+	SYS_GETEGID                      = 50
+	SYS_ACCT                         = 51
+	SYS_UMOUNT2                      = 52
+	SYS_LOCK                         = 53
+	SYS_IOCTL                        = 54
+	SYS_FCNTL                        = 55
+	SYS_MPX                          = 56
+	SYS_SETPGID                      = 57
+	SYS_ULIMIT                       = 58
+	SYS_OLDOLDUNAME                  = 59
+	SYS_UMASK                        = 60
+	SYS_CHROOT                       = 61
+	SYS_USTAT                        = 62
+	SYS_DUP2                         = 63
+	SYS_GETPPID                      = 64
+	SYS_GETPGRP                      = 65
+	SYS_SETSID                       = 66
+	SYS_SIGACTION                    = 67
+	SYS_SGETMASK                     = 68
+	SYS_SSETMASK                     = 69
+	SYS_SETREUID                     = 70
+	SYS_SETREGID                     = 71
+	SYS_SIGSUSPEND                   = 72
+	SYS_SIGPENDING                   = 73
+	SYS_SETHOSTNAME                  = 74
+	SYS_SETRLIMIT                    = 75
+	SYS_GETRLIMIT                    = 76
+	SYS_GETRUSAGE                    = 77
+	SYS_GETTIMEOFDAY                 = 78
+	SYS_SETTIMEOFDAY                 = 79
+	SYS_GETGROUPS                    = 80
+	SYS_SETGROUPS                    = 81
+	SYS_SELECT                       = 82
+	SYS_SYMLINK                      = 83
+	SYS_OLDLSTAT                     = 84
+	SYS_READLINK                     = 85
+	SYS_USELIB                       = 86
+	SYS_SWAPON                       = 87
+	SYS_REBOOT                       = 88
+	SYS_READDIR                      = 89
+	SYS_MMAP                         = 90
+	SYS_MUNMAP                       = 91
+	SYS_TRUNCATE                     = 92
+	SYS_FTRUNCATE                    = 93
+	SYS_FCHMOD                       = 94
+	SYS_FCHOWN                       = 95
+	SYS_GETPRIORITY                  = 96
+	SYS_SETPRIORITY                  = 97
+	SYS_PROFIL                       = 98
+	SYS_STATFS                       = 99
+	SYS_FSTATFS                      = 100
+	SYS_IOPERM                       = 101
+	SYS_SOCKETCALL                   = 102
+	SYS_SYSLOG                       = 103
+	SYS_SETITIMER                    = 104
+	SYS_GETITIMER                    = 105
+	SYS_STAT                         = 106
+	SYS_LSTAT                        = 107
+	SYS_FSTAT                        = 108
+	SYS_OLDUNAME                     = 109
+	SYS_IOPL                         = 110
+	SYS_VHANGUP                      = 111
+	SYS_IDLE                         = 112
+	SYS_VM86OLD                      = 113
+	SYS_WAIT4                        = 114
+	SYS_SWAPOFF                      = 115
+	SYS_SYSINFO                      = 116
+	SYS_IPC                          = 117
+	SYS_FSYNC                        = 118
+	SYS_SIGRETURN                    = 119
+	SYS_CLONE                        = 120
+	SYS_SETDOMAINNAME                = 121
+	SYS_UNAME                        = 122
+	SYS_MODIFY_LDT                   = 123
+	SYS_ADJTIMEX                     = 124
+	SYS_MPROTECT                     = 125
+	SYS_SIGPROCMASK                  = 126
+	SYS_CREATE_MODULE                = 127
+	SYS_INIT_MODULE                  = 128
+	SYS_DELETE_MODULE                = 129
+	SYS_GET_KERNEL_SYMS              = 130
+	SYS_QUOTACTL                     = 131
+	SYS_GETPGID                      = 132
+	SYS_FCHDIR                       = 133
+	SYS_BDFLUSH                      = 134
+	SYS_SYSFS                        = 135
+	SYS_PERSONALITY                  = 136
+	SYS_AFS_SYSCALL                  = 137
+	SYS_SETFSUID                     = 138
+	SYS_SETFSGID                     = 139
+	SYS__LLSEEK                      = 140
+	SYS_GETDENTS                     = 141
+	SYS__NEWSELECT                   = 142
+	SYS_FLOCK                        = 143
+	SYS_MSYNC                        = 144
+	SYS_READV                        = 145
+	SYS_WRITEV                       = 146
+	SYS_GETSID                       = 147
+	SYS_FDATASYNC                    = 148
+	SYS__SYSCTL                      = 149
+	SYS_MLOCK                        = 150
+	SYS_MUNLOCK                      = 151
+	SYS_MLOCKALL                     = 152
+	SYS_MUNLOCKALL                   = 153
+	SYS_SCHED_SETPARAM               = 154
+	SYS_SCHED_GETPARAM               = 155
+	SYS_SCHED_SETSCHEDULER           = 156
+	SYS_SCHED_GETSCHEDULER           = 157
+	SYS_SCHED_YIELD                  = 158
+	SYS_SCHED_GET_PRIORITY_MAX       = 159
+	SYS_SCHED_GET_PRIORITY_MIN       = 160
+	SYS_SCHED_RR_GET_INTERVAL        = 161
+	SYS_NANOSLEEP                    = 162
+	SYS_MREMAP                       = 163
+	SYS_SETRESUID                    = 164
+	SYS_GETRESUID                    = 165
+	SYS_VM86                         = 166
+	SYS_QUERY_MODULE                 = 167
+	SYS_POLL                         = 168
+	SYS_NFSSERVCTL                   = 169
+	SYS_SETRESGID                    = 170
+	SYS_GETRESGID                    = 171
+	SYS_PRCTL                        = 172
+	SYS_RT_SIGRETURN                 = 173
+	SYS_RT_SIGACTION                 = 174
+	SYS_RT_SIGPROCMASK               = 175
+	SYS_RT_SIGPENDING                = 176
+	SYS_RT_SIGTIMEDWAIT              = 177
+	SYS_RT_SIGQUEUEINFO              = 178
+	SYS_RT_SIGSUSPEND                = 179
+	SYS_PREAD64                      = 180
+	SYS_PWRITE64                     = 181
+	SYS_CHOWN                        = 182
+	SYS_GETCWD                       = 183
+	SYS_CAPGET                       = 184
+	SYS_CAPSET                       = 185
+	SYS_SIGALTSTACK                  = 186
+	SYS_SENDFILE                     = 187
+	SYS_GETPMSG                      = 188
+	SYS_PUTPMSG                      = 189
+	SYS_VFORK                        = 190
+	SYS_UGETRLIMIT                   = 191
+	SYS_MMAP2                        = 192
+	SYS_TRUNCATE64                   = 193
+	SYS_FTRUNCATE64                  = 194
+	SYS_STAT64                       = 195
+	SYS_LSTAT64                      = 196
+	SYS_FSTAT64                      = 197
+	SYS_LCHOWN32                     = 198
+	SYS_GETUID32                     = 199
+	SYS_GETGID32                     = 200
+	SYS_GETEUID32                    = 201
+	SYS_GETEGID32                    = 202
+	SYS_SETREUID32                   = 203
+	SYS_SETREGID32                   = 204
+	SYS_GETGROUPS32                  = 205
+	SYS_SETGROUPS32                  = 206
+	SYS_FCHOWN32                     = 207
+	SYS_SETRESUID32                  = 208
+	SYS_GETRESUID32                  = 209
+	SYS_SETRESGID32                  = 210
+	SYS_GETRESGID32                  = 211
+	SYS_CHOWN32                      = 212
+	SYS_SETUID32                     = 213
+	SYS_SETGID32                     = 214
+	SYS_SETFSUID32                   = 215
+	SYS_SETFSGID32                   = 216
+	SYS_PIVOT_ROOT                   = 217
+	SYS_MINCORE                      = 218
+	SYS_MADVISE                      = 219
+	SYS_GETDENTS64                   = 220
+	SYS_FCNTL64                      = 221
+	SYS_GETTID                       = 224
+	SYS_READAHEAD                    = 225
+	SYS_SETXATTR                     = 226
+	SYS_LSETXATTR                    = 227
+	SYS_FSETXATTR                    = 228
+	SYS_GETXATTR                     = 229
+	SYS_LGETXATTR                    = 230
+	SYS_FGETXATTR                    = 231
+	SYS_LISTXATTR                    = 232
+	SYS_LLISTXATTR                   = 233
+	SYS_FLISTXATTR                   = 234
+	SYS_REMOVEXATTR                  = 235
+	SYS_LREMOVEXATTR                 = 236
+	SYS_FREMOVEXATTR                 = 237
+	SYS_TKILL                        = 238
+	SYS_SENDFILE64                   = 239
+	SYS_FUTEX                        = 240
+	SYS_SCHED_SETAFFINITY            = 241
+	SYS_SCHED_GETAFFINITY            = 242
+	SYS_SET_THREAD_AREA              = 243
+	SYS_GET_THREAD_AREA              = 244
+	SYS_IO_SETUP                     = 245
+	SYS_IO_DESTROY                   = 246
+	SYS_IO_GETEVENTS                 = 247
+	SYS_IO_SUBMIT                    = 248
+	SYS_IO_CANCEL                    = 249
+	SYS_FADVISE64                    = 250
+	SYS_EXIT_GROUP                   = 252
+	SYS_LOOKUP_DCOOKIE               = 253
+	SYS_EPOLL_CREATE                 = 254
+	SYS_EPOLL_CTL                    = 255
+	SYS_EPOLL_WAIT                   = 256
+	SYS_REMAP_FILE_PAGES             = 257
+	SYS_SET_TID_ADDRESS              = 258
+	SYS_TIMER_CREATE                 = 259
+	SYS_TIMER_SETTIME                = 260
+	SYS_TIMER_GETTIME                = 261
+	SYS_TIMER_GETOVERRUN             = 262
+	SYS_TIMER_DELETE                 = 263
+	SYS_CLOCK_SETTIME                = 264
+	SYS_CLOCK_GETTIME                = 265
+	SYS_CLOCK_GETRES                 = 266
+	SYS_CLOCK_NANOSLEEP              = 267
+	SYS_STATFS64                     = 268
+	SYS_FSTATFS64                    = 269
+	SYS_TGKILL                       = 270
+	SYS_UTIMES                       = 271
+	SYS_FADVISE64_64                 = 272
+	SYS_VSERVER                      = 273
+	SYS_MBIND                        = 274
+	SYS_GET_MEMPOLICY                = 275
+	SYS_SET_MEMPOLICY                = 276
+	SYS_MQ_OPEN                      = 277
+	SYS_MQ_UNLINK                    = 278
+	SYS_MQ_TIMEDSEND                 = 279
+	SYS_MQ_TIMEDRECEIVE              = 280
+	SYS_MQ_NOTIFY                    = 281
+	SYS_MQ_GETSETATTR                = 282
+	SYS_KEXEC_LOAD                   = 283
+	SYS_WAITID                       = 284
+	SYS_ADD_KEY                      = 286
+	SYS_REQUEST_KEY                  = 287
+	SYS_KEYCTL                       = 288
+	SYS_IOPRIO_SET                   = 289
+	SYS_IOPRIO_GET                   = 290
+	SYS_INOTIFY_INIT                 = 291
+	SYS_INOTIFY_ADD_WATCH            = 292
+	SYS_INOTIFY_RM_WATCH             = 293
+	SYS_MIGRATE_PAGES                = 294
+	SYS_OPENAT                       = 295
+	SYS_MKDIRAT                      = 296
+	SYS_MKNODAT                      = 297
+	SYS_FCHOWNAT                     = 298
+	SYS_FUTIMESAT                    = 299
+	SYS_FSTATAT64                    = 300
+	SYS_UNLINKAT                     = 301
+	SYS_RENAMEAT                     = 302
+	SYS_LINKAT                       = 303
+	SYS_SYMLINKAT                    = 304
+	SYS_READLINKAT                   = 305
+	SYS_FCHMODAT                     = 306
+	SYS_FACCESSAT                    = 307
+	SYS_PSELECT6                     = 308
+	SYS_PPOLL                        = 309
+	SYS_UNSHARE                      = 310
+	SYS_SET_ROBUST_LIST              = 311
+	SYS_GET_ROBUST_LIST              = 312
+	SYS_SPLICE                       = 313
+	SYS_SYNC_FILE_RANGE              = 314
+	SYS_TEE                          = 315
+	SYS_VMSPLICE                     = 316
+	SYS_MOVE_PAGES                   = 317
+	SYS_GETCPU                       = 318
+	SYS_EPOLL_PWAIT                  = 319
+	SYS_UTIMENSAT                    = 320
+	SYS_SIGNALFD                     = 321
+	SYS_TIMERFD_CREATE               = 322
+	SYS_EVENTFD                      = 323
+	SYS_FALLOCATE                    = 324
+	SYS_TIMERFD_SETTIME              = 325
+	SYS_TIMERFD_GETTIME              = 326
+	SYS_SIGNALFD4                    = 327
+	SYS_EVENTFD2                     = 328
+	SYS_EPOLL_CREATE1                = 329
+	SYS_DUP3                         = 330
+	SYS_PIPE2                        = 331
+	SYS_INOTIFY_INIT1                = 332
+	SYS_PREADV                       = 333
+	SYS_PWRITEV                      = 334
+	SYS_RT_TGSIGQUEUEINFO            = 335
+	SYS_PERF_EVENT_OPEN              = 336
+	SYS_RECVMMSG                     = 337
+	SYS_FANOTIFY_INIT                = 338
+	SYS_FANOTIFY_MARK                = 339
+	SYS_PRLIMIT64                    = 340
+	SYS_NAME_TO_HANDLE_AT            = 341
+	SYS_OPEN_BY_HANDLE_AT            = 342
+	SYS_CLOCK_ADJTIME                = 343
+	SYS_SYNCFS                       = 344
+	SYS_SENDMMSG                     = 345
+	SYS_SETNS                        = 346
+	SYS_PROCESS_VM_READV             = 347
+	SYS_PROCESS_VM_WRITEV            = 348
+	SYS_KCMP                         = 349
+	SYS_FINIT_MODULE                 = 350
+	SYS_SCHED_SETATTR                = 351
+	SYS_SCHED_GETATTR                = 352
+	SYS_RENAMEAT2                    = 353
+	SYS_SECCOMP                      = 354
+	SYS_GETRANDOM                    = 355
+	SYS_MEMFD_CREATE                 = 356
+	SYS_BPF                          = 357
+	SYS_EXECVEAT                     = 358
+	SYS_SOCKET                       = 359
+	SYS_SOCKETPAIR                   = 360
+	SYS_BIND                         = 361
+	SYS_CONNECT                      = 362
+	SYS_LISTEN                       = 363
+	SYS_ACCEPT4                      = 364
+	SYS_GETSOCKOPT                   = 365
+	SYS_SETSOCKOPT                   = 366
+	SYS_GETSOCKNAME                  = 367
+	SYS_GETPEERNAME                  = 368
+	SYS_SENDTO                       = 369
+	SYS_SENDMSG                      = 370
+	SYS_RECVFROM                     = 371
+	SYS_RECVMSG                      = 372
+	SYS_SHUTDOWN                     = 373
+	SYS_USERFAULTFD                  = 374
+	SYS_MEMBARRIER                   = 375
+	SYS_MLOCK2                       = 376
+	SYS_COPY_FILE_RANGE              = 377
+	SYS_PREADV2                      = 378
+	SYS_PWRITEV2                     = 379
+	SYS_PKEY_MPROTECT                = 380
+	SYS_PKEY_ALLOC                   = 381
+	SYS_PKEY_FREE                    = 382
+	SYS_STATX                        = 383
+	SYS_ARCH_PRCTL                   = 384
+	SYS_IO_PGETEVENTS                = 385
+	SYS_RSEQ                         = 386
+	SYS_SEMGET                       = 393
+	SYS_SEMCTL                       = 394
+	SYS_SHMGET                       = 395
+	SYS_SHMCTL                       = 396
+	SYS_SHMAT                        = 397
+	SYS_SHMDT                        = 398
+	SYS_MSGGET                       = 399
+	SYS_MSGSND                       = 400
+	SYS_MSGRCV                       = 401
+	SYS_MSGCTL                       = 402
+	SYS_CLOCK_GETTIME64              = 403
+	SYS_CLOCK_SETTIME64              = 404
+	SYS_CLOCK_ADJTIME64              = 405
+	SYS_CLOCK_GETRES_TIME64          = 406
+	SYS_CLOCK_NANOSLEEP_TIME64       = 407
+	SYS_TIMER_GETTIME64              = 408
+	SYS_TIMER_SETTIME64              = 409
+	SYS_TIMERFD_GETTIME64            = 410
+	SYS_TIMERFD_SETTIME64            = 411
+	SYS_UTIMENSAT_TIME64             = 412
+	SYS_PSELECT6_TIME64              = 413
+	SYS_PPOLL_TIME64                 = 414
+	SYS_IO_PGETEVENTS_TIME64         = 416
+	SYS_RECVMMSG_TIME64              = 417
+	SYS_MQ_TIMEDSEND_TIME64          = 418
+	SYS_MQ_TIMEDRECEIVE_TIME64       = 419
+	SYS_SEMTIMEDOP_TIME64            = 420
+	SYS_RT_SIGTIMEDWAIT_TIME64       = 421
+	SYS_FUTEX_TIME64                 = 422
+	SYS_SCHED_RR_GET_INTERVAL_TIME64 = 423
+	SYS_PIDFD_SEND_SIGNAL            = 424
+	SYS_IO_URING_SETUP               = 425
+	SYS_IO_URING_ENTER               = 426
+	SYS_IO_URING_REGISTER            = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go
index b3d8ad7..9ba2078 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go
@@ -341,4 +341,8 @@ const (
 	SYS_STATX                  = 332
 	SYS_IO_PGETEVENTS          = 333
 	SYS_RSEQ                   = 334
+	SYS_PIDFD_SEND_SIGNAL      = 424
+	SYS_IO_URING_SETUP         = 425
+	SYS_IO_URING_ENTER         = 426
+	SYS_IO_URING_REGISTER      = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go
index e092822..94f68f1 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go
@@ -6,359 +6,385 @@
 package unix
 
 const (
-	SYS_RESTART_SYSCALL        = 0
-	SYS_EXIT                   = 1
-	SYS_FORK                   = 2
-	SYS_READ                   = 3
-	SYS_WRITE                  = 4
-	SYS_OPEN                   = 5
-	SYS_CLOSE                  = 6
-	SYS_CREAT                  = 8
-	SYS_LINK                   = 9
-	SYS_UNLINK                 = 10
-	SYS_EXECVE                 = 11
-	SYS_CHDIR                  = 12
-	SYS_MKNOD                  = 14
-	SYS_CHMOD                  = 15
-	SYS_LCHOWN                 = 16
-	SYS_LSEEK                  = 19
-	SYS_GETPID                 = 20
-	SYS_MOUNT                  = 21
-	SYS_SETUID                 = 23
-	SYS_GETUID                 = 24
-	SYS_PTRACE                 = 26
-	SYS_PAUSE                  = 29
-	SYS_ACCESS                 = 33
-	SYS_NICE                   = 34
-	SYS_SYNC                   = 36
-	SYS_KILL                   = 37
-	SYS_RENAME                 = 38
-	SYS_MKDIR                  = 39
-	SYS_RMDIR                  = 40
-	SYS_DUP                    = 41
-	SYS_PIPE                   = 42
-	SYS_TIMES                  = 43
-	SYS_BRK                    = 45
-	SYS_SETGID                 = 46
-	SYS_GETGID                 = 47
-	SYS_GETEUID                = 49
-	SYS_GETEGID                = 50
-	SYS_ACCT                   = 51
-	SYS_UMOUNT2                = 52
-	SYS_IOCTL                  = 54
-	SYS_FCNTL                  = 55
-	SYS_SETPGID                = 57
-	SYS_UMASK                  = 60
-	SYS_CHROOT                 = 61
-	SYS_USTAT                  = 62
-	SYS_DUP2                   = 63
-	SYS_GETPPID                = 64
-	SYS_GETPGRP                = 65
-	SYS_SETSID                 = 66
-	SYS_SIGACTION              = 67
-	SYS_SETREUID               = 70
-	SYS_SETREGID               = 71
-	SYS_SIGSUSPEND             = 72
-	SYS_SIGPENDING             = 73
-	SYS_SETHOSTNAME            = 74
-	SYS_SETRLIMIT              = 75
-	SYS_GETRUSAGE              = 77
-	SYS_GETTIMEOFDAY           = 78
-	SYS_SETTIMEOFDAY           = 79
-	SYS_GETGROUPS              = 80
-	SYS_SETGROUPS              = 81
-	SYS_SYMLINK                = 83
-	SYS_READLINK               = 85
-	SYS_USELIB                 = 86
-	SYS_SWAPON                 = 87
-	SYS_REBOOT                 = 88
-	SYS_MUNMAP                 = 91
-	SYS_TRUNCATE               = 92
-	SYS_FTRUNCATE              = 93
-	SYS_FCHMOD                 = 94
-	SYS_FCHOWN                 = 95
-	SYS_GETPRIORITY            = 96
-	SYS_SETPRIORITY            = 97
-	SYS_STATFS                 = 99
-	SYS_FSTATFS                = 100
-	SYS_SYSLOG                 = 103
-	SYS_SETITIMER              = 104
-	SYS_GETITIMER              = 105
-	SYS_STAT                   = 106
-	SYS_LSTAT                  = 107
-	SYS_FSTAT                  = 108
-	SYS_VHANGUP                = 111
-	SYS_WAIT4                  = 114
-	SYS_SWAPOFF                = 115
-	SYS_SYSINFO                = 116
-	SYS_FSYNC                  = 118
-	SYS_SIGRETURN              = 119
-	SYS_CLONE                  = 120
-	SYS_SETDOMAINNAME          = 121
-	SYS_UNAME                  = 122
-	SYS_ADJTIMEX               = 124
-	SYS_MPROTECT               = 125
-	SYS_SIGPROCMASK            = 126
-	SYS_INIT_MODULE            = 128
-	SYS_DELETE_MODULE          = 129
-	SYS_QUOTACTL               = 131
-	SYS_GETPGID                = 132
-	SYS_FCHDIR                 = 133
-	SYS_BDFLUSH                = 134
-	SYS_SYSFS                  = 135
-	SYS_PERSONALITY            = 136
-	SYS_SETFSUID               = 138
-	SYS_SETFSGID               = 139
-	SYS__LLSEEK                = 140
-	SYS_GETDENTS               = 141
-	SYS__NEWSELECT             = 142
-	SYS_FLOCK                  = 143
-	SYS_MSYNC                  = 144
-	SYS_READV                  = 145
-	SYS_WRITEV                 = 146
-	SYS_GETSID                 = 147
-	SYS_FDATASYNC              = 148
-	SYS__SYSCTL                = 149
-	SYS_MLOCK                  = 150
-	SYS_MUNLOCK                = 151
-	SYS_MLOCKALL               = 152
-	SYS_MUNLOCKALL             = 153
-	SYS_SCHED_SETPARAM         = 154
-	SYS_SCHED_GETPARAM         = 155
-	SYS_SCHED_SETSCHEDULER     = 156
-	SYS_SCHED_GETSCHEDULER     = 157
-	SYS_SCHED_YIELD            = 158
-	SYS_SCHED_GET_PRIORITY_MAX = 159
-	SYS_SCHED_GET_PRIORITY_MIN = 160
-	SYS_SCHED_RR_GET_INTERVAL  = 161
-	SYS_NANOSLEEP              = 162
-	SYS_MREMAP                 = 163
-	SYS_SETRESUID              = 164
-	SYS_GETRESUID              = 165
-	SYS_POLL                   = 168
-	SYS_NFSSERVCTL             = 169
-	SYS_SETRESGID              = 170
-	SYS_GETRESGID              = 171
-	SYS_PRCTL                  = 172
-	SYS_RT_SIGRETURN           = 173
-	SYS_RT_SIGACTION           = 174
-	SYS_RT_SIGPROCMASK         = 175
-	SYS_RT_SIGPENDING          = 176
-	SYS_RT_SIGTIMEDWAIT        = 177
-	SYS_RT_SIGQUEUEINFO        = 178
-	SYS_RT_SIGSUSPEND          = 179
-	SYS_PREAD64                = 180
-	SYS_PWRITE64               = 181
-	SYS_CHOWN                  = 182
-	SYS_GETCWD                 = 183
-	SYS_CAPGET                 = 184
-	SYS_CAPSET                 = 185
-	SYS_SIGALTSTACK            = 186
-	SYS_SENDFILE               = 187
-	SYS_VFORK                  = 190
-	SYS_UGETRLIMIT             = 191
-	SYS_MMAP2                  = 192
-	SYS_TRUNCATE64             = 193
-	SYS_FTRUNCATE64            = 194
-	SYS_STAT64                 = 195
-	SYS_LSTAT64                = 196
-	SYS_FSTAT64                = 197
-	SYS_LCHOWN32               = 198
-	SYS_GETUID32               = 199
-	SYS_GETGID32               = 200
-	SYS_GETEUID32              = 201
-	SYS_GETEGID32              = 202
-	SYS_SETREUID32             = 203
-	SYS_SETREGID32             = 204
-	SYS_GETGROUPS32            = 205
-	SYS_SETGROUPS32            = 206
-	SYS_FCHOWN32               = 207
-	SYS_SETRESUID32            = 208
-	SYS_GETRESUID32            = 209
-	SYS_SETRESGID32            = 210
-	SYS_GETRESGID32            = 211
-	SYS_CHOWN32                = 212
-	SYS_SETUID32               = 213
-	SYS_SETGID32               = 214
-	SYS_SETFSUID32             = 215
-	SYS_SETFSGID32             = 216
-	SYS_GETDENTS64             = 217
-	SYS_PIVOT_ROOT             = 218
-	SYS_MINCORE                = 219
-	SYS_MADVISE                = 220
-	SYS_FCNTL64                = 221
-	SYS_GETTID                 = 224
-	SYS_READAHEAD              = 225
-	SYS_SETXATTR               = 226
-	SYS_LSETXATTR              = 227
-	SYS_FSETXATTR              = 228
-	SYS_GETXATTR               = 229
-	SYS_LGETXATTR              = 230
-	SYS_FGETXATTR              = 231
-	SYS_LISTXATTR              = 232
-	SYS_LLISTXATTR             = 233
-	SYS_FLISTXATTR             = 234
-	SYS_REMOVEXATTR            = 235
-	SYS_LREMOVEXATTR           = 236
-	SYS_FREMOVEXATTR           = 237
-	SYS_TKILL                  = 238
-	SYS_SENDFILE64             = 239
-	SYS_FUTEX                  = 240
-	SYS_SCHED_SETAFFINITY      = 241
-	SYS_SCHED_GETAFFINITY      = 242
-	SYS_IO_SETUP               = 243
-	SYS_IO_DESTROY             = 244
-	SYS_IO_GETEVENTS           = 245
-	SYS_IO_SUBMIT              = 246
-	SYS_IO_CANCEL              = 247
-	SYS_EXIT_GROUP             = 248
-	SYS_LOOKUP_DCOOKIE         = 249
-	SYS_EPOLL_CREATE           = 250
-	SYS_EPOLL_CTL              = 251
-	SYS_EPOLL_WAIT             = 252
-	SYS_REMAP_FILE_PAGES       = 253
-	SYS_SET_TID_ADDRESS        = 256
-	SYS_TIMER_CREATE           = 257
-	SYS_TIMER_SETTIME          = 258
-	SYS_TIMER_GETTIME          = 259
-	SYS_TIMER_GETOVERRUN       = 260
-	SYS_TIMER_DELETE           = 261
-	SYS_CLOCK_SETTIME          = 262
-	SYS_CLOCK_GETTIME          = 263
-	SYS_CLOCK_GETRES           = 264
-	SYS_CLOCK_NANOSLEEP        = 265
-	SYS_STATFS64               = 266
-	SYS_FSTATFS64              = 267
-	SYS_TGKILL                 = 268
-	SYS_UTIMES                 = 269
-	SYS_ARM_FADVISE64_64       = 270
-	SYS_PCICONFIG_IOBASE       = 271
-	SYS_PCICONFIG_READ         = 272
-	SYS_PCICONFIG_WRITE        = 273
-	SYS_MQ_OPEN                = 274
-	SYS_MQ_UNLINK              = 275
-	SYS_MQ_TIMEDSEND           = 276
-	SYS_MQ_TIMEDRECEIVE        = 277
-	SYS_MQ_NOTIFY              = 278
-	SYS_MQ_GETSETATTR          = 279
-	SYS_WAITID                 = 280
-	SYS_SOCKET                 = 281
-	SYS_BIND                   = 282
-	SYS_CONNECT                = 283
-	SYS_LISTEN                 = 284
-	SYS_ACCEPT                 = 285
-	SYS_GETSOCKNAME            = 286
-	SYS_GETPEERNAME            = 287
-	SYS_SOCKETPAIR             = 288
-	SYS_SEND                   = 289
-	SYS_SENDTO                 = 290
-	SYS_RECV                   = 291
-	SYS_RECVFROM               = 292
-	SYS_SHUTDOWN               = 293
-	SYS_SETSOCKOPT             = 294
-	SYS_GETSOCKOPT             = 295
-	SYS_SENDMSG                = 296
-	SYS_RECVMSG                = 297
-	SYS_SEMOP                  = 298
-	SYS_SEMGET                 = 299
-	SYS_SEMCTL                 = 300
-	SYS_MSGSND                 = 301
-	SYS_MSGRCV                 = 302
-	SYS_MSGGET                 = 303
-	SYS_MSGCTL                 = 304
-	SYS_SHMAT                  = 305
-	SYS_SHMDT                  = 306
-	SYS_SHMGET                 = 307
-	SYS_SHMCTL                 = 308
-	SYS_ADD_KEY                = 309
-	SYS_REQUEST_KEY            = 310
-	SYS_KEYCTL                 = 311
-	SYS_SEMTIMEDOP             = 312
-	SYS_VSERVER                = 313
-	SYS_IOPRIO_SET             = 314
-	SYS_IOPRIO_GET             = 315
-	SYS_INOTIFY_INIT           = 316
-	SYS_INOTIFY_ADD_WATCH      = 317
-	SYS_INOTIFY_RM_WATCH       = 318
-	SYS_MBIND                  = 319
-	SYS_GET_MEMPOLICY          = 320
-	SYS_SET_MEMPOLICY          = 321
-	SYS_OPENAT                 = 322
-	SYS_MKDIRAT                = 323
-	SYS_MKNODAT                = 324
-	SYS_FCHOWNAT               = 325
-	SYS_FUTIMESAT              = 326
-	SYS_FSTATAT64              = 327
-	SYS_UNLINKAT               = 328
-	SYS_RENAMEAT               = 329
-	SYS_LINKAT                 = 330
-	SYS_SYMLINKAT              = 331
-	SYS_READLINKAT             = 332
-	SYS_FCHMODAT               = 333
-	SYS_FACCESSAT              = 334
-	SYS_PSELECT6               = 335
-	SYS_PPOLL                  = 336
-	SYS_UNSHARE                = 337
-	SYS_SET_ROBUST_LIST        = 338
-	SYS_GET_ROBUST_LIST        = 339
-	SYS_SPLICE                 = 340
-	SYS_ARM_SYNC_FILE_RANGE    = 341
-	SYS_TEE                    = 342
-	SYS_VMSPLICE               = 343
-	SYS_MOVE_PAGES             = 344
-	SYS_GETCPU                 = 345
-	SYS_EPOLL_PWAIT            = 346
-	SYS_KEXEC_LOAD             = 347
-	SYS_UTIMENSAT              = 348
-	SYS_SIGNALFD               = 349
-	SYS_TIMERFD_CREATE         = 350
-	SYS_EVENTFD                = 351
-	SYS_FALLOCATE              = 352
-	SYS_TIMERFD_SETTIME        = 353
-	SYS_TIMERFD_GETTIME        = 354
-	SYS_SIGNALFD4              = 355
-	SYS_EVENTFD2               = 356
-	SYS_EPOLL_CREATE1          = 357
-	SYS_DUP3                   = 358
-	SYS_PIPE2                  = 359
-	SYS_INOTIFY_INIT1          = 360
-	SYS_PREADV                 = 361
-	SYS_PWRITEV                = 362
-	SYS_RT_TGSIGQUEUEINFO      = 363
-	SYS_PERF_EVENT_OPEN        = 364
-	SYS_RECVMMSG               = 365
-	SYS_ACCEPT4                = 366
-	SYS_FANOTIFY_INIT          = 367
-	SYS_FANOTIFY_MARK          = 368
-	SYS_PRLIMIT64              = 369
-	SYS_NAME_TO_HANDLE_AT      = 370
-	SYS_OPEN_BY_HANDLE_AT      = 371
-	SYS_CLOCK_ADJTIME          = 372
-	SYS_SYNCFS                 = 373
-	SYS_SENDMMSG               = 374
-	SYS_SETNS                  = 375
-	SYS_PROCESS_VM_READV       = 376
-	SYS_PROCESS_VM_WRITEV      = 377
-	SYS_KCMP                   = 378
-	SYS_FINIT_MODULE           = 379
-	SYS_SCHED_SETATTR          = 380
-	SYS_SCHED_GETATTR          = 381
-	SYS_RENAMEAT2              = 382
-	SYS_SECCOMP                = 383
-	SYS_GETRANDOM              = 384
-	SYS_MEMFD_CREATE           = 385
-	SYS_BPF                    = 386
-	SYS_EXECVEAT               = 387
-	SYS_USERFAULTFD            = 388
-	SYS_MEMBARRIER             = 389
-	SYS_MLOCK2                 = 390
-	SYS_COPY_FILE_RANGE        = 391
-	SYS_PREADV2                = 392
-	SYS_PWRITEV2               = 393
-	SYS_PKEY_MPROTECT          = 394
-	SYS_PKEY_ALLOC             = 395
-	SYS_PKEY_FREE              = 396
-	SYS_STATX                  = 397
-	SYS_RSEQ                   = 398
-	SYS_IO_PGETEVENTS          = 399
+	SYS_RESTART_SYSCALL              = 0
+	SYS_EXIT                         = 1
+	SYS_FORK                         = 2
+	SYS_READ                         = 3
+	SYS_WRITE                        = 4
+	SYS_OPEN                         = 5
+	SYS_CLOSE                        = 6
+	SYS_CREAT                        = 8
+	SYS_LINK                         = 9
+	SYS_UNLINK                       = 10
+	SYS_EXECVE                       = 11
+	SYS_CHDIR                        = 12
+	SYS_MKNOD                        = 14
+	SYS_CHMOD                        = 15
+	SYS_LCHOWN                       = 16
+	SYS_LSEEK                        = 19
+	SYS_GETPID                       = 20
+	SYS_MOUNT                        = 21
+	SYS_SETUID                       = 23
+	SYS_GETUID                       = 24
+	SYS_PTRACE                       = 26
+	SYS_PAUSE                        = 29
+	SYS_ACCESS                       = 33
+	SYS_NICE                         = 34
+	SYS_SYNC                         = 36
+	SYS_KILL                         = 37
+	SYS_RENAME                       = 38
+	SYS_MKDIR                        = 39
+	SYS_RMDIR                        = 40
+	SYS_DUP                          = 41
+	SYS_PIPE                         = 42
+	SYS_TIMES                        = 43
+	SYS_BRK                          = 45
+	SYS_SETGID                       = 46
+	SYS_GETGID                       = 47
+	SYS_GETEUID                      = 49
+	SYS_GETEGID                      = 50
+	SYS_ACCT                         = 51
+	SYS_UMOUNT2                      = 52
+	SYS_IOCTL                        = 54
+	SYS_FCNTL                        = 55
+	SYS_SETPGID                      = 57
+	SYS_UMASK                        = 60
+	SYS_CHROOT                       = 61
+	SYS_USTAT                        = 62
+	SYS_DUP2                         = 63
+	SYS_GETPPID                      = 64
+	SYS_GETPGRP                      = 65
+	SYS_SETSID                       = 66
+	SYS_SIGACTION                    = 67
+	SYS_SETREUID                     = 70
+	SYS_SETREGID                     = 71
+	SYS_SIGSUSPEND                   = 72
+	SYS_SIGPENDING                   = 73
+	SYS_SETHOSTNAME                  = 74
+	SYS_SETRLIMIT                    = 75
+	SYS_GETRUSAGE                    = 77
+	SYS_GETTIMEOFDAY                 = 78
+	SYS_SETTIMEOFDAY                 = 79
+	SYS_GETGROUPS                    = 80
+	SYS_SETGROUPS                    = 81
+	SYS_SYMLINK                      = 83
+	SYS_READLINK                     = 85
+	SYS_USELIB                       = 86
+	SYS_SWAPON                       = 87
+	SYS_REBOOT                       = 88
+	SYS_MUNMAP                       = 91
+	SYS_TRUNCATE                     = 92
+	SYS_FTRUNCATE                    = 93
+	SYS_FCHMOD                       = 94
+	SYS_FCHOWN                       = 95
+	SYS_GETPRIORITY                  = 96
+	SYS_SETPRIORITY                  = 97
+	SYS_STATFS                       = 99
+	SYS_FSTATFS                      = 100
+	SYS_SYSLOG                       = 103
+	SYS_SETITIMER                    = 104
+	SYS_GETITIMER                    = 105
+	SYS_STAT                         = 106
+	SYS_LSTAT                        = 107
+	SYS_FSTAT                        = 108
+	SYS_VHANGUP                      = 111
+	SYS_WAIT4                        = 114
+	SYS_SWAPOFF                      = 115
+	SYS_SYSINFO                      = 116
+	SYS_FSYNC                        = 118
+	SYS_SIGRETURN                    = 119
+	SYS_CLONE                        = 120
+	SYS_SETDOMAINNAME                = 121
+	SYS_UNAME                        = 122
+	SYS_ADJTIMEX                     = 124
+	SYS_MPROTECT                     = 125
+	SYS_SIGPROCMASK                  = 126
+	SYS_INIT_MODULE                  = 128
+	SYS_DELETE_MODULE                = 129
+	SYS_QUOTACTL                     = 131
+	SYS_GETPGID                      = 132
+	SYS_FCHDIR                       = 133
+	SYS_BDFLUSH                      = 134
+	SYS_SYSFS                        = 135
+	SYS_PERSONALITY                  = 136
+	SYS_SETFSUID                     = 138
+	SYS_SETFSGID                     = 139
+	SYS__LLSEEK                      = 140
+	SYS_GETDENTS                     = 141
+	SYS__NEWSELECT                   = 142
+	SYS_FLOCK                        = 143
+	SYS_MSYNC                        = 144
+	SYS_READV                        = 145
+	SYS_WRITEV                       = 146
+	SYS_GETSID                       = 147
+	SYS_FDATASYNC                    = 148
+	SYS__SYSCTL                      = 149
+	SYS_MLOCK                        = 150
+	SYS_MUNLOCK                      = 151
+	SYS_MLOCKALL                     = 152
+	SYS_MUNLOCKALL                   = 153
+	SYS_SCHED_SETPARAM               = 154
+	SYS_SCHED_GETPARAM               = 155
+	SYS_SCHED_SETSCHEDULER           = 156
+	SYS_SCHED_GETSCHEDULER           = 157
+	SYS_SCHED_YIELD                  = 158
+	SYS_SCHED_GET_PRIORITY_MAX       = 159
+	SYS_SCHED_GET_PRIORITY_MIN       = 160
+	SYS_SCHED_RR_GET_INTERVAL        = 161
+	SYS_NANOSLEEP                    = 162
+	SYS_MREMAP                       = 163
+	SYS_SETRESUID                    = 164
+	SYS_GETRESUID                    = 165
+	SYS_POLL                         = 168
+	SYS_NFSSERVCTL                   = 169
+	SYS_SETRESGID                    = 170
+	SYS_GETRESGID                    = 171
+	SYS_PRCTL                        = 172
+	SYS_RT_SIGRETURN                 = 173
+	SYS_RT_SIGACTION                 = 174
+	SYS_RT_SIGPROCMASK               = 175
+	SYS_RT_SIGPENDING                = 176
+	SYS_RT_SIGTIMEDWAIT              = 177
+	SYS_RT_SIGQUEUEINFO              = 178
+	SYS_RT_SIGSUSPEND                = 179
+	SYS_PREAD64                      = 180
+	SYS_PWRITE64                     = 181
+	SYS_CHOWN                        = 182
+	SYS_GETCWD                       = 183
+	SYS_CAPGET                       = 184
+	SYS_CAPSET                       = 185
+	SYS_SIGALTSTACK                  = 186
+	SYS_SENDFILE                     = 187
+	SYS_VFORK                        = 190
+	SYS_UGETRLIMIT                   = 191
+	SYS_MMAP2                        = 192
+	SYS_TRUNCATE64                   = 193
+	SYS_FTRUNCATE64                  = 194
+	SYS_STAT64                       = 195
+	SYS_LSTAT64                      = 196
+	SYS_FSTAT64                      = 197
+	SYS_LCHOWN32                     = 198
+	SYS_GETUID32                     = 199
+	SYS_GETGID32                     = 200
+	SYS_GETEUID32                    = 201
+	SYS_GETEGID32                    = 202
+	SYS_SETREUID32                   = 203
+	SYS_SETREGID32                   = 204
+	SYS_GETGROUPS32                  = 205
+	SYS_SETGROUPS32                  = 206
+	SYS_FCHOWN32                     = 207
+	SYS_SETRESUID32                  = 208
+	SYS_GETRESUID32                  = 209
+	SYS_SETRESGID32                  = 210
+	SYS_GETRESGID32                  = 211
+	SYS_CHOWN32                      = 212
+	SYS_SETUID32                     = 213
+	SYS_SETGID32                     = 214
+	SYS_SETFSUID32                   = 215
+	SYS_SETFSGID32                   = 216
+	SYS_GETDENTS64                   = 217
+	SYS_PIVOT_ROOT                   = 218
+	SYS_MINCORE                      = 219
+	SYS_MADVISE                      = 220
+	SYS_FCNTL64                      = 221
+	SYS_GETTID                       = 224
+	SYS_READAHEAD                    = 225
+	SYS_SETXATTR                     = 226
+	SYS_LSETXATTR                    = 227
+	SYS_FSETXATTR                    = 228
+	SYS_GETXATTR                     = 229
+	SYS_LGETXATTR                    = 230
+	SYS_FGETXATTR                    = 231
+	SYS_LISTXATTR                    = 232
+	SYS_LLISTXATTR                   = 233
+	SYS_FLISTXATTR                   = 234
+	SYS_REMOVEXATTR                  = 235
+	SYS_LREMOVEXATTR                 = 236
+	SYS_FREMOVEXATTR                 = 237
+	SYS_TKILL                        = 238
+	SYS_SENDFILE64                   = 239
+	SYS_FUTEX                        = 240
+	SYS_SCHED_SETAFFINITY            = 241
+	SYS_SCHED_GETAFFINITY            = 242
+	SYS_IO_SETUP                     = 243
+	SYS_IO_DESTROY                   = 244
+	SYS_IO_GETEVENTS                 = 245
+	SYS_IO_SUBMIT                    = 246
+	SYS_IO_CANCEL                    = 247
+	SYS_EXIT_GROUP                   = 248
+	SYS_LOOKUP_DCOOKIE               = 249
+	SYS_EPOLL_CREATE                 = 250
+	SYS_EPOLL_CTL                    = 251
+	SYS_EPOLL_WAIT                   = 252
+	SYS_REMAP_FILE_PAGES             = 253
+	SYS_SET_TID_ADDRESS              = 256
+	SYS_TIMER_CREATE                 = 257
+	SYS_TIMER_SETTIME                = 258
+	SYS_TIMER_GETTIME                = 259
+	SYS_TIMER_GETOVERRUN             = 260
+	SYS_TIMER_DELETE                 = 261
+	SYS_CLOCK_SETTIME                = 262
+	SYS_CLOCK_GETTIME                = 263
+	SYS_CLOCK_GETRES                 = 264
+	SYS_CLOCK_NANOSLEEP              = 265
+	SYS_STATFS64                     = 266
+	SYS_FSTATFS64                    = 267
+	SYS_TGKILL                       = 268
+	SYS_UTIMES                       = 269
+	SYS_ARM_FADVISE64_64             = 270
+	SYS_PCICONFIG_IOBASE             = 271
+	SYS_PCICONFIG_READ               = 272
+	SYS_PCICONFIG_WRITE              = 273
+	SYS_MQ_OPEN                      = 274
+	SYS_MQ_UNLINK                    = 275
+	SYS_MQ_TIMEDSEND                 = 276
+	SYS_MQ_TIMEDRECEIVE              = 277
+	SYS_MQ_NOTIFY                    = 278
+	SYS_MQ_GETSETATTR                = 279
+	SYS_WAITID                       = 280
+	SYS_SOCKET                       = 281
+	SYS_BIND                         = 282
+	SYS_CONNECT                      = 283
+	SYS_LISTEN                       = 284
+	SYS_ACCEPT                       = 285
+	SYS_GETSOCKNAME                  = 286
+	SYS_GETPEERNAME                  = 287
+	SYS_SOCKETPAIR                   = 288
+	SYS_SEND                         = 289
+	SYS_SENDTO                       = 290
+	SYS_RECV                         = 291
+	SYS_RECVFROM                     = 292
+	SYS_SHUTDOWN                     = 293
+	SYS_SETSOCKOPT                   = 294
+	SYS_GETSOCKOPT                   = 295
+	SYS_SENDMSG                      = 296
+	SYS_RECVMSG                      = 297
+	SYS_SEMOP                        = 298
+	SYS_SEMGET                       = 299
+	SYS_SEMCTL                       = 300
+	SYS_MSGSND                       = 301
+	SYS_MSGRCV                       = 302
+	SYS_MSGGET                       = 303
+	SYS_MSGCTL                       = 304
+	SYS_SHMAT                        = 305
+	SYS_SHMDT                        = 306
+	SYS_SHMGET                       = 307
+	SYS_SHMCTL                       = 308
+	SYS_ADD_KEY                      = 309
+	SYS_REQUEST_KEY                  = 310
+	SYS_KEYCTL                       = 311
+	SYS_SEMTIMEDOP                   = 312
+	SYS_VSERVER                      = 313
+	SYS_IOPRIO_SET                   = 314
+	SYS_IOPRIO_GET                   = 315
+	SYS_INOTIFY_INIT                 = 316
+	SYS_INOTIFY_ADD_WATCH            = 317
+	SYS_INOTIFY_RM_WATCH             = 318
+	SYS_MBIND                        = 319
+	SYS_GET_MEMPOLICY                = 320
+	SYS_SET_MEMPOLICY                = 321
+	SYS_OPENAT                       = 322
+	SYS_MKDIRAT                      = 323
+	SYS_MKNODAT                      = 324
+	SYS_FCHOWNAT                     = 325
+	SYS_FUTIMESAT                    = 326
+	SYS_FSTATAT64                    = 327
+	SYS_UNLINKAT                     = 328
+	SYS_RENAMEAT                     = 329
+	SYS_LINKAT                       = 330
+	SYS_SYMLINKAT                    = 331
+	SYS_READLINKAT                   = 332
+	SYS_FCHMODAT                     = 333
+	SYS_FACCESSAT                    = 334
+	SYS_PSELECT6                     = 335
+	SYS_PPOLL                        = 336
+	SYS_UNSHARE                      = 337
+	SYS_SET_ROBUST_LIST              = 338
+	SYS_GET_ROBUST_LIST              = 339
+	SYS_SPLICE                       = 340
+	SYS_ARM_SYNC_FILE_RANGE          = 341
+	SYS_TEE                          = 342
+	SYS_VMSPLICE                     = 343
+	SYS_MOVE_PAGES                   = 344
+	SYS_GETCPU                       = 345
+	SYS_EPOLL_PWAIT                  = 346
+	SYS_KEXEC_LOAD                   = 347
+	SYS_UTIMENSAT                    = 348
+	SYS_SIGNALFD                     = 349
+	SYS_TIMERFD_CREATE               = 350
+	SYS_EVENTFD                      = 351
+	SYS_FALLOCATE                    = 352
+	SYS_TIMERFD_SETTIME              = 353
+	SYS_TIMERFD_GETTIME              = 354
+	SYS_SIGNALFD4                    = 355
+	SYS_EVENTFD2                     = 356
+	SYS_EPOLL_CREATE1                = 357
+	SYS_DUP3                         = 358
+	SYS_PIPE2                        = 359
+	SYS_INOTIFY_INIT1                = 360
+	SYS_PREADV                       = 361
+	SYS_PWRITEV                      = 362
+	SYS_RT_TGSIGQUEUEINFO            = 363
+	SYS_PERF_EVENT_OPEN              = 364
+	SYS_RECVMMSG                     = 365
+	SYS_ACCEPT4                      = 366
+	SYS_FANOTIFY_INIT                = 367
+	SYS_FANOTIFY_MARK                = 368
+	SYS_PRLIMIT64                    = 369
+	SYS_NAME_TO_HANDLE_AT            = 370
+	SYS_OPEN_BY_HANDLE_AT            = 371
+	SYS_CLOCK_ADJTIME                = 372
+	SYS_SYNCFS                       = 373
+	SYS_SENDMMSG                     = 374
+	SYS_SETNS                        = 375
+	SYS_PROCESS_VM_READV             = 376
+	SYS_PROCESS_VM_WRITEV            = 377
+	SYS_KCMP                         = 378
+	SYS_FINIT_MODULE                 = 379
+	SYS_SCHED_SETATTR                = 380
+	SYS_SCHED_GETATTR                = 381
+	SYS_RENAMEAT2                    = 382
+	SYS_SECCOMP                      = 383
+	SYS_GETRANDOM                    = 384
+	SYS_MEMFD_CREATE                 = 385
+	SYS_BPF                          = 386
+	SYS_EXECVEAT                     = 387
+	SYS_USERFAULTFD                  = 388
+	SYS_MEMBARRIER                   = 389
+	SYS_MLOCK2                       = 390
+	SYS_COPY_FILE_RANGE              = 391
+	SYS_PREADV2                      = 392
+	SYS_PWRITEV2                     = 393
+	SYS_PKEY_MPROTECT                = 394
+	SYS_PKEY_ALLOC                   = 395
+	SYS_PKEY_FREE                    = 396
+	SYS_STATX                        = 397
+	SYS_RSEQ                         = 398
+	SYS_IO_PGETEVENTS                = 399
+	SYS_MIGRATE_PAGES                = 400
+	SYS_KEXEC_FILE_LOAD              = 401
+	SYS_CLOCK_GETTIME64              = 403
+	SYS_CLOCK_SETTIME64              = 404
+	SYS_CLOCK_ADJTIME64              = 405
+	SYS_CLOCK_GETRES_TIME64          = 406
+	SYS_CLOCK_NANOSLEEP_TIME64       = 407
+	SYS_TIMER_GETTIME64              = 408
+	SYS_TIMER_SETTIME64              = 409
+	SYS_TIMERFD_GETTIME64            = 410
+	SYS_TIMERFD_SETTIME64            = 411
+	SYS_UTIMENSAT_TIME64             = 412
+	SYS_PSELECT6_TIME64              = 413
+	SYS_PPOLL_TIME64                 = 414
+	SYS_IO_PGETEVENTS_TIME64         = 416
+	SYS_RECVMMSG_TIME64              = 417
+	SYS_MQ_TIMEDSEND_TIME64          = 418
+	SYS_MQ_TIMEDRECEIVE_TIME64       = 419
+	SYS_SEMTIMEDOP_TIME64            = 420
+	SYS_RT_SIGTIMEDWAIT_TIME64       = 421
+	SYS_FUTEX_TIME64                 = 422
+	SYS_SCHED_RR_GET_INTERVAL_TIME64 = 423
+	SYS_PIDFD_SEND_SIGNAL            = 424
+	SYS_IO_URING_SETUP               = 425
+	SYS_IO_URING_ENTER               = 426
+	SYS_IO_URING_REGISTER            = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go
index b81d508..15c4135 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go
@@ -286,4 +286,8 @@ const (
 	SYS_IO_PGETEVENTS          = 292
 	SYS_RSEQ                   = 293
 	SYS_KEXEC_FILE_LOAD        = 294
+	SYS_PIDFD_SEND_SIGNAL      = 424
+	SYS_IO_URING_SETUP         = 425
+	SYS_IO_URING_ENTER         = 426
+	SYS_IO_URING_REGISTER      = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go
index 6893a5b..638465b 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go
@@ -6,372 +6,406 @@
 package unix
 
 const (
-	SYS_SYSCALL                = 4000
-	SYS_EXIT                   = 4001
-	SYS_FORK                   = 4002
-	SYS_READ                   = 4003
-	SYS_WRITE                  = 4004
-	SYS_OPEN                   = 4005
-	SYS_CLOSE                  = 4006
-	SYS_WAITPID                = 4007
-	SYS_CREAT                  = 4008
-	SYS_LINK                   = 4009
-	SYS_UNLINK                 = 4010
-	SYS_EXECVE                 = 4011
-	SYS_CHDIR                  = 4012
-	SYS_TIME                   = 4013
-	SYS_MKNOD                  = 4014
-	SYS_CHMOD                  = 4015
-	SYS_LCHOWN                 = 4016
-	SYS_BREAK                  = 4017
-	SYS_UNUSED18               = 4018
-	SYS_LSEEK                  = 4019
-	SYS_GETPID                 = 4020
-	SYS_MOUNT                  = 4021
-	SYS_UMOUNT                 = 4022
-	SYS_SETUID                 = 4023
-	SYS_GETUID                 = 4024
-	SYS_STIME                  = 4025
-	SYS_PTRACE                 = 4026
-	SYS_ALARM                  = 4027
-	SYS_UNUSED28               = 4028
-	SYS_PAUSE                  = 4029
-	SYS_UTIME                  = 4030
-	SYS_STTY                   = 4031
-	SYS_GTTY                   = 4032
-	SYS_ACCESS                 = 4033
-	SYS_NICE                   = 4034
-	SYS_FTIME                  = 4035
-	SYS_SYNC                   = 4036
-	SYS_KILL                   = 4037
-	SYS_RENAME                 = 4038
-	SYS_MKDIR                  = 4039
-	SYS_RMDIR                  = 4040
-	SYS_DUP                    = 4041
-	SYS_PIPE                   = 4042
-	SYS_TIMES                  = 4043
-	SYS_PROF                   = 4044
-	SYS_BRK                    = 4045
-	SYS_SETGID                 = 4046
-	SYS_GETGID                 = 4047
-	SYS_SIGNAL                 = 4048
-	SYS_GETEUID                = 4049
-	SYS_GETEGID                = 4050
-	SYS_ACCT                   = 4051
-	SYS_UMOUNT2                = 4052
-	SYS_LOCK                   = 4053
-	SYS_IOCTL                  = 4054
-	SYS_FCNTL                  = 4055
-	SYS_MPX                    = 4056
-	SYS_SETPGID                = 4057
-	SYS_ULIMIT                 = 4058
-	SYS_UNUSED59               = 4059
-	SYS_UMASK                  = 4060
-	SYS_CHROOT                 = 4061
-	SYS_USTAT                  = 4062
-	SYS_DUP2                   = 4063
-	SYS_GETPPID                = 4064
-	SYS_GETPGRP                = 4065
-	SYS_SETSID                 = 4066
-	SYS_SIGACTION              = 4067
-	SYS_SGETMASK               = 4068
-	SYS_SSETMASK               = 4069
-	SYS_SETREUID               = 4070
-	SYS_SETREGID               = 4071
-	SYS_SIGSUSPEND             = 4072
-	SYS_SIGPENDING             = 4073
-	SYS_SETHOSTNAME            = 4074
-	SYS_SETRLIMIT              = 4075
-	SYS_GETRLIMIT              = 4076
-	SYS_GETRUSAGE              = 4077
-	SYS_GETTIMEOFDAY           = 4078
-	SYS_SETTIMEOFDAY           = 4079
-	SYS_GETGROUPS              = 4080
-	SYS_SETGROUPS              = 4081
-	SYS_RESERVED82             = 4082
-	SYS_SYMLINK                = 4083
-	SYS_UNUSED84               = 4084
-	SYS_READLINK               = 4085
-	SYS_USELIB                 = 4086
-	SYS_SWAPON                 = 4087
-	SYS_REBOOT                 = 4088
-	SYS_READDIR                = 4089
-	SYS_MMAP                   = 4090
-	SYS_MUNMAP                 = 4091
-	SYS_TRUNCATE               = 4092
-	SYS_FTRUNCATE              = 4093
-	SYS_FCHMOD                 = 4094
-	SYS_FCHOWN                 = 4095
-	SYS_GETPRIORITY            = 4096
-	SYS_SETPRIORITY            = 4097
-	SYS_PROFIL                 = 4098
-	SYS_STATFS                 = 4099
-	SYS_FSTATFS                = 4100
-	SYS_IOPERM                 = 4101
-	SYS_SOCKETCALL             = 4102
-	SYS_SYSLOG                 = 4103
-	SYS_SETITIMER              = 4104
-	SYS_GETITIMER              = 4105
-	SYS_STAT                   = 4106
-	SYS_LSTAT                  = 4107
-	SYS_FSTAT                  = 4108
-	SYS_UNUSED109              = 4109
-	SYS_IOPL                   = 4110
-	SYS_VHANGUP                = 4111
-	SYS_IDLE                   = 4112
-	SYS_VM86                   = 4113
-	SYS_WAIT4                  = 4114
-	SYS_SWAPOFF                = 4115
-	SYS_SYSINFO                = 4116
-	SYS_IPC                    = 4117
-	SYS_FSYNC                  = 4118
-	SYS_SIGRETURN              = 4119
-	SYS_CLONE                  = 4120
-	SYS_SETDOMAINNAME          = 4121
-	SYS_UNAME                  = 4122
-	SYS_MODIFY_LDT             = 4123
-	SYS_ADJTIMEX               = 4124
-	SYS_MPROTECT               = 4125
-	SYS_SIGPROCMASK            = 4126
-	SYS_CREATE_MODULE          = 4127
-	SYS_INIT_MODULE            = 4128
-	SYS_DELETE_MODULE          = 4129
-	SYS_GET_KERNEL_SYMS        = 4130
-	SYS_QUOTACTL               = 4131
-	SYS_GETPGID                = 4132
-	SYS_FCHDIR                 = 4133
-	SYS_BDFLUSH                = 4134
-	SYS_SYSFS                  = 4135
-	SYS_PERSONALITY            = 4136
-	SYS_AFS_SYSCALL            = 4137
-	SYS_SETFSUID               = 4138
-	SYS_SETFSGID               = 4139
-	SYS__LLSEEK                = 4140
-	SYS_GETDENTS               = 4141
-	SYS__NEWSELECT             = 4142
-	SYS_FLOCK                  = 4143
-	SYS_MSYNC                  = 4144
-	SYS_READV                  = 4145
-	SYS_WRITEV                 = 4146
-	SYS_CACHEFLUSH             = 4147
-	SYS_CACHECTL               = 4148
-	SYS_SYSMIPS                = 4149
-	SYS_UNUSED150              = 4150
-	SYS_GETSID                 = 4151
-	SYS_FDATASYNC              = 4152
-	SYS__SYSCTL                = 4153
-	SYS_MLOCK                  = 4154
-	SYS_MUNLOCK                = 4155
-	SYS_MLOCKALL               = 4156
-	SYS_MUNLOCKALL             = 4157
-	SYS_SCHED_SETPARAM         = 4158
-	SYS_SCHED_GETPARAM         = 4159
-	SYS_SCHED_SETSCHEDULER     = 4160
-	SYS_SCHED_GETSCHEDULER     = 4161
-	SYS_SCHED_YIELD            = 4162
-	SYS_SCHED_GET_PRIORITY_MAX = 4163
-	SYS_SCHED_GET_PRIORITY_MIN = 4164
-	SYS_SCHED_RR_GET_INTERVAL  = 4165
-	SYS_NANOSLEEP              = 4166
-	SYS_MREMAP                 = 4167
-	SYS_ACCEPT                 = 4168
-	SYS_BIND                   = 4169
-	SYS_CONNECT                = 4170
-	SYS_GETPEERNAME            = 4171
-	SYS_GETSOCKNAME            = 4172
-	SYS_GETSOCKOPT             = 4173
-	SYS_LISTEN                 = 4174
-	SYS_RECV                   = 4175
-	SYS_RECVFROM               = 4176
-	SYS_RECVMSG                = 4177
-	SYS_SEND                   = 4178
-	SYS_SENDMSG                = 4179
-	SYS_SENDTO                 = 4180
-	SYS_SETSOCKOPT             = 4181
-	SYS_SHUTDOWN               = 4182
-	SYS_SOCKET                 = 4183
-	SYS_SOCKETPAIR             = 4184
-	SYS_SETRESUID              = 4185
-	SYS_GETRESUID              = 4186
-	SYS_QUERY_MODULE           = 4187
-	SYS_POLL                   = 4188
-	SYS_NFSSERVCTL             = 4189
-	SYS_SETRESGID              = 4190
-	SYS_GETRESGID              = 4191
-	SYS_PRCTL                  = 4192
-	SYS_RT_SIGRETURN           = 4193
-	SYS_RT_SIGACTION           = 4194
-	SYS_RT_SIGPROCMASK         = 4195
-	SYS_RT_SIGPENDING          = 4196
-	SYS_RT_SIGTIMEDWAIT        = 4197
-	SYS_RT_SIGQUEUEINFO        = 4198
-	SYS_RT_SIGSUSPEND          = 4199
-	SYS_PREAD64                = 4200
-	SYS_PWRITE64               = 4201
-	SYS_CHOWN                  = 4202
-	SYS_GETCWD                 = 4203
-	SYS_CAPGET                 = 4204
-	SYS_CAPSET                 = 4205
-	SYS_SIGALTSTACK            = 4206
-	SYS_SENDFILE               = 4207
-	SYS_GETPMSG                = 4208
-	SYS_PUTPMSG                = 4209
-	SYS_MMAP2                  = 4210
-	SYS_TRUNCATE64             = 4211
-	SYS_FTRUNCATE64            = 4212
-	SYS_STAT64                 = 4213
-	SYS_LSTAT64                = 4214
-	SYS_FSTAT64                = 4215
-	SYS_PIVOT_ROOT             = 4216
-	SYS_MINCORE                = 4217
-	SYS_MADVISE                = 4218
-	SYS_GETDENTS64             = 4219
-	SYS_FCNTL64                = 4220
-	SYS_RESERVED221            = 4221
-	SYS_GETTID                 = 4222
-	SYS_READAHEAD              = 4223
-	SYS_SETXATTR               = 4224
-	SYS_LSETXATTR              = 4225
-	SYS_FSETXATTR              = 4226
-	SYS_GETXATTR               = 4227
-	SYS_LGETXATTR              = 4228
-	SYS_FGETXATTR              = 4229
-	SYS_LISTXATTR              = 4230
-	SYS_LLISTXATTR             = 4231
-	SYS_FLISTXATTR             = 4232
-	SYS_REMOVEXATTR            = 4233
-	SYS_LREMOVEXATTR           = 4234
-	SYS_FREMOVEXATTR           = 4235
-	SYS_TKILL                  = 4236
-	SYS_SENDFILE64             = 4237
-	SYS_FUTEX                  = 4238
-	SYS_SCHED_SETAFFINITY      = 4239
-	SYS_SCHED_GETAFFINITY      = 4240
-	SYS_IO_SETUP               = 4241
-	SYS_IO_DESTROY             = 4242
-	SYS_IO_GETEVENTS           = 4243
-	SYS_IO_SUBMIT              = 4244
-	SYS_IO_CANCEL              = 4245
-	SYS_EXIT_GROUP             = 4246
-	SYS_LOOKUP_DCOOKIE         = 4247
-	SYS_EPOLL_CREATE           = 4248
-	SYS_EPOLL_CTL              = 4249
-	SYS_EPOLL_WAIT             = 4250
-	SYS_REMAP_FILE_PAGES       = 4251
-	SYS_SET_TID_ADDRESS        = 4252
-	SYS_RESTART_SYSCALL        = 4253
-	SYS_FADVISE64              = 4254
-	SYS_STATFS64               = 4255
-	SYS_FSTATFS64              = 4256
-	SYS_TIMER_CREATE           = 4257
-	SYS_TIMER_SETTIME          = 4258
-	SYS_TIMER_GETTIME          = 4259
-	SYS_TIMER_GETOVERRUN       = 4260
-	SYS_TIMER_DELETE           = 4261
-	SYS_CLOCK_SETTIME          = 4262
-	SYS_CLOCK_GETTIME          = 4263
-	SYS_CLOCK_GETRES           = 4264
-	SYS_CLOCK_NANOSLEEP        = 4265
-	SYS_TGKILL                 = 4266
-	SYS_UTIMES                 = 4267
-	SYS_MBIND                  = 4268
-	SYS_GET_MEMPOLICY          = 4269
-	SYS_SET_MEMPOLICY          = 4270
-	SYS_MQ_OPEN                = 4271
-	SYS_MQ_UNLINK              = 4272
-	SYS_MQ_TIMEDSEND           = 4273
-	SYS_MQ_TIMEDRECEIVE        = 4274
-	SYS_MQ_NOTIFY              = 4275
-	SYS_MQ_GETSETATTR          = 4276
-	SYS_VSERVER                = 4277
-	SYS_WAITID                 = 4278
-	SYS_ADD_KEY                = 4280
-	SYS_REQUEST_KEY            = 4281
-	SYS_KEYCTL                 = 4282
-	SYS_SET_THREAD_AREA        = 4283
-	SYS_INOTIFY_INIT           = 4284
-	SYS_INOTIFY_ADD_WATCH      = 4285
-	SYS_INOTIFY_RM_WATCH       = 4286
-	SYS_MIGRATE_PAGES          = 4287
-	SYS_OPENAT                 = 4288
-	SYS_MKDIRAT                = 4289
-	SYS_MKNODAT                = 4290
-	SYS_FCHOWNAT               = 4291
-	SYS_FUTIMESAT              = 4292
-	SYS_FSTATAT64              = 4293
-	SYS_UNLINKAT               = 4294
-	SYS_RENAMEAT               = 4295
-	SYS_LINKAT                 = 4296
-	SYS_SYMLINKAT              = 4297
-	SYS_READLINKAT             = 4298
-	SYS_FCHMODAT               = 4299
-	SYS_FACCESSAT              = 4300
-	SYS_PSELECT6               = 4301
-	SYS_PPOLL                  = 4302
-	SYS_UNSHARE                = 4303
-	SYS_SPLICE                 = 4304
-	SYS_SYNC_FILE_RANGE        = 4305
-	SYS_TEE                    = 4306
-	SYS_VMSPLICE               = 4307
-	SYS_MOVE_PAGES             = 4308
-	SYS_SET_ROBUST_LIST        = 4309
-	SYS_GET_ROBUST_LIST        = 4310
-	SYS_KEXEC_LOAD             = 4311
-	SYS_GETCPU                 = 4312
-	SYS_EPOLL_PWAIT            = 4313
-	SYS_IOPRIO_SET             = 4314
-	SYS_IOPRIO_GET             = 4315
-	SYS_UTIMENSAT              = 4316
-	SYS_SIGNALFD               = 4317
-	SYS_TIMERFD                = 4318
-	SYS_EVENTFD                = 4319
-	SYS_FALLOCATE              = 4320
-	SYS_TIMERFD_CREATE         = 4321
-	SYS_TIMERFD_GETTIME        = 4322
-	SYS_TIMERFD_SETTIME        = 4323
-	SYS_SIGNALFD4              = 4324
-	SYS_EVENTFD2               = 4325
-	SYS_EPOLL_CREATE1          = 4326
-	SYS_DUP3                   = 4327
-	SYS_PIPE2                  = 4328
-	SYS_INOTIFY_INIT1          = 4329
-	SYS_PREADV                 = 4330
-	SYS_PWRITEV                = 4331
-	SYS_RT_TGSIGQUEUEINFO      = 4332
-	SYS_PERF_EVENT_OPEN        = 4333
-	SYS_ACCEPT4                = 4334
-	SYS_RECVMMSG               = 4335
-	SYS_FANOTIFY_INIT          = 4336
-	SYS_FANOTIFY_MARK          = 4337
-	SYS_PRLIMIT64              = 4338
-	SYS_NAME_TO_HANDLE_AT      = 4339
-	SYS_OPEN_BY_HANDLE_AT      = 4340
-	SYS_CLOCK_ADJTIME          = 4341
-	SYS_SYNCFS                 = 4342
-	SYS_SENDMMSG               = 4343
-	SYS_SETNS                  = 4344
-	SYS_PROCESS_VM_READV       = 4345
-	SYS_PROCESS_VM_WRITEV      = 4346
-	SYS_KCMP                   = 4347
-	SYS_FINIT_MODULE           = 4348
-	SYS_SCHED_SETATTR          = 4349
-	SYS_SCHED_GETATTR          = 4350
-	SYS_RENAMEAT2              = 4351
-	SYS_SECCOMP                = 4352
-	SYS_GETRANDOM              = 4353
-	SYS_MEMFD_CREATE           = 4354
-	SYS_BPF                    = 4355
-	SYS_EXECVEAT               = 4356
-	SYS_USERFAULTFD            = 4357
-	SYS_MEMBARRIER             = 4358
-	SYS_MLOCK2                 = 4359
-	SYS_COPY_FILE_RANGE        = 4360
-	SYS_PREADV2                = 4361
-	SYS_PWRITEV2               = 4362
-	SYS_PKEY_MPROTECT          = 4363
-	SYS_PKEY_ALLOC             = 4364
-	SYS_PKEY_FREE              = 4365
-	SYS_STATX                  = 4366
-	SYS_RSEQ                   = 4367
-	SYS_IO_PGETEVENTS          = 4368
+	SYS_SYSCALL                      = 4000
+	SYS_EXIT                         = 4001
+	SYS_FORK                         = 4002
+	SYS_READ                         = 4003
+	SYS_WRITE                        = 4004
+	SYS_OPEN                         = 4005
+	SYS_CLOSE                        = 4006
+	SYS_WAITPID                      = 4007
+	SYS_CREAT                        = 4008
+	SYS_LINK                         = 4009
+	SYS_UNLINK                       = 4010
+	SYS_EXECVE                       = 4011
+	SYS_CHDIR                        = 4012
+	SYS_TIME                         = 4013
+	SYS_MKNOD                        = 4014
+	SYS_CHMOD                        = 4015
+	SYS_LCHOWN                       = 4016
+	SYS_BREAK                        = 4017
+	SYS_UNUSED18                     = 4018
+	SYS_LSEEK                        = 4019
+	SYS_GETPID                       = 4020
+	SYS_MOUNT                        = 4021
+	SYS_UMOUNT                       = 4022
+	SYS_SETUID                       = 4023
+	SYS_GETUID                       = 4024
+	SYS_STIME                        = 4025
+	SYS_PTRACE                       = 4026
+	SYS_ALARM                        = 4027
+	SYS_UNUSED28                     = 4028
+	SYS_PAUSE                        = 4029
+	SYS_UTIME                        = 4030
+	SYS_STTY                         = 4031
+	SYS_GTTY                         = 4032
+	SYS_ACCESS                       = 4033
+	SYS_NICE                         = 4034
+	SYS_FTIME                        = 4035
+	SYS_SYNC                         = 4036
+	SYS_KILL                         = 4037
+	SYS_RENAME                       = 4038
+	SYS_MKDIR                        = 4039
+	SYS_RMDIR                        = 4040
+	SYS_DUP                          = 4041
+	SYS_PIPE                         = 4042
+	SYS_TIMES                        = 4043
+	SYS_PROF                         = 4044
+	SYS_BRK                          = 4045
+	SYS_SETGID                       = 4046
+	SYS_GETGID                       = 4047
+	SYS_SIGNAL                       = 4048
+	SYS_GETEUID                      = 4049
+	SYS_GETEGID                      = 4050
+	SYS_ACCT                         = 4051
+	SYS_UMOUNT2                      = 4052
+	SYS_LOCK                         = 4053
+	SYS_IOCTL                        = 4054
+	SYS_FCNTL                        = 4055
+	SYS_MPX                          = 4056
+	SYS_SETPGID                      = 4057
+	SYS_ULIMIT                       = 4058
+	SYS_UNUSED59                     = 4059
+	SYS_UMASK                        = 4060
+	SYS_CHROOT                       = 4061
+	SYS_USTAT                        = 4062
+	SYS_DUP2                         = 4063
+	SYS_GETPPID                      = 4064
+	SYS_GETPGRP                      = 4065
+	SYS_SETSID                       = 4066
+	SYS_SIGACTION                    = 4067
+	SYS_SGETMASK                     = 4068
+	SYS_SSETMASK                     = 4069
+	SYS_SETREUID                     = 4070
+	SYS_SETREGID                     = 4071
+	SYS_SIGSUSPEND                   = 4072
+	SYS_SIGPENDING                   = 4073
+	SYS_SETHOSTNAME                  = 4074
+	SYS_SETRLIMIT                    = 4075
+	SYS_GETRLIMIT                    = 4076
+	SYS_GETRUSAGE                    = 4077
+	SYS_GETTIMEOFDAY                 = 4078
+	SYS_SETTIMEOFDAY                 = 4079
+	SYS_GETGROUPS                    = 4080
+	SYS_SETGROUPS                    = 4081
+	SYS_RESERVED82                   = 4082
+	SYS_SYMLINK                      = 4083
+	SYS_UNUSED84                     = 4084
+	SYS_READLINK                     = 4085
+	SYS_USELIB                       = 4086
+	SYS_SWAPON                       = 4087
+	SYS_REBOOT                       = 4088
+	SYS_READDIR                      = 4089
+	SYS_MMAP                         = 4090
+	SYS_MUNMAP                       = 4091
+	SYS_TRUNCATE                     = 4092
+	SYS_FTRUNCATE                    = 4093
+	SYS_FCHMOD                       = 4094
+	SYS_FCHOWN                       = 4095
+	SYS_GETPRIORITY                  = 4096
+	SYS_SETPRIORITY                  = 4097
+	SYS_PROFIL                       = 4098
+	SYS_STATFS                       = 4099
+	SYS_FSTATFS                      = 4100
+	SYS_IOPERM                       = 4101
+	SYS_SOCKETCALL                   = 4102
+	SYS_SYSLOG                       = 4103
+	SYS_SETITIMER                    = 4104
+	SYS_GETITIMER                    = 4105
+	SYS_STAT                         = 4106
+	SYS_LSTAT                        = 4107
+	SYS_FSTAT                        = 4108
+	SYS_UNUSED109                    = 4109
+	SYS_IOPL                         = 4110
+	SYS_VHANGUP                      = 4111
+	SYS_IDLE                         = 4112
+	SYS_VM86                         = 4113
+	SYS_WAIT4                        = 4114
+	SYS_SWAPOFF                      = 4115
+	SYS_SYSINFO                      = 4116
+	SYS_IPC                          = 4117
+	SYS_FSYNC                        = 4118
+	SYS_SIGRETURN                    = 4119
+	SYS_CLONE                        = 4120
+	SYS_SETDOMAINNAME                = 4121
+	SYS_UNAME                        = 4122
+	SYS_MODIFY_LDT                   = 4123
+	SYS_ADJTIMEX                     = 4124
+	SYS_MPROTECT                     = 4125
+	SYS_SIGPROCMASK                  = 4126
+	SYS_CREATE_MODULE                = 4127
+	SYS_INIT_MODULE                  = 4128
+	SYS_DELETE_MODULE                = 4129
+	SYS_GET_KERNEL_SYMS              = 4130
+	SYS_QUOTACTL                     = 4131
+	SYS_GETPGID                      = 4132
+	SYS_FCHDIR                       = 4133
+	SYS_BDFLUSH                      = 4134
+	SYS_SYSFS                        = 4135
+	SYS_PERSONALITY                  = 4136
+	SYS_AFS_SYSCALL                  = 4137
+	SYS_SETFSUID                     = 4138
+	SYS_SETFSGID                     = 4139
+	SYS__LLSEEK                      = 4140
+	SYS_GETDENTS                     = 4141
+	SYS__NEWSELECT                   = 4142
+	SYS_FLOCK                        = 4143
+	SYS_MSYNC                        = 4144
+	SYS_READV                        = 4145
+	SYS_WRITEV                       = 4146
+	SYS_CACHEFLUSH                   = 4147
+	SYS_CACHECTL                     = 4148
+	SYS_SYSMIPS                      = 4149
+	SYS_UNUSED150                    = 4150
+	SYS_GETSID                       = 4151
+	SYS_FDATASYNC                    = 4152
+	SYS__SYSCTL                      = 4153
+	SYS_MLOCK                        = 4154
+	SYS_MUNLOCK                      = 4155
+	SYS_MLOCKALL                     = 4156
+	SYS_MUNLOCKALL                   = 4157
+	SYS_SCHED_SETPARAM               = 4158
+	SYS_SCHED_GETPARAM               = 4159
+	SYS_SCHED_SETSCHEDULER           = 4160
+	SYS_SCHED_GETSCHEDULER           = 4161
+	SYS_SCHED_YIELD                  = 4162
+	SYS_SCHED_GET_PRIORITY_MAX       = 4163
+	SYS_SCHED_GET_PRIORITY_MIN       = 4164
+	SYS_SCHED_RR_GET_INTERVAL        = 4165
+	SYS_NANOSLEEP                    = 4166
+	SYS_MREMAP                       = 4167
+	SYS_ACCEPT                       = 4168
+	SYS_BIND                         = 4169
+	SYS_CONNECT                      = 4170
+	SYS_GETPEERNAME                  = 4171
+	SYS_GETSOCKNAME                  = 4172
+	SYS_GETSOCKOPT                   = 4173
+	SYS_LISTEN                       = 4174
+	SYS_RECV                         = 4175
+	SYS_RECVFROM                     = 4176
+	SYS_RECVMSG                      = 4177
+	SYS_SEND                         = 4178
+	SYS_SENDMSG                      = 4179
+	SYS_SENDTO                       = 4180
+	SYS_SETSOCKOPT                   = 4181
+	SYS_SHUTDOWN                     = 4182
+	SYS_SOCKET                       = 4183
+	SYS_SOCKETPAIR                   = 4184
+	SYS_SETRESUID                    = 4185
+	SYS_GETRESUID                    = 4186
+	SYS_QUERY_MODULE                 = 4187
+	SYS_POLL                         = 4188
+	SYS_NFSSERVCTL                   = 4189
+	SYS_SETRESGID                    = 4190
+	SYS_GETRESGID                    = 4191
+	SYS_PRCTL                        = 4192
+	SYS_RT_SIGRETURN                 = 4193
+	SYS_RT_SIGACTION                 = 4194
+	SYS_RT_SIGPROCMASK               = 4195
+	SYS_RT_SIGPENDING                = 4196
+	SYS_RT_SIGTIMEDWAIT              = 4197
+	SYS_RT_SIGQUEUEINFO              = 4198
+	SYS_RT_SIGSUSPEND                = 4199
+	SYS_PREAD64                      = 4200
+	SYS_PWRITE64                     = 4201
+	SYS_CHOWN                        = 4202
+	SYS_GETCWD                       = 4203
+	SYS_CAPGET                       = 4204
+	SYS_CAPSET                       = 4205
+	SYS_SIGALTSTACK                  = 4206
+	SYS_SENDFILE                     = 4207
+	SYS_GETPMSG                      = 4208
+	SYS_PUTPMSG                      = 4209
+	SYS_MMAP2                        = 4210
+	SYS_TRUNCATE64                   = 4211
+	SYS_FTRUNCATE64                  = 4212
+	SYS_STAT64                       = 4213
+	SYS_LSTAT64                      = 4214
+	SYS_FSTAT64                      = 4215
+	SYS_PIVOT_ROOT                   = 4216
+	SYS_MINCORE                      = 4217
+	SYS_MADVISE                      = 4218
+	SYS_GETDENTS64                   = 4219
+	SYS_FCNTL64                      = 4220
+	SYS_RESERVED221                  = 4221
+	SYS_GETTID                       = 4222
+	SYS_READAHEAD                    = 4223
+	SYS_SETXATTR                     = 4224
+	SYS_LSETXATTR                    = 4225
+	SYS_FSETXATTR                    = 4226
+	SYS_GETXATTR                     = 4227
+	SYS_LGETXATTR                    = 4228
+	SYS_FGETXATTR                    = 4229
+	SYS_LISTXATTR                    = 4230
+	SYS_LLISTXATTR                   = 4231
+	SYS_FLISTXATTR                   = 4232
+	SYS_REMOVEXATTR                  = 4233
+	SYS_LREMOVEXATTR                 = 4234
+	SYS_FREMOVEXATTR                 = 4235
+	SYS_TKILL                        = 4236
+	SYS_SENDFILE64                   = 4237
+	SYS_FUTEX                        = 4238
+	SYS_SCHED_SETAFFINITY            = 4239
+	SYS_SCHED_GETAFFINITY            = 4240
+	SYS_IO_SETUP                     = 4241
+	SYS_IO_DESTROY                   = 4242
+	SYS_IO_GETEVENTS                 = 4243
+	SYS_IO_SUBMIT                    = 4244
+	SYS_IO_CANCEL                    = 4245
+	SYS_EXIT_GROUP                   = 4246
+	SYS_LOOKUP_DCOOKIE               = 4247
+	SYS_EPOLL_CREATE                 = 4248
+	SYS_EPOLL_CTL                    = 4249
+	SYS_EPOLL_WAIT                   = 4250
+	SYS_REMAP_FILE_PAGES             = 4251
+	SYS_SET_TID_ADDRESS              = 4252
+	SYS_RESTART_SYSCALL              = 4253
+	SYS_FADVISE64                    = 4254
+	SYS_STATFS64                     = 4255
+	SYS_FSTATFS64                    = 4256
+	SYS_TIMER_CREATE                 = 4257
+	SYS_TIMER_SETTIME                = 4258
+	SYS_TIMER_GETTIME                = 4259
+	SYS_TIMER_GETOVERRUN             = 4260
+	SYS_TIMER_DELETE                 = 4261
+	SYS_CLOCK_SETTIME                = 4262
+	SYS_CLOCK_GETTIME                = 4263
+	SYS_CLOCK_GETRES                 = 4264
+	SYS_CLOCK_NANOSLEEP              = 4265
+	SYS_TGKILL                       = 4266
+	SYS_UTIMES                       = 4267
+	SYS_MBIND                        = 4268
+	SYS_GET_MEMPOLICY                = 4269
+	SYS_SET_MEMPOLICY                = 4270
+	SYS_MQ_OPEN                      = 4271
+	SYS_MQ_UNLINK                    = 4272
+	SYS_MQ_TIMEDSEND                 = 4273
+	SYS_MQ_TIMEDRECEIVE              = 4274
+	SYS_MQ_NOTIFY                    = 4275
+	SYS_MQ_GETSETATTR                = 4276
+	SYS_VSERVER                      = 4277
+	SYS_WAITID                       = 4278
+	SYS_ADD_KEY                      = 4280
+	SYS_REQUEST_KEY                  = 4281
+	SYS_KEYCTL                       = 4282
+	SYS_SET_THREAD_AREA              = 4283
+	SYS_INOTIFY_INIT                 = 4284
+	SYS_INOTIFY_ADD_WATCH            = 4285
+	SYS_INOTIFY_RM_WATCH             = 4286
+	SYS_MIGRATE_PAGES                = 4287
+	SYS_OPENAT                       = 4288
+	SYS_MKDIRAT                      = 4289
+	SYS_MKNODAT                      = 4290
+	SYS_FCHOWNAT                     = 4291
+	SYS_FUTIMESAT                    = 4292
+	SYS_FSTATAT64                    = 4293
+	SYS_UNLINKAT                     = 4294
+	SYS_RENAMEAT                     = 4295
+	SYS_LINKAT                       = 4296
+	SYS_SYMLINKAT                    = 4297
+	SYS_READLINKAT                   = 4298
+	SYS_FCHMODAT                     = 4299
+	SYS_FACCESSAT                    = 4300
+	SYS_PSELECT6                     = 4301
+	SYS_PPOLL                        = 4302
+	SYS_UNSHARE                      = 4303
+	SYS_SPLICE                       = 4304
+	SYS_SYNC_FILE_RANGE              = 4305
+	SYS_TEE                          = 4306
+	SYS_VMSPLICE                     = 4307
+	SYS_MOVE_PAGES                   = 4308
+	SYS_SET_ROBUST_LIST              = 4309
+	SYS_GET_ROBUST_LIST              = 4310
+	SYS_KEXEC_LOAD                   = 4311
+	SYS_GETCPU                       = 4312
+	SYS_EPOLL_PWAIT                  = 4313
+	SYS_IOPRIO_SET                   = 4314
+	SYS_IOPRIO_GET                   = 4315
+	SYS_UTIMENSAT                    = 4316
+	SYS_SIGNALFD                     = 4317
+	SYS_TIMERFD                      = 4318
+	SYS_EVENTFD                      = 4319
+	SYS_FALLOCATE                    = 4320
+	SYS_TIMERFD_CREATE               = 4321
+	SYS_TIMERFD_GETTIME              = 4322
+	SYS_TIMERFD_SETTIME              = 4323
+	SYS_SIGNALFD4                    = 4324
+	SYS_EVENTFD2                     = 4325
+	SYS_EPOLL_CREATE1                = 4326
+	SYS_DUP3                         = 4327
+	SYS_PIPE2                        = 4328
+	SYS_INOTIFY_INIT1                = 4329
+	SYS_PREADV                       = 4330
+	SYS_PWRITEV                      = 4331
+	SYS_RT_TGSIGQUEUEINFO            = 4332
+	SYS_PERF_EVENT_OPEN              = 4333
+	SYS_ACCEPT4                      = 4334
+	SYS_RECVMMSG                     = 4335
+	SYS_FANOTIFY_INIT                = 4336
+	SYS_FANOTIFY_MARK                = 4337
+	SYS_PRLIMIT64                    = 4338
+	SYS_NAME_TO_HANDLE_AT            = 4339
+	SYS_OPEN_BY_HANDLE_AT            = 4340
+	SYS_CLOCK_ADJTIME                = 4341
+	SYS_SYNCFS                       = 4342
+	SYS_SENDMMSG                     = 4343
+	SYS_SETNS                        = 4344
+	SYS_PROCESS_VM_READV             = 4345
+	SYS_PROCESS_VM_WRITEV            = 4346
+	SYS_KCMP                         = 4347
+	SYS_FINIT_MODULE                 = 4348
+	SYS_SCHED_SETATTR                = 4349
+	SYS_SCHED_GETATTR                = 4350
+	SYS_RENAMEAT2                    = 4351
+	SYS_SECCOMP                      = 4352
+	SYS_GETRANDOM                    = 4353
+	SYS_MEMFD_CREATE                 = 4354
+	SYS_BPF                          = 4355
+	SYS_EXECVEAT                     = 4356
+	SYS_USERFAULTFD                  = 4357
+	SYS_MEMBARRIER                   = 4358
+	SYS_MLOCK2                       = 4359
+	SYS_COPY_FILE_RANGE              = 4360
+	SYS_PREADV2                      = 4361
+	SYS_PWRITEV2                     = 4362
+	SYS_PKEY_MPROTECT                = 4363
+	SYS_PKEY_ALLOC                   = 4364
+	SYS_PKEY_FREE                    = 4365
+	SYS_STATX                        = 4366
+	SYS_RSEQ                         = 4367
+	SYS_IO_PGETEVENTS                = 4368
+	SYS_SEMGET                       = 4393
+	SYS_SEMCTL                       = 4394
+	SYS_SHMGET                       = 4395
+	SYS_SHMCTL                       = 4396
+	SYS_SHMAT                        = 4397
+	SYS_SHMDT                        = 4398
+	SYS_MSGGET                       = 4399
+	SYS_MSGSND                       = 4400
+	SYS_MSGRCV                       = 4401
+	SYS_MSGCTL                       = 4402
+	SYS_CLOCK_GETTIME64              = 4403
+	SYS_CLOCK_SETTIME64              = 4404
+	SYS_CLOCK_ADJTIME64              = 4405
+	SYS_CLOCK_GETRES_TIME64          = 4406
+	SYS_CLOCK_NANOSLEEP_TIME64       = 4407
+	SYS_TIMER_GETTIME64              = 4408
+	SYS_TIMER_SETTIME64              = 4409
+	SYS_TIMERFD_GETTIME64            = 4410
+	SYS_TIMERFD_SETTIME64            = 4411
+	SYS_UTIMENSAT_TIME64             = 4412
+	SYS_PSELECT6_TIME64              = 4413
+	SYS_PPOLL_TIME64                 = 4414
+	SYS_IO_PGETEVENTS_TIME64         = 4416
+	SYS_RECVMMSG_TIME64              = 4417
+	SYS_MQ_TIMEDSEND_TIME64          = 4418
+	SYS_MQ_TIMEDRECEIVE_TIME64       = 4419
+	SYS_SEMTIMEDOP_TIME64            = 4420
+	SYS_RT_SIGTIMEDWAIT_TIME64       = 4421
+	SYS_FUTEX_TIME64                 = 4422
+	SYS_SCHED_RR_GET_INTERVAL_TIME64 = 4423
+	SYS_PIDFD_SEND_SIGNAL            = 4424
+	SYS_IO_URING_SETUP               = 4425
+	SYS_IO_URING_ENTER               = 4426
+	SYS_IO_URING_REGISTER            = 4427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go
index 40164ca..57ec82a 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go
@@ -334,4 +334,8 @@ const (
 	SYS_STATX                  = 5326
 	SYS_RSEQ                   = 5327
 	SYS_IO_PGETEVENTS          = 5328
+	SYS_PIDFD_SEND_SIGNAL      = 5424
+	SYS_IO_URING_SETUP         = 5425
+	SYS_IO_URING_ENTER         = 5426
+	SYS_IO_URING_REGISTER      = 5427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go
index 8a90973..825a3e3 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go
@@ -334,4 +334,8 @@ const (
 	SYS_STATX                  = 5326
 	SYS_RSEQ                   = 5327
 	SYS_IO_PGETEVENTS          = 5328
+	SYS_PIDFD_SEND_SIGNAL      = 5424
+	SYS_IO_URING_SETUP         = 5425
+	SYS_IO_URING_ENTER         = 5426
+	SYS_IO_URING_REGISTER      = 5427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go
index 8d78184..f152dfd 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go
@@ -6,372 +6,406 @@
 package unix
 
 const (
-	SYS_SYSCALL                = 4000
-	SYS_EXIT                   = 4001
-	SYS_FORK                   = 4002
-	SYS_READ                   = 4003
-	SYS_WRITE                  = 4004
-	SYS_OPEN                   = 4005
-	SYS_CLOSE                  = 4006
-	SYS_WAITPID                = 4007
-	SYS_CREAT                  = 4008
-	SYS_LINK                   = 4009
-	SYS_UNLINK                 = 4010
-	SYS_EXECVE                 = 4011
-	SYS_CHDIR                  = 4012
-	SYS_TIME                   = 4013
-	SYS_MKNOD                  = 4014
-	SYS_CHMOD                  = 4015
-	SYS_LCHOWN                 = 4016
-	SYS_BREAK                  = 4017
-	SYS_UNUSED18               = 4018
-	SYS_LSEEK                  = 4019
-	SYS_GETPID                 = 4020
-	SYS_MOUNT                  = 4021
-	SYS_UMOUNT                 = 4022
-	SYS_SETUID                 = 4023
-	SYS_GETUID                 = 4024
-	SYS_STIME                  = 4025
-	SYS_PTRACE                 = 4026
-	SYS_ALARM                  = 4027
-	SYS_UNUSED28               = 4028
-	SYS_PAUSE                  = 4029
-	SYS_UTIME                  = 4030
-	SYS_STTY                   = 4031
-	SYS_GTTY                   = 4032
-	SYS_ACCESS                 = 4033
-	SYS_NICE                   = 4034
-	SYS_FTIME                  = 4035
-	SYS_SYNC                   = 4036
-	SYS_KILL                   = 4037
-	SYS_RENAME                 = 4038
-	SYS_MKDIR                  = 4039
-	SYS_RMDIR                  = 4040
-	SYS_DUP                    = 4041
-	SYS_PIPE                   = 4042
-	SYS_TIMES                  = 4043
-	SYS_PROF                   = 4044
-	SYS_BRK                    = 4045
-	SYS_SETGID                 = 4046
-	SYS_GETGID                 = 4047
-	SYS_SIGNAL                 = 4048
-	SYS_GETEUID                = 4049
-	SYS_GETEGID                = 4050
-	SYS_ACCT                   = 4051
-	SYS_UMOUNT2                = 4052
-	SYS_LOCK                   = 4053
-	SYS_IOCTL                  = 4054
-	SYS_FCNTL                  = 4055
-	SYS_MPX                    = 4056
-	SYS_SETPGID                = 4057
-	SYS_ULIMIT                 = 4058
-	SYS_UNUSED59               = 4059
-	SYS_UMASK                  = 4060
-	SYS_CHROOT                 = 4061
-	SYS_USTAT                  = 4062
-	SYS_DUP2                   = 4063
-	SYS_GETPPID                = 4064
-	SYS_GETPGRP                = 4065
-	SYS_SETSID                 = 4066
-	SYS_SIGACTION              = 4067
-	SYS_SGETMASK               = 4068
-	SYS_SSETMASK               = 4069
-	SYS_SETREUID               = 4070
-	SYS_SETREGID               = 4071
-	SYS_SIGSUSPEND             = 4072
-	SYS_SIGPENDING             = 4073
-	SYS_SETHOSTNAME            = 4074
-	SYS_SETRLIMIT              = 4075
-	SYS_GETRLIMIT              = 4076
-	SYS_GETRUSAGE              = 4077
-	SYS_GETTIMEOFDAY           = 4078
-	SYS_SETTIMEOFDAY           = 4079
-	SYS_GETGROUPS              = 4080
-	SYS_SETGROUPS              = 4081
-	SYS_RESERVED82             = 4082
-	SYS_SYMLINK                = 4083
-	SYS_UNUSED84               = 4084
-	SYS_READLINK               = 4085
-	SYS_USELIB                 = 4086
-	SYS_SWAPON                 = 4087
-	SYS_REBOOT                 = 4088
-	SYS_READDIR                = 4089
-	SYS_MMAP                   = 4090
-	SYS_MUNMAP                 = 4091
-	SYS_TRUNCATE               = 4092
-	SYS_FTRUNCATE              = 4093
-	SYS_FCHMOD                 = 4094
-	SYS_FCHOWN                 = 4095
-	SYS_GETPRIORITY            = 4096
-	SYS_SETPRIORITY            = 4097
-	SYS_PROFIL                 = 4098
-	SYS_STATFS                 = 4099
-	SYS_FSTATFS                = 4100
-	SYS_IOPERM                 = 4101
-	SYS_SOCKETCALL             = 4102
-	SYS_SYSLOG                 = 4103
-	SYS_SETITIMER              = 4104
-	SYS_GETITIMER              = 4105
-	SYS_STAT                   = 4106
-	SYS_LSTAT                  = 4107
-	SYS_FSTAT                  = 4108
-	SYS_UNUSED109              = 4109
-	SYS_IOPL                   = 4110
-	SYS_VHANGUP                = 4111
-	SYS_IDLE                   = 4112
-	SYS_VM86                   = 4113
-	SYS_WAIT4                  = 4114
-	SYS_SWAPOFF                = 4115
-	SYS_SYSINFO                = 4116
-	SYS_IPC                    = 4117
-	SYS_FSYNC                  = 4118
-	SYS_SIGRETURN              = 4119
-	SYS_CLONE                  = 4120
-	SYS_SETDOMAINNAME          = 4121
-	SYS_UNAME                  = 4122
-	SYS_MODIFY_LDT             = 4123
-	SYS_ADJTIMEX               = 4124
-	SYS_MPROTECT               = 4125
-	SYS_SIGPROCMASK            = 4126
-	SYS_CREATE_MODULE          = 4127
-	SYS_INIT_MODULE            = 4128
-	SYS_DELETE_MODULE          = 4129
-	SYS_GET_KERNEL_SYMS        = 4130
-	SYS_QUOTACTL               = 4131
-	SYS_GETPGID                = 4132
-	SYS_FCHDIR                 = 4133
-	SYS_BDFLUSH                = 4134
-	SYS_SYSFS                  = 4135
-	SYS_PERSONALITY            = 4136
-	SYS_AFS_SYSCALL            = 4137
-	SYS_SETFSUID               = 4138
-	SYS_SETFSGID               = 4139
-	SYS__LLSEEK                = 4140
-	SYS_GETDENTS               = 4141
-	SYS__NEWSELECT             = 4142
-	SYS_FLOCK                  = 4143
-	SYS_MSYNC                  = 4144
-	SYS_READV                  = 4145
-	SYS_WRITEV                 = 4146
-	SYS_CACHEFLUSH             = 4147
-	SYS_CACHECTL               = 4148
-	SYS_SYSMIPS                = 4149
-	SYS_UNUSED150              = 4150
-	SYS_GETSID                 = 4151
-	SYS_FDATASYNC              = 4152
-	SYS__SYSCTL                = 4153
-	SYS_MLOCK                  = 4154
-	SYS_MUNLOCK                = 4155
-	SYS_MLOCKALL               = 4156
-	SYS_MUNLOCKALL             = 4157
-	SYS_SCHED_SETPARAM         = 4158
-	SYS_SCHED_GETPARAM         = 4159
-	SYS_SCHED_SETSCHEDULER     = 4160
-	SYS_SCHED_GETSCHEDULER     = 4161
-	SYS_SCHED_YIELD            = 4162
-	SYS_SCHED_GET_PRIORITY_MAX = 4163
-	SYS_SCHED_GET_PRIORITY_MIN = 4164
-	SYS_SCHED_RR_GET_INTERVAL  = 4165
-	SYS_NANOSLEEP              = 4166
-	SYS_MREMAP                 = 4167
-	SYS_ACCEPT                 = 4168
-	SYS_BIND                   = 4169
-	SYS_CONNECT                = 4170
-	SYS_GETPEERNAME            = 4171
-	SYS_GETSOCKNAME            = 4172
-	SYS_GETSOCKOPT             = 4173
-	SYS_LISTEN                 = 4174
-	SYS_RECV                   = 4175
-	SYS_RECVFROM               = 4176
-	SYS_RECVMSG                = 4177
-	SYS_SEND                   = 4178
-	SYS_SENDMSG                = 4179
-	SYS_SENDTO                 = 4180
-	SYS_SETSOCKOPT             = 4181
-	SYS_SHUTDOWN               = 4182
-	SYS_SOCKET                 = 4183
-	SYS_SOCKETPAIR             = 4184
-	SYS_SETRESUID              = 4185
-	SYS_GETRESUID              = 4186
-	SYS_QUERY_MODULE           = 4187
-	SYS_POLL                   = 4188
-	SYS_NFSSERVCTL             = 4189
-	SYS_SETRESGID              = 4190
-	SYS_GETRESGID              = 4191
-	SYS_PRCTL                  = 4192
-	SYS_RT_SIGRETURN           = 4193
-	SYS_RT_SIGACTION           = 4194
-	SYS_RT_SIGPROCMASK         = 4195
-	SYS_RT_SIGPENDING          = 4196
-	SYS_RT_SIGTIMEDWAIT        = 4197
-	SYS_RT_SIGQUEUEINFO        = 4198
-	SYS_RT_SIGSUSPEND          = 4199
-	SYS_PREAD64                = 4200
-	SYS_PWRITE64               = 4201
-	SYS_CHOWN                  = 4202
-	SYS_GETCWD                 = 4203
-	SYS_CAPGET                 = 4204
-	SYS_CAPSET                 = 4205
-	SYS_SIGALTSTACK            = 4206
-	SYS_SENDFILE               = 4207
-	SYS_GETPMSG                = 4208
-	SYS_PUTPMSG                = 4209
-	SYS_MMAP2                  = 4210
-	SYS_TRUNCATE64             = 4211
-	SYS_FTRUNCATE64            = 4212
-	SYS_STAT64                 = 4213
-	SYS_LSTAT64                = 4214
-	SYS_FSTAT64                = 4215
-	SYS_PIVOT_ROOT             = 4216
-	SYS_MINCORE                = 4217
-	SYS_MADVISE                = 4218
-	SYS_GETDENTS64             = 4219
-	SYS_FCNTL64                = 4220
-	SYS_RESERVED221            = 4221
-	SYS_GETTID                 = 4222
-	SYS_READAHEAD              = 4223
-	SYS_SETXATTR               = 4224
-	SYS_LSETXATTR              = 4225
-	SYS_FSETXATTR              = 4226
-	SYS_GETXATTR               = 4227
-	SYS_LGETXATTR              = 4228
-	SYS_FGETXATTR              = 4229
-	SYS_LISTXATTR              = 4230
-	SYS_LLISTXATTR             = 4231
-	SYS_FLISTXATTR             = 4232
-	SYS_REMOVEXATTR            = 4233
-	SYS_LREMOVEXATTR           = 4234
-	SYS_FREMOVEXATTR           = 4235
-	SYS_TKILL                  = 4236
-	SYS_SENDFILE64             = 4237
-	SYS_FUTEX                  = 4238
-	SYS_SCHED_SETAFFINITY      = 4239
-	SYS_SCHED_GETAFFINITY      = 4240
-	SYS_IO_SETUP               = 4241
-	SYS_IO_DESTROY             = 4242
-	SYS_IO_GETEVENTS           = 4243
-	SYS_IO_SUBMIT              = 4244
-	SYS_IO_CANCEL              = 4245
-	SYS_EXIT_GROUP             = 4246
-	SYS_LOOKUP_DCOOKIE         = 4247
-	SYS_EPOLL_CREATE           = 4248
-	SYS_EPOLL_CTL              = 4249
-	SYS_EPOLL_WAIT             = 4250
-	SYS_REMAP_FILE_PAGES       = 4251
-	SYS_SET_TID_ADDRESS        = 4252
-	SYS_RESTART_SYSCALL        = 4253
-	SYS_FADVISE64              = 4254
-	SYS_STATFS64               = 4255
-	SYS_FSTATFS64              = 4256
-	SYS_TIMER_CREATE           = 4257
-	SYS_TIMER_SETTIME          = 4258
-	SYS_TIMER_GETTIME          = 4259
-	SYS_TIMER_GETOVERRUN       = 4260
-	SYS_TIMER_DELETE           = 4261
-	SYS_CLOCK_SETTIME          = 4262
-	SYS_CLOCK_GETTIME          = 4263
-	SYS_CLOCK_GETRES           = 4264
-	SYS_CLOCK_NANOSLEEP        = 4265
-	SYS_TGKILL                 = 4266
-	SYS_UTIMES                 = 4267
-	SYS_MBIND                  = 4268
-	SYS_GET_MEMPOLICY          = 4269
-	SYS_SET_MEMPOLICY          = 4270
-	SYS_MQ_OPEN                = 4271
-	SYS_MQ_UNLINK              = 4272
-	SYS_MQ_TIMEDSEND           = 4273
-	SYS_MQ_TIMEDRECEIVE        = 4274
-	SYS_MQ_NOTIFY              = 4275
-	SYS_MQ_GETSETATTR          = 4276
-	SYS_VSERVER                = 4277
-	SYS_WAITID                 = 4278
-	SYS_ADD_KEY                = 4280
-	SYS_REQUEST_KEY            = 4281
-	SYS_KEYCTL                 = 4282
-	SYS_SET_THREAD_AREA        = 4283
-	SYS_INOTIFY_INIT           = 4284
-	SYS_INOTIFY_ADD_WATCH      = 4285
-	SYS_INOTIFY_RM_WATCH       = 4286
-	SYS_MIGRATE_PAGES          = 4287
-	SYS_OPENAT                 = 4288
-	SYS_MKDIRAT                = 4289
-	SYS_MKNODAT                = 4290
-	SYS_FCHOWNAT               = 4291
-	SYS_FUTIMESAT              = 4292
-	SYS_FSTATAT64              = 4293
-	SYS_UNLINKAT               = 4294
-	SYS_RENAMEAT               = 4295
-	SYS_LINKAT                 = 4296
-	SYS_SYMLINKAT              = 4297
-	SYS_READLINKAT             = 4298
-	SYS_FCHMODAT               = 4299
-	SYS_FACCESSAT              = 4300
-	SYS_PSELECT6               = 4301
-	SYS_PPOLL                  = 4302
-	SYS_UNSHARE                = 4303
-	SYS_SPLICE                 = 4304
-	SYS_SYNC_FILE_RANGE        = 4305
-	SYS_TEE                    = 4306
-	SYS_VMSPLICE               = 4307
-	SYS_MOVE_PAGES             = 4308
-	SYS_SET_ROBUST_LIST        = 4309
-	SYS_GET_ROBUST_LIST        = 4310
-	SYS_KEXEC_LOAD             = 4311
-	SYS_GETCPU                 = 4312
-	SYS_EPOLL_PWAIT            = 4313
-	SYS_IOPRIO_SET             = 4314
-	SYS_IOPRIO_GET             = 4315
-	SYS_UTIMENSAT              = 4316
-	SYS_SIGNALFD               = 4317
-	SYS_TIMERFD                = 4318
-	SYS_EVENTFD                = 4319
-	SYS_FALLOCATE              = 4320
-	SYS_TIMERFD_CREATE         = 4321
-	SYS_TIMERFD_GETTIME        = 4322
-	SYS_TIMERFD_SETTIME        = 4323
-	SYS_SIGNALFD4              = 4324
-	SYS_EVENTFD2               = 4325
-	SYS_EPOLL_CREATE1          = 4326
-	SYS_DUP3                   = 4327
-	SYS_PIPE2                  = 4328
-	SYS_INOTIFY_INIT1          = 4329
-	SYS_PREADV                 = 4330
-	SYS_PWRITEV                = 4331
-	SYS_RT_TGSIGQUEUEINFO      = 4332
-	SYS_PERF_EVENT_OPEN        = 4333
-	SYS_ACCEPT4                = 4334
-	SYS_RECVMMSG               = 4335
-	SYS_FANOTIFY_INIT          = 4336
-	SYS_FANOTIFY_MARK          = 4337
-	SYS_PRLIMIT64              = 4338
-	SYS_NAME_TO_HANDLE_AT      = 4339
-	SYS_OPEN_BY_HANDLE_AT      = 4340
-	SYS_CLOCK_ADJTIME          = 4341
-	SYS_SYNCFS                 = 4342
-	SYS_SENDMMSG               = 4343
-	SYS_SETNS                  = 4344
-	SYS_PROCESS_VM_READV       = 4345
-	SYS_PROCESS_VM_WRITEV      = 4346
-	SYS_KCMP                   = 4347
-	SYS_FINIT_MODULE           = 4348
-	SYS_SCHED_SETATTR          = 4349
-	SYS_SCHED_GETATTR          = 4350
-	SYS_RENAMEAT2              = 4351
-	SYS_SECCOMP                = 4352
-	SYS_GETRANDOM              = 4353
-	SYS_MEMFD_CREATE           = 4354
-	SYS_BPF                    = 4355
-	SYS_EXECVEAT               = 4356
-	SYS_USERFAULTFD            = 4357
-	SYS_MEMBARRIER             = 4358
-	SYS_MLOCK2                 = 4359
-	SYS_COPY_FILE_RANGE        = 4360
-	SYS_PREADV2                = 4361
-	SYS_PWRITEV2               = 4362
-	SYS_PKEY_MPROTECT          = 4363
-	SYS_PKEY_ALLOC             = 4364
-	SYS_PKEY_FREE              = 4365
-	SYS_STATX                  = 4366
-	SYS_RSEQ                   = 4367
-	SYS_IO_PGETEVENTS          = 4368
+	SYS_SYSCALL                      = 4000
+	SYS_EXIT                         = 4001
+	SYS_FORK                         = 4002
+	SYS_READ                         = 4003
+	SYS_WRITE                        = 4004
+	SYS_OPEN                         = 4005
+	SYS_CLOSE                        = 4006
+	SYS_WAITPID                      = 4007
+	SYS_CREAT                        = 4008
+	SYS_LINK                         = 4009
+	SYS_UNLINK                       = 4010
+	SYS_EXECVE                       = 4011
+	SYS_CHDIR                        = 4012
+	SYS_TIME                         = 4013
+	SYS_MKNOD                        = 4014
+	SYS_CHMOD                        = 4015
+	SYS_LCHOWN                       = 4016
+	SYS_BREAK                        = 4017
+	SYS_UNUSED18                     = 4018
+	SYS_LSEEK                        = 4019
+	SYS_GETPID                       = 4020
+	SYS_MOUNT                        = 4021
+	SYS_UMOUNT                       = 4022
+	SYS_SETUID                       = 4023
+	SYS_GETUID                       = 4024
+	SYS_STIME                        = 4025
+	SYS_PTRACE                       = 4026
+	SYS_ALARM                        = 4027
+	SYS_UNUSED28                     = 4028
+	SYS_PAUSE                        = 4029
+	SYS_UTIME                        = 4030
+	SYS_STTY                         = 4031
+	SYS_GTTY                         = 4032
+	SYS_ACCESS                       = 4033
+	SYS_NICE                         = 4034
+	SYS_FTIME                        = 4035
+	SYS_SYNC                         = 4036
+	SYS_KILL                         = 4037
+	SYS_RENAME                       = 4038
+	SYS_MKDIR                        = 4039
+	SYS_RMDIR                        = 4040
+	SYS_DUP                          = 4041
+	SYS_PIPE                         = 4042
+	SYS_TIMES                        = 4043
+	SYS_PROF                         = 4044
+	SYS_BRK                          = 4045
+	SYS_SETGID                       = 4046
+	SYS_GETGID                       = 4047
+	SYS_SIGNAL                       = 4048
+	SYS_GETEUID                      = 4049
+	SYS_GETEGID                      = 4050
+	SYS_ACCT                         = 4051
+	SYS_UMOUNT2                      = 4052
+	SYS_LOCK                         = 4053
+	SYS_IOCTL                        = 4054
+	SYS_FCNTL                        = 4055
+	SYS_MPX                          = 4056
+	SYS_SETPGID                      = 4057
+	SYS_ULIMIT                       = 4058
+	SYS_UNUSED59                     = 4059
+	SYS_UMASK                        = 4060
+	SYS_CHROOT                       = 4061
+	SYS_USTAT                        = 4062
+	SYS_DUP2                         = 4063
+	SYS_GETPPID                      = 4064
+	SYS_GETPGRP                      = 4065
+	SYS_SETSID                       = 4066
+	SYS_SIGACTION                    = 4067
+	SYS_SGETMASK                     = 4068
+	SYS_SSETMASK                     = 4069
+	SYS_SETREUID                     = 4070
+	SYS_SETREGID                     = 4071
+	SYS_SIGSUSPEND                   = 4072
+	SYS_SIGPENDING                   = 4073
+	SYS_SETHOSTNAME                  = 4074
+	SYS_SETRLIMIT                    = 4075
+	SYS_GETRLIMIT                    = 4076
+	SYS_GETRUSAGE                    = 4077
+	SYS_GETTIMEOFDAY                 = 4078
+	SYS_SETTIMEOFDAY                 = 4079
+	SYS_GETGROUPS                    = 4080
+	SYS_SETGROUPS                    = 4081
+	SYS_RESERVED82                   = 4082
+	SYS_SYMLINK                      = 4083
+	SYS_UNUSED84                     = 4084
+	SYS_READLINK                     = 4085
+	SYS_USELIB                       = 4086
+	SYS_SWAPON                       = 4087
+	SYS_REBOOT                       = 4088
+	SYS_READDIR                      = 4089
+	SYS_MMAP                         = 4090
+	SYS_MUNMAP                       = 4091
+	SYS_TRUNCATE                     = 4092
+	SYS_FTRUNCATE                    = 4093
+	SYS_FCHMOD                       = 4094
+	SYS_FCHOWN                       = 4095
+	SYS_GETPRIORITY                  = 4096
+	SYS_SETPRIORITY                  = 4097
+	SYS_PROFIL                       = 4098
+	SYS_STATFS                       = 4099
+	SYS_FSTATFS                      = 4100
+	SYS_IOPERM                       = 4101
+	SYS_SOCKETCALL                   = 4102
+	SYS_SYSLOG                       = 4103
+	SYS_SETITIMER                    = 4104
+	SYS_GETITIMER                    = 4105
+	SYS_STAT                         = 4106
+	SYS_LSTAT                        = 4107
+	SYS_FSTAT                        = 4108
+	SYS_UNUSED109                    = 4109
+	SYS_IOPL                         = 4110
+	SYS_VHANGUP                      = 4111
+	SYS_IDLE                         = 4112
+	SYS_VM86                         = 4113
+	SYS_WAIT4                        = 4114
+	SYS_SWAPOFF                      = 4115
+	SYS_SYSINFO                      = 4116
+	SYS_IPC                          = 4117
+	SYS_FSYNC                        = 4118
+	SYS_SIGRETURN                    = 4119
+	SYS_CLONE                        = 4120
+	SYS_SETDOMAINNAME                = 4121
+	SYS_UNAME                        = 4122
+	SYS_MODIFY_LDT                   = 4123
+	SYS_ADJTIMEX                     = 4124
+	SYS_MPROTECT                     = 4125
+	SYS_SIGPROCMASK                  = 4126
+	SYS_CREATE_MODULE                = 4127
+	SYS_INIT_MODULE                  = 4128
+	SYS_DELETE_MODULE                = 4129
+	SYS_GET_KERNEL_SYMS              = 4130
+	SYS_QUOTACTL                     = 4131
+	SYS_GETPGID                      = 4132
+	SYS_FCHDIR                       = 4133
+	SYS_BDFLUSH                      = 4134
+	SYS_SYSFS                        = 4135
+	SYS_PERSONALITY                  = 4136
+	SYS_AFS_SYSCALL                  = 4137
+	SYS_SETFSUID                     = 4138
+	SYS_SETFSGID                     = 4139
+	SYS__LLSEEK                      = 4140
+	SYS_GETDENTS                     = 4141
+	SYS__NEWSELECT                   = 4142
+	SYS_FLOCK                        = 4143
+	SYS_MSYNC                        = 4144
+	SYS_READV                        = 4145
+	SYS_WRITEV                       = 4146
+	SYS_CACHEFLUSH                   = 4147
+	SYS_CACHECTL                     = 4148
+	SYS_SYSMIPS                      = 4149
+	SYS_UNUSED150                    = 4150
+	SYS_GETSID                       = 4151
+	SYS_FDATASYNC                    = 4152
+	SYS__SYSCTL                      = 4153
+	SYS_MLOCK                        = 4154
+	SYS_MUNLOCK                      = 4155
+	SYS_MLOCKALL                     = 4156
+	SYS_MUNLOCKALL                   = 4157
+	SYS_SCHED_SETPARAM               = 4158
+	SYS_SCHED_GETPARAM               = 4159
+	SYS_SCHED_SETSCHEDULER           = 4160
+	SYS_SCHED_GETSCHEDULER           = 4161
+	SYS_SCHED_YIELD                  = 4162
+	SYS_SCHED_GET_PRIORITY_MAX       = 4163
+	SYS_SCHED_GET_PRIORITY_MIN       = 4164
+	SYS_SCHED_RR_GET_INTERVAL        = 4165
+	SYS_NANOSLEEP                    = 4166
+	SYS_MREMAP                       = 4167
+	SYS_ACCEPT                       = 4168
+	SYS_BIND                         = 4169
+	SYS_CONNECT                      = 4170
+	SYS_GETPEERNAME                  = 4171
+	SYS_GETSOCKNAME                  = 4172
+	SYS_GETSOCKOPT                   = 4173
+	SYS_LISTEN                       = 4174
+	SYS_RECV                         = 4175
+	SYS_RECVFROM                     = 4176
+	SYS_RECVMSG                      = 4177
+	SYS_SEND                         = 4178
+	SYS_SENDMSG                      = 4179
+	SYS_SENDTO                       = 4180
+	SYS_SETSOCKOPT                   = 4181
+	SYS_SHUTDOWN                     = 4182
+	SYS_SOCKET                       = 4183
+	SYS_SOCKETPAIR                   = 4184
+	SYS_SETRESUID                    = 4185
+	SYS_GETRESUID                    = 4186
+	SYS_QUERY_MODULE                 = 4187
+	SYS_POLL                         = 4188
+	SYS_NFSSERVCTL                   = 4189
+	SYS_SETRESGID                    = 4190
+	SYS_GETRESGID                    = 4191
+	SYS_PRCTL                        = 4192
+	SYS_RT_SIGRETURN                 = 4193
+	SYS_RT_SIGACTION                 = 4194
+	SYS_RT_SIGPROCMASK               = 4195
+	SYS_RT_SIGPENDING                = 4196
+	SYS_RT_SIGTIMEDWAIT              = 4197
+	SYS_RT_SIGQUEUEINFO              = 4198
+	SYS_RT_SIGSUSPEND                = 4199
+	SYS_PREAD64                      = 4200
+	SYS_PWRITE64                     = 4201
+	SYS_CHOWN                        = 4202
+	SYS_GETCWD                       = 4203
+	SYS_CAPGET                       = 4204
+	SYS_CAPSET                       = 4205
+	SYS_SIGALTSTACK                  = 4206
+	SYS_SENDFILE                     = 4207
+	SYS_GETPMSG                      = 4208
+	SYS_PUTPMSG                      = 4209
+	SYS_MMAP2                        = 4210
+	SYS_TRUNCATE64                   = 4211
+	SYS_FTRUNCATE64                  = 4212
+	SYS_STAT64                       = 4213
+	SYS_LSTAT64                      = 4214
+	SYS_FSTAT64                      = 4215
+	SYS_PIVOT_ROOT                   = 4216
+	SYS_MINCORE                      = 4217
+	SYS_MADVISE                      = 4218
+	SYS_GETDENTS64                   = 4219
+	SYS_FCNTL64                      = 4220
+	SYS_RESERVED221                  = 4221
+	SYS_GETTID                       = 4222
+	SYS_READAHEAD                    = 4223
+	SYS_SETXATTR                     = 4224
+	SYS_LSETXATTR                    = 4225
+	SYS_FSETXATTR                    = 4226
+	SYS_GETXATTR                     = 4227
+	SYS_LGETXATTR                    = 4228
+	SYS_FGETXATTR                    = 4229
+	SYS_LISTXATTR                    = 4230
+	SYS_LLISTXATTR                   = 4231
+	SYS_FLISTXATTR                   = 4232
+	SYS_REMOVEXATTR                  = 4233
+	SYS_LREMOVEXATTR                 = 4234
+	SYS_FREMOVEXATTR                 = 4235
+	SYS_TKILL                        = 4236
+	SYS_SENDFILE64                   = 4237
+	SYS_FUTEX                        = 4238
+	SYS_SCHED_SETAFFINITY            = 4239
+	SYS_SCHED_GETAFFINITY            = 4240
+	SYS_IO_SETUP                     = 4241
+	SYS_IO_DESTROY                   = 4242
+	SYS_IO_GETEVENTS                 = 4243
+	SYS_IO_SUBMIT                    = 4244
+	SYS_IO_CANCEL                    = 4245
+	SYS_EXIT_GROUP                   = 4246
+	SYS_LOOKUP_DCOOKIE               = 4247
+	SYS_EPOLL_CREATE                 = 4248
+	SYS_EPOLL_CTL                    = 4249
+	SYS_EPOLL_WAIT                   = 4250
+	SYS_REMAP_FILE_PAGES             = 4251
+	SYS_SET_TID_ADDRESS              = 4252
+	SYS_RESTART_SYSCALL              = 4253
+	SYS_FADVISE64                    = 4254
+	SYS_STATFS64                     = 4255
+	SYS_FSTATFS64                    = 4256
+	SYS_TIMER_CREATE                 = 4257
+	SYS_TIMER_SETTIME                = 4258
+	SYS_TIMER_GETTIME                = 4259
+	SYS_TIMER_GETOVERRUN             = 4260
+	SYS_TIMER_DELETE                 = 4261
+	SYS_CLOCK_SETTIME                = 4262
+	SYS_CLOCK_GETTIME                = 4263
+	SYS_CLOCK_GETRES                 = 4264
+	SYS_CLOCK_NANOSLEEP              = 4265
+	SYS_TGKILL                       = 4266
+	SYS_UTIMES                       = 4267
+	SYS_MBIND                        = 4268
+	SYS_GET_MEMPOLICY                = 4269
+	SYS_SET_MEMPOLICY                = 4270
+	SYS_MQ_OPEN                      = 4271
+	SYS_MQ_UNLINK                    = 4272
+	SYS_MQ_TIMEDSEND                 = 4273
+	SYS_MQ_TIMEDRECEIVE              = 4274
+	SYS_MQ_NOTIFY                    = 4275
+	SYS_MQ_GETSETATTR                = 4276
+	SYS_VSERVER                      = 4277
+	SYS_WAITID                       = 4278
+	SYS_ADD_KEY                      = 4280
+	SYS_REQUEST_KEY                  = 4281
+	SYS_KEYCTL                       = 4282
+	SYS_SET_THREAD_AREA              = 4283
+	SYS_INOTIFY_INIT                 = 4284
+	SYS_INOTIFY_ADD_WATCH            = 4285
+	SYS_INOTIFY_RM_WATCH             = 4286
+	SYS_MIGRATE_PAGES                = 4287
+	SYS_OPENAT                       = 4288
+	SYS_MKDIRAT                      = 4289
+	SYS_MKNODAT                      = 4290
+	SYS_FCHOWNAT                     = 4291
+	SYS_FUTIMESAT                    = 4292
+	SYS_FSTATAT64                    = 4293
+	SYS_UNLINKAT                     = 4294
+	SYS_RENAMEAT                     = 4295
+	SYS_LINKAT                       = 4296
+	SYS_SYMLINKAT                    = 4297
+	SYS_READLINKAT                   = 4298
+	SYS_FCHMODAT                     = 4299
+	SYS_FACCESSAT                    = 4300
+	SYS_PSELECT6                     = 4301
+	SYS_PPOLL                        = 4302
+	SYS_UNSHARE                      = 4303
+	SYS_SPLICE                       = 4304
+	SYS_SYNC_FILE_RANGE              = 4305
+	SYS_TEE                          = 4306
+	SYS_VMSPLICE                     = 4307
+	SYS_MOVE_PAGES                   = 4308
+	SYS_SET_ROBUST_LIST              = 4309
+	SYS_GET_ROBUST_LIST              = 4310
+	SYS_KEXEC_LOAD                   = 4311
+	SYS_GETCPU                       = 4312
+	SYS_EPOLL_PWAIT                  = 4313
+	SYS_IOPRIO_SET                   = 4314
+	SYS_IOPRIO_GET                   = 4315
+	SYS_UTIMENSAT                    = 4316
+	SYS_SIGNALFD                     = 4317
+	SYS_TIMERFD                      = 4318
+	SYS_EVENTFD                      = 4319
+	SYS_FALLOCATE                    = 4320
+	SYS_TIMERFD_CREATE               = 4321
+	SYS_TIMERFD_GETTIME              = 4322
+	SYS_TIMERFD_SETTIME              = 4323
+	SYS_SIGNALFD4                    = 4324
+	SYS_EVENTFD2                     = 4325
+	SYS_EPOLL_CREATE1                = 4326
+	SYS_DUP3                         = 4327
+	SYS_PIPE2                        = 4328
+	SYS_INOTIFY_INIT1                = 4329
+	SYS_PREADV                       = 4330
+	SYS_PWRITEV                      = 4331
+	SYS_RT_TGSIGQUEUEINFO            = 4332
+	SYS_PERF_EVENT_OPEN              = 4333
+	SYS_ACCEPT4                      = 4334
+	SYS_RECVMMSG                     = 4335
+	SYS_FANOTIFY_INIT                = 4336
+	SYS_FANOTIFY_MARK                = 4337
+	SYS_PRLIMIT64                    = 4338
+	SYS_NAME_TO_HANDLE_AT            = 4339
+	SYS_OPEN_BY_HANDLE_AT            = 4340
+	SYS_CLOCK_ADJTIME                = 4341
+	SYS_SYNCFS                       = 4342
+	SYS_SENDMMSG                     = 4343
+	SYS_SETNS                        = 4344
+	SYS_PROCESS_VM_READV             = 4345
+	SYS_PROCESS_VM_WRITEV            = 4346
+	SYS_KCMP                         = 4347
+	SYS_FINIT_MODULE                 = 4348
+	SYS_SCHED_SETATTR                = 4349
+	SYS_SCHED_GETATTR                = 4350
+	SYS_RENAMEAT2                    = 4351
+	SYS_SECCOMP                      = 4352
+	SYS_GETRANDOM                    = 4353
+	SYS_MEMFD_CREATE                 = 4354
+	SYS_BPF                          = 4355
+	SYS_EXECVEAT                     = 4356
+	SYS_USERFAULTFD                  = 4357
+	SYS_MEMBARRIER                   = 4358
+	SYS_MLOCK2                       = 4359
+	SYS_COPY_FILE_RANGE              = 4360
+	SYS_PREADV2                      = 4361
+	SYS_PWRITEV2                     = 4362
+	SYS_PKEY_MPROTECT                = 4363
+	SYS_PKEY_ALLOC                   = 4364
+	SYS_PKEY_FREE                    = 4365
+	SYS_STATX                        = 4366
+	SYS_RSEQ                         = 4367
+	SYS_IO_PGETEVENTS                = 4368
+	SYS_SEMGET                       = 4393
+	SYS_SEMCTL                       = 4394
+	SYS_SHMGET                       = 4395
+	SYS_SHMCTL                       = 4396
+	SYS_SHMAT                        = 4397
+	SYS_SHMDT                        = 4398
+	SYS_MSGGET                       = 4399
+	SYS_MSGSND                       = 4400
+	SYS_MSGRCV                       = 4401
+	SYS_MSGCTL                       = 4402
+	SYS_CLOCK_GETTIME64              = 4403
+	SYS_CLOCK_SETTIME64              = 4404
+	SYS_CLOCK_ADJTIME64              = 4405
+	SYS_CLOCK_GETRES_TIME64          = 4406
+	SYS_CLOCK_NANOSLEEP_TIME64       = 4407
+	SYS_TIMER_GETTIME64              = 4408
+	SYS_TIMER_SETTIME64              = 4409
+	SYS_TIMERFD_GETTIME64            = 4410
+	SYS_TIMERFD_SETTIME64            = 4411
+	SYS_UTIMENSAT_TIME64             = 4412
+	SYS_PSELECT6_TIME64              = 4413
+	SYS_PPOLL_TIME64                 = 4414
+	SYS_IO_PGETEVENTS_TIME64         = 4416
+	SYS_RECVMMSG_TIME64              = 4417
+	SYS_MQ_TIMEDSEND_TIME64          = 4418
+	SYS_MQ_TIMEDRECEIVE_TIME64       = 4419
+	SYS_SEMTIMEDOP_TIME64            = 4420
+	SYS_RT_SIGTIMEDWAIT_TIME64       = 4421
+	SYS_FUTEX_TIME64                 = 4422
+	SYS_SCHED_RR_GET_INTERVAL_TIME64 = 4423
+	SYS_PIDFD_SEND_SIGNAL            = 4424
+	SYS_IO_URING_SETUP               = 4425
+	SYS_IO_URING_ENTER               = 4426
+	SYS_IO_URING_REGISTER            = 4427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go
index ec5bde3..7cbe78b 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go
@@ -372,4 +372,19 @@ const (
 	SYS_PKEY_MPROTECT          = 386
 	SYS_RSEQ                   = 387
 	SYS_IO_PGETEVENTS          = 388
+	SYS_SEMTIMEDOP             = 392
+	SYS_SEMGET                 = 393
+	SYS_SEMCTL                 = 394
+	SYS_SHMGET                 = 395
+	SYS_SHMCTL                 = 396
+	SYS_SHMAT                  = 397
+	SYS_SHMDT                  = 398
+	SYS_MSGGET                 = 399
+	SYS_MSGSND                 = 400
+	SYS_MSGRCV                 = 401
+	SYS_MSGCTL                 = 402
+	SYS_PIDFD_SEND_SIGNAL      = 424
+	SYS_IO_URING_SETUP         = 425
+	SYS_IO_URING_ENTER         = 426
+	SYS_IO_URING_REGISTER      = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go
index bdbabdb..51a2f12 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go
@@ -372,4 +372,19 @@ const (
 	SYS_PKEY_MPROTECT          = 386
 	SYS_RSEQ                   = 387
 	SYS_IO_PGETEVENTS          = 388
+	SYS_SEMTIMEDOP             = 392
+	SYS_SEMGET                 = 393
+	SYS_SEMCTL                 = 394
+	SYS_SHMGET                 = 395
+	SYS_SHMCTL                 = 396
+	SYS_SHMAT                  = 397
+	SYS_SHMDT                  = 398
+	SYS_MSGGET                 = 399
+	SYS_MSGSND                 = 400
+	SYS_MSGRCV                 = 401
+	SYS_MSGCTL                 = 402
+	SYS_PIDFD_SEND_SIGNAL      = 424
+	SYS_IO_URING_SETUP         = 425
+	SYS_IO_URING_ENTER         = 426
+	SYS_IO_URING_REGISTER      = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go
index 2c8c46a..323432a 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go
@@ -285,4 +285,8 @@ const (
 	SYS_IO_PGETEVENTS          = 292
 	SYS_RSEQ                   = 293
 	SYS_KEXEC_FILE_LOAD        = 294
+	SYS_PIDFD_SEND_SIGNAL      = 424
+	SYS_IO_URING_SETUP         = 425
+	SYS_IO_URING_ENTER         = 426
+	SYS_IO_URING_REGISTER      = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go
index 6eb7c25..9dca974 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go
@@ -334,4 +334,22 @@ const (
 	SYS_KEXEC_FILE_LOAD        = 381
 	SYS_IO_PGETEVENTS          = 382
 	SYS_RSEQ                   = 383
+	SYS_PKEY_MPROTECT          = 384
+	SYS_PKEY_ALLOC             = 385
+	SYS_PKEY_FREE              = 386
+	SYS_SEMTIMEDOP             = 392
+	SYS_SEMGET                 = 393
+	SYS_SEMCTL                 = 394
+	SYS_SHMGET                 = 395
+	SYS_SHMCTL                 = 396
+	SYS_SHMAT                  = 397
+	SYS_SHMDT                  = 398
+	SYS_MSGGET                 = 399
+	SYS_MSGSND                 = 400
+	SYS_MSGRCV                 = 401
+	SYS_MSGCTL                 = 402
+	SYS_PIDFD_SEND_SIGNAL      = 424
+	SYS_IO_URING_SETUP         = 425
+	SYS_IO_URING_ENTER         = 426
+	SYS_IO_URING_REGISTER      = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go
index 6ed3063..d3da46f 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go
@@ -348,4 +348,23 @@ const (
 	SYS_PWRITEV2               = 359
 	SYS_STATX                  = 360
 	SYS_IO_PGETEVENTS          = 361
+	SYS_PKEY_MPROTECT          = 362
+	SYS_PKEY_ALLOC             = 363
+	SYS_PKEY_FREE              = 364
+	SYS_RSEQ                   = 365
+	SYS_SEMTIMEDOP             = 392
+	SYS_SEMGET                 = 393
+	SYS_SEMCTL                 = 394
+	SYS_SHMGET                 = 395
+	SYS_SHMCTL                 = 396
+	SYS_SHMAT                  = 397
+	SYS_SHMDT                  = 398
+	SYS_MSGGET                 = 399
+	SYS_MSGSND                 = 400
+	SYS_MSGRCV                 = 401
+	SYS_MSGCTL                 = 402
+	SYS_PIDFD_SEND_SIGNAL      = 424
+	SYS_IO_URING_SETUP         = 425
+	SYS_IO_URING_ENTER         = 426
+	SYS_IO_URING_REGISTER      = 427
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go
new file mode 100644
index 0000000..fe2b689
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go
@@ -0,0 +1,217 @@
+// go run mksysnum.go https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master
+// Code generated by the command above; see README.md. DO NOT EDIT.
+
+// +build arm64,openbsd
+
+package unix
+
+const (
+	SYS_EXIT           = 1   // { void sys_exit(int rval); }
+	SYS_FORK           = 2   // { int sys_fork(void); }
+	SYS_READ           = 3   // { ssize_t sys_read(int fd, void *buf, size_t nbyte); }
+	SYS_WRITE          = 4   // { ssize_t sys_write(int fd, const void *buf, size_t nbyte); }
+	SYS_OPEN           = 5   // { int sys_open(const char *path, int flags, ... mode_t mode); }
+	SYS_CLOSE          = 6   // { int sys_close(int fd); }
+	SYS_GETENTROPY     = 7   // { int sys_getentropy(void *buf, size_t nbyte); }
+	SYS___TFORK        = 8   // { int sys___tfork(const struct __tfork *param, size_t psize); }
+	SYS_LINK           = 9   // { int sys_link(const char *path, const char *link); }
+	SYS_UNLINK         = 10  // { int sys_unlink(const char *path); }
+	SYS_WAIT4          = 11  // { pid_t sys_wait4(pid_t pid, int *status, int options, struct rusage *rusage); }
+	SYS_CHDIR          = 12  // { int sys_chdir(const char *path); }
+	SYS_FCHDIR         = 13  // { int sys_fchdir(int fd); }
+	SYS_MKNOD          = 14  // { int sys_mknod(const char *path, mode_t mode, dev_t dev); }
+	SYS_CHMOD          = 15  // { int sys_chmod(const char *path, mode_t mode); }
+	SYS_CHOWN          = 16  // { int sys_chown(const char *path, uid_t uid, gid_t gid); }
+	SYS_OBREAK         = 17  // { int sys_obreak(char *nsize); } break
+	SYS_GETDTABLECOUNT = 18  // { int sys_getdtablecount(void); }
+	SYS_GETRUSAGE      = 19  // { int sys_getrusage(int who, struct rusage *rusage); }
+	SYS_GETPID         = 20  // { pid_t sys_getpid(void); }
+	SYS_MOUNT          = 21  // { int sys_mount(const char *type, const char *path, int flags, void *data); }
+	SYS_UNMOUNT        = 22  // { int sys_unmount(const char *path, int flags); }
+	SYS_SETUID         = 23  // { int sys_setuid(uid_t uid); }
+	SYS_GETUID         = 24  // { uid_t sys_getuid(void); }
+	SYS_GETEUID        = 25  // { uid_t sys_geteuid(void); }
+	SYS_PTRACE         = 26  // { int sys_ptrace(int req, pid_t pid, caddr_t addr, int data); }
+	SYS_RECVMSG        = 27  // { ssize_t sys_recvmsg(int s, struct msghdr *msg, int flags); }
+	SYS_SENDMSG        = 28  // { ssize_t sys_sendmsg(int s, const struct msghdr *msg, int flags); }
+	SYS_RECVFROM       = 29  // { ssize_t sys_recvfrom(int s, void *buf, size_t len, int flags, struct sockaddr *from, socklen_t *fromlenaddr); }
+	SYS_ACCEPT         = 30  // { int sys_accept(int s, struct sockaddr *name, socklen_t *anamelen); }
+	SYS_GETPEERNAME    = 31  // { int sys_getpeername(int fdes, struct sockaddr *asa, socklen_t *alen); }
+	SYS_GETSOCKNAME    = 32  // { int sys_getsockname(int fdes, struct sockaddr *asa, socklen_t *alen); }
+	SYS_ACCESS         = 33  // { int sys_access(const char *path, int amode); }
+	SYS_CHFLAGS        = 34  // { int sys_chflags(const char *path, u_int flags); }
+	SYS_FCHFLAGS       = 35  // { int sys_fchflags(int fd, u_int flags); }
+	SYS_SYNC           = 36  // { void sys_sync(void); }
+	SYS_STAT           = 38  // { int sys_stat(const char *path, struct stat *ub); }
+	SYS_GETPPID        = 39  // { pid_t sys_getppid(void); }
+	SYS_LSTAT          = 40  // { int sys_lstat(const char *path, struct stat *ub); }
+	SYS_DUP            = 41  // { int sys_dup(int fd); }
+	SYS_FSTATAT        = 42  // { int sys_fstatat(int fd, const char *path, struct stat *buf, int flag); }
+	SYS_GETEGID        = 43  // { gid_t sys_getegid(void); }
+	SYS_PROFIL         = 44  // { int sys_profil(caddr_t samples, size_t size, u_long offset, u_int scale); }
+	SYS_KTRACE         = 45  // { int sys_ktrace(const char *fname, int ops, int facs, pid_t pid); }
+	SYS_SIGACTION      = 46  // { int sys_sigaction(int signum, const struct sigaction *nsa, struct sigaction *osa); }
+	SYS_GETGID         = 47  // { gid_t sys_getgid(void); }
+	SYS_SIGPROCMASK    = 48  // { int sys_sigprocmask(int how, sigset_t mask); }
+	SYS_SETLOGIN       = 50  // { int sys_setlogin(const char *namebuf); }
+	SYS_ACCT           = 51  // { int sys_acct(const char *path); }
+	SYS_SIGPENDING     = 52  // { int sys_sigpending(void); }
+	SYS_FSTAT          = 53  // { int sys_fstat(int fd, struct stat *sb); }
+	SYS_IOCTL          = 54  // { int sys_ioctl(int fd, u_long com, ... void *data); }
+	SYS_REBOOT         = 55  // { int sys_reboot(int opt); }
+	SYS_REVOKE         = 56  // { int sys_revoke(const char *path); }
+	SYS_SYMLINK        = 57  // { int sys_symlink(const char *path, const char *link); }
+	SYS_READLINK       = 58  // { ssize_t sys_readlink(const char *path, char *buf, size_t count); }
+	SYS_EXECVE         = 59  // { int sys_execve(const char *path, char * const *argp, char * const *envp); }
+	SYS_UMASK          = 60  // { mode_t sys_umask(mode_t newmask); }
+	SYS_CHROOT         = 61  // { int sys_chroot(const char *path); }
+	SYS_GETFSSTAT      = 62  // { int sys_getfsstat(struct statfs *buf, size_t bufsize, int flags); }
+	SYS_STATFS         = 63  // { int sys_statfs(const char *path, struct statfs *buf); }
+	SYS_FSTATFS        = 64  // { int sys_fstatfs(int fd, struct statfs *buf); }
+	SYS_FHSTATFS       = 65  // { int sys_fhstatfs(const fhandle_t *fhp, struct statfs *buf); }
+	SYS_VFORK          = 66  // { int sys_vfork(void); }
+	SYS_GETTIMEOFDAY   = 67  // { int sys_gettimeofday(struct timeval *tp, struct timezone *tzp); }
+	SYS_SETTIMEOFDAY   = 68  // { int sys_settimeofday(const struct timeval *tv, const struct timezone *tzp); }
+	SYS_SETITIMER      = 69  // { int sys_setitimer(int which, const struct itimerval *itv, struct itimerval *oitv); }
+	SYS_GETITIMER      = 70  // { int sys_getitimer(int which, struct itimerval *itv); }
+	SYS_SELECT         = 71  // { int sys_select(int nd, fd_set *in, fd_set *ou, fd_set *ex, struct timeval *tv); }
+	SYS_KEVENT         = 72  // { int sys_kevent(int fd, const struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); }
+	SYS_MUNMAP         = 73  // { int sys_munmap(void *addr, size_t len); }
+	SYS_MPROTECT       = 74  // { int sys_mprotect(void *addr, size_t len, int prot); }
+	SYS_MADVISE        = 75  // { int sys_madvise(void *addr, size_t len, int behav); }
+	SYS_UTIMES         = 76  // { int sys_utimes(const char *path, const struct timeval *tptr); }
+	SYS_FUTIMES        = 77  // { int sys_futimes(int fd, const struct timeval *tptr); }
+	SYS_GETGROUPS      = 79  // { int sys_getgroups(int gidsetsize, gid_t *gidset); }
+	SYS_SETGROUPS      = 80  // { int sys_setgroups(int gidsetsize, const gid_t *gidset); }
+	SYS_GETPGRP        = 81  // { int sys_getpgrp(void); }
+	SYS_SETPGID        = 82  // { int sys_setpgid(pid_t pid, pid_t pgid); }
+	SYS_FUTEX          = 83  // { int sys_futex(uint32_t *f, int op, int val, const struct timespec *timeout, uint32_t *g); }
+	SYS_UTIMENSAT      = 84  // { int sys_utimensat(int fd, const char *path, const struct timespec *times, int flag); }
+	SYS_FUTIMENS       = 85  // { int sys_futimens(int fd, const struct timespec *times); }
+	SYS_KBIND          = 86  // { int sys_kbind(const struct __kbind *param, size_t psize, int64_t proc_cookie); }
+	SYS_CLOCK_GETTIME  = 87  // { int sys_clock_gettime(clockid_t clock_id, struct timespec *tp); }
+	SYS_CLOCK_SETTIME  = 88  // { int sys_clock_settime(clockid_t clock_id, const struct timespec *tp); }
+	SYS_CLOCK_GETRES   = 89  // { int sys_clock_getres(clockid_t clock_id, struct timespec *tp); }
+	SYS_DUP2           = 90  // { int sys_dup2(int from, int to); }
+	SYS_NANOSLEEP      = 91  // { int sys_nanosleep(const struct timespec *rqtp, struct timespec *rmtp); }
+	SYS_FCNTL          = 92  // { int sys_fcntl(int fd, int cmd, ... void *arg); }
+	SYS_ACCEPT4        = 93  // { int sys_accept4(int s, struct sockaddr *name, socklen_t *anamelen, int flags); }
+	SYS___THRSLEEP     = 94  // { int sys___thrsleep(const volatile void *ident, clockid_t clock_id, const struct timespec *tp, void *lock, const int *abort); }
+	SYS_FSYNC          = 95  // { int sys_fsync(int fd); }
+	SYS_SETPRIORITY    = 96  // { int sys_setpriority(int which, id_t who, int prio); }
+	SYS_SOCKET         = 97  // { int sys_socket(int domain, int type, int protocol); }
+	SYS_CONNECT        = 98  // { int sys_connect(int s, const struct sockaddr *name, socklen_t namelen); }
+	SYS_GETDENTS       = 99  // { int sys_getdents(int fd, void *buf, size_t buflen); }
+	SYS_GETPRIORITY    = 100 // { int sys_getpriority(int which, id_t who); }
+	SYS_PIPE2          = 101 // { int sys_pipe2(int *fdp, int flags); }
+	SYS_DUP3           = 102 // { int sys_dup3(int from, int to, int flags); }
+	SYS_SIGRETURN      = 103 // { int sys_sigreturn(struct sigcontext *sigcntxp); }
+	SYS_BIND           = 104 // { int sys_bind(int s, const struct sockaddr *name, socklen_t namelen); }
+	SYS_SETSOCKOPT     = 105 // { int sys_setsockopt(int s, int level, int name, const void *val, socklen_t valsize); }
+	SYS_LISTEN         = 106 // { int sys_listen(int s, int backlog); }
+	SYS_CHFLAGSAT      = 107 // { int sys_chflagsat(int fd, const char *path, u_int flags, int atflags); }
+	SYS_PLEDGE         = 108 // { int sys_pledge(const char *promises, const char *execpromises); }
+	SYS_PPOLL          = 109 // { int sys_ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *mask); }
+	SYS_PSELECT        = 110 // { int sys_pselect(int nd, fd_set *in, fd_set *ou, fd_set *ex, const struct timespec *ts, const sigset_t *mask); }
+	SYS_SIGSUSPEND     = 111 // { int sys_sigsuspend(int mask); }
+	SYS_SENDSYSLOG     = 112 // { int sys_sendsyslog(const char *buf, size_t nbyte, int flags); }
+	SYS_UNVEIL         = 114 // { int sys_unveil(const char *path, const char *permissions); }
+	SYS_GETSOCKOPT     = 118 // { int sys_getsockopt(int s, int level, int name, void *val, socklen_t *avalsize); }
+	SYS_THRKILL        = 119 // { int sys_thrkill(pid_t tid, int signum, void *tcb); }
+	SYS_READV          = 120 // { ssize_t sys_readv(int fd, const struct iovec *iovp, int iovcnt); }
+	SYS_WRITEV         = 121 // { ssize_t sys_writev(int fd, const struct iovec *iovp, int iovcnt); }
+	SYS_KILL           = 122 // { int sys_kill(int pid, int signum); }
+	SYS_FCHOWN         = 123 // { int sys_fchown(int fd, uid_t uid, gid_t gid); }
+	SYS_FCHMOD         = 124 // { int sys_fchmod(int fd, mode_t mode); }
+	SYS_SETREUID       = 126 // { int sys_setreuid(uid_t ruid, uid_t euid); }
+	SYS_SETREGID       = 127 // { int sys_setregid(gid_t rgid, gid_t egid); }
+	SYS_RENAME         = 128 // { int sys_rename(const char *from, const char *to); }
+	SYS_FLOCK          = 131 // { int sys_flock(int fd, int how); }
+	SYS_MKFIFO         = 132 // { int sys_mkfifo(const char *path, mode_t mode); }
+	SYS_SENDTO         = 133 // { ssize_t sys_sendto(int s, const void *buf, size_t len, int flags, const struct sockaddr *to, socklen_t tolen); }
+	SYS_SHUTDOWN       = 134 // { int sys_shutdown(int s, int how); }
+	SYS_SOCKETPAIR     = 135 // { int sys_socketpair(int domain, int type, int protocol, int *rsv); }
+	SYS_MKDIR          = 136 // { int sys_mkdir(const char *path, mode_t mode); }
+	SYS_RMDIR          = 137 // { int sys_rmdir(const char *path); }
+	SYS_ADJTIME        = 140 // { int sys_adjtime(const struct timeval *delta, struct timeval *olddelta); }
+	SYS_GETLOGIN_R     = 141 // { int sys_getlogin_r(char *namebuf, u_int namelen); }
+	SYS_SETSID         = 147 // { int sys_setsid(void); }
+	SYS_QUOTACTL       = 148 // { int sys_quotactl(const char *path, int cmd, int uid, char *arg); }
+	SYS_NFSSVC         = 155 // { int sys_nfssvc(int flag, void *argp); }
+	SYS_GETFH          = 161 // { int sys_getfh(const char *fname, fhandle_t *fhp); }
+	SYS_SYSARCH        = 165 // { int sys_sysarch(int op, void *parms); }
+	SYS_PREAD          = 173 // { ssize_t sys_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); }
+	SYS_PWRITE         = 174 // { ssize_t sys_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); }
+	SYS_SETGID         = 181 // { int sys_setgid(gid_t gid); }
+	SYS_SETEGID        = 182 // { int sys_setegid(gid_t egid); }
+	SYS_SETEUID        = 183 // { int sys_seteuid(uid_t euid); }
+	SYS_PATHCONF       = 191 // { long sys_pathconf(const char *path, int name); }
+	SYS_FPATHCONF      = 192 // { long sys_fpathconf(int fd, int name); }
+	SYS_SWAPCTL        = 193 // { int sys_swapctl(int cmd, const void *arg, int misc); }
+	SYS_GETRLIMIT      = 194 // { int sys_getrlimit(int which, struct rlimit *rlp); }
+	SYS_SETRLIMIT      = 195 // { int sys_setrlimit(int which, const struct rlimit *rlp); }
+	SYS_MMAP           = 197 // { void *sys_mmap(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); }
+	SYS_LSEEK          = 199 // { off_t sys_lseek(int fd, int pad, off_t offset, int whence); }
+	SYS_TRUNCATE       = 200 // { int sys_truncate(const char *path, int pad, off_t length); }
+	SYS_FTRUNCATE      = 201 // { int sys_ftruncate(int fd, int pad, off_t length); }
+	SYS_SYSCTL         = 202 // { int sys_sysctl(const int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); }
+	SYS_MLOCK          = 203 // { int sys_mlock(const void *addr, size_t len); }
+	SYS_MUNLOCK        = 204 // { int sys_munlock(const void *addr, size_t len); }
+	SYS_GETPGID        = 207 // { pid_t sys_getpgid(pid_t pid); }
+	SYS_UTRACE         = 209 // { int sys_utrace(const char *label, const void *addr, size_t len); }
+	SYS_SEMGET         = 221 // { int sys_semget(key_t key, int nsems, int semflg); }
+	SYS_MSGGET         = 225 // { int sys_msgget(key_t key, int msgflg); }
+	SYS_MSGSND         = 226 // { int sys_msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); }
+	SYS_MSGRCV         = 227 // { int sys_msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); }
+	SYS_SHMAT          = 228 // { void *sys_shmat(int shmid, const void *shmaddr, int shmflg); }
+	SYS_SHMDT          = 230 // { int sys_shmdt(const void *shmaddr); }
+	SYS_MINHERIT       = 250 // { int sys_minherit(void *addr, size_t len, int inherit); }
+	SYS_POLL           = 252 // { int sys_poll(struct pollfd *fds, u_int nfds, int timeout); }
+	SYS_ISSETUGID      = 253 // { int sys_issetugid(void); }
+	SYS_LCHOWN         = 254 // { int sys_lchown(const char *path, uid_t uid, gid_t gid); }
+	SYS_GETSID         = 255 // { pid_t sys_getsid(pid_t pid); }
+	SYS_MSYNC          = 256 // { int sys_msync(void *addr, size_t len, int flags); }
+	SYS_PIPE           = 263 // { int sys_pipe(int *fdp); }
+	SYS_FHOPEN         = 264 // { int sys_fhopen(const fhandle_t *fhp, int flags); }
+	SYS_PREADV         = 267 // { ssize_t sys_preadv(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); }
+	SYS_PWRITEV        = 268 // { ssize_t sys_pwritev(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); }
+	SYS_KQUEUE         = 269 // { int sys_kqueue(void); }
+	SYS_MLOCKALL       = 271 // { int sys_mlockall(int flags); }
+	SYS_MUNLOCKALL     = 272 // { int sys_munlockall(void); }
+	SYS_GETRESUID      = 281 // { int sys_getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); }
+	SYS_SETRESUID      = 282 // { int sys_setresuid(uid_t ruid, uid_t euid, uid_t suid); }
+	SYS_GETRESGID      = 283 // { int sys_getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); }
+	SYS_SETRESGID      = 284 // { int sys_setresgid(gid_t rgid, gid_t egid, gid_t sgid); }
+	SYS_MQUERY         = 286 // { void *sys_mquery(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); }
+	SYS_CLOSEFROM      = 287 // { int sys_closefrom(int fd); }
+	SYS_SIGALTSTACK    = 288 // { int sys_sigaltstack(const struct sigaltstack *nss, struct sigaltstack *oss); }
+	SYS_SHMGET         = 289 // { int sys_shmget(key_t key, size_t size, int shmflg); }
+	SYS_SEMOP          = 290 // { int sys_semop(int semid, struct sembuf *sops, size_t nsops); }
+	SYS_FHSTAT         = 294 // { int sys_fhstat(const fhandle_t *fhp, struct stat *sb); }
+	SYS___SEMCTL       = 295 // { int sys___semctl(int semid, int semnum, int cmd, union semun *arg); }
+	SYS_SHMCTL         = 296 // { int sys_shmctl(int shmid, int cmd, struct shmid_ds *buf); }
+	SYS_MSGCTL         = 297 // { int sys_msgctl(int msqid, int cmd, struct msqid_ds *buf); }
+	SYS_SCHED_YIELD    = 298 // { int sys_sched_yield(void); }
+	SYS_GETTHRID       = 299 // { pid_t sys_getthrid(void); }
+	SYS___THRWAKEUP    = 301 // { int sys___thrwakeup(const volatile void *ident, int n); }
+	SYS___THREXIT      = 302 // { void sys___threxit(pid_t *notdead); }
+	SYS___THRSIGDIVERT = 303 // { int sys___thrsigdivert(sigset_t sigmask, siginfo_t *info, const struct timespec *timeout); }
+	SYS___GETCWD       = 304 // { int sys___getcwd(char *buf, size_t len); }
+	SYS_ADJFREQ        = 305 // { int sys_adjfreq(const int64_t *freq, int64_t *oldfreq); }
+	SYS_SETRTABLE      = 310 // { int sys_setrtable(int rtableid); }
+	SYS_GETRTABLE      = 311 // { int sys_getrtable(void); }
+	SYS_FACCESSAT      = 313 // { int sys_faccessat(int fd, const char *path, int amode, int flag); }
+	SYS_FCHMODAT       = 314 // { int sys_fchmodat(int fd, const char *path, mode_t mode, int flag); }
+	SYS_FCHOWNAT       = 315 // { int sys_fchownat(int fd, const char *path, uid_t uid, gid_t gid, int flag); }
+	SYS_LINKAT         = 317 // { int sys_linkat(int fd1, const char *path1, int fd2, const char *path2, int flag); }
+	SYS_MKDIRAT        = 318 // { int sys_mkdirat(int fd, const char *path, mode_t mode); }
+	SYS_MKFIFOAT       = 319 // { int sys_mkfifoat(int fd, const char *path, mode_t mode); }
+	SYS_MKNODAT        = 320 // { int sys_mknodat(int fd, const char *path, mode_t mode, dev_t dev); }
+	SYS_OPENAT         = 321 // { int sys_openat(int fd, const char *path, int flags, ... mode_t mode); }
+	SYS_READLINKAT     = 322 // { ssize_t sys_readlinkat(int fd, const char *path, char *buf, size_t count); }
+	SYS_RENAMEAT       = 323 // { int sys_renameat(int fromfd, const char *from, int tofd, const char *to); }
+	SYS_SYMLINKAT      = 324 // { int sys_symlinkat(const char *path, int fd, const char *link); }
+	SYS_UNLINKAT       = 325 // { int sys_unlinkat(int fd, const char *path, int flag); }
+	SYS___SET_TCB      = 329 // { void sys___set_tcb(void *tcb); }
+	SYS___GET_TCB      = 330 // { void *sys___get_tcb(void); }
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go
index cedc9b0..2c1f815 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go
@@ -30,11 +30,6 @@ type Timespec struct {
 	Nsec int32
 }
 
-type StTimespec struct {
-	Sec  int32
-	Nsec int32
-}
-
 type Timeval struct {
 	Sec  int32
 	Usec int32
@@ -101,9 +96,9 @@ type Stat_t struct {
 	Gid      uint32
 	Rdev     uint32
 	Size     int32
-	Atim     StTimespec
-	Mtim     StTimespec
-	Ctim     StTimespec
+	Atim     Timespec
+	Mtim     Timespec
+	Ctim     Timespec
 	Blksize  int32
 	Blocks   int32
 	Vfstype  int32
@@ -148,6 +143,17 @@ type RawSockaddrUnix struct {
 	Path   [1023]uint8
 }
 
+type RawSockaddrDatalink struct {
+	Len    uint8
+	Family uint8
+	Index  uint16
+	Type   uint8
+	Nlen   uint8
+	Alen   uint8
+	Slen   uint8
+	Data   [120]uint8
+}
+
 type RawSockaddr struct {
 	Len    uint8
 	Family uint8
@@ -207,17 +213,18 @@ type Msghdr struct {
 }
 
 const (
-	SizeofSockaddrInet4 = 0x10
-	SizeofSockaddrInet6 = 0x1c
-	SizeofSockaddrAny   = 0x404
-	SizeofSockaddrUnix  = 0x401
-	SizeofLinger        = 0x8
-	SizeofIPMreq        = 0x8
-	SizeofIPv6Mreq      = 0x14
-	SizeofIPv6MTUInfo   = 0x20
-	SizeofMsghdr        = 0x1c
-	SizeofCmsghdr       = 0xc
-	SizeofICMPv6Filter  = 0x20
+	SizeofSockaddrInet4    = 0x10
+	SizeofSockaddrInet6    = 0x1c
+	SizeofSockaddrAny      = 0x404
+	SizeofSockaddrUnix     = 0x401
+	SizeofSockaddrDatalink = 0x80
+	SizeofLinger           = 0x8
+	SizeofIPMreq           = 0x8
+	SizeofIPv6Mreq         = 0x14
+	SizeofIPv6MTUInfo      = 0x20
+	SizeofMsghdr           = 0x1c
+	SizeofCmsghdr          = 0xc
+	SizeofICMPv6Filter     = 0x20
 )
 
 const (
diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go
index f46482d..b4a069e 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go
@@ -30,12 +30,6 @@ type Timespec struct {
 	Nsec int64
 }
 
-type StTimespec struct {
-	Sec  int64
-	Nsec int32
-	_    [4]byte
-}
-
 type Timeval struct {
 	Sec  int64
 	Usec int32
@@ -103,10 +97,9 @@ type Stat_t struct {
 	Gid      uint32
 	Rdev     uint64
 	Ssize    int32
-	_        [4]byte
-	Atim     StTimespec
-	Mtim     StTimespec
-	Ctim     StTimespec
+	Atim     Timespec
+	Mtim     Timespec
+	Ctim     Timespec
 	Blksize  int64
 	Blocks   int64
 	Vfstype  int32
@@ -154,6 +147,17 @@ type RawSockaddrUnix struct {
 	Path   [1023]uint8
 }
 
+type RawSockaddrDatalink struct {
+	Len    uint8
+	Family uint8
+	Index  uint16
+	Type   uint8
+	Nlen   uint8
+	Alen   uint8
+	Slen   uint8
+	Data   [120]uint8
+}
+
 type RawSockaddr struct {
 	Len    uint8
 	Family uint8
@@ -205,27 +209,26 @@ type Linger struct {
 type Msghdr struct {
 	Name       *byte
 	Namelen    uint32
-	_          [4]byte
 	Iov        *Iovec
 	Iovlen     int32
-	_          [4]byte
 	Control    *byte
 	Controllen uint32
 	Flags      int32
 }
 
 const (
-	SizeofSockaddrInet4 = 0x10
-	SizeofSockaddrInet6 = 0x1c
-	SizeofSockaddrAny   = 0x404
-	SizeofSockaddrUnix  = 0x401
-	SizeofLinger        = 0x8
-	SizeofIPMreq        = 0x8
-	SizeofIPv6Mreq      = 0x14
-	SizeofIPv6MTUInfo   = 0x20
-	SizeofMsghdr        = 0x30
-	SizeofCmsghdr       = 0xc
-	SizeofICMPv6Filter  = 0x20
+	SizeofSockaddrInet4    = 0x10
+	SizeofSockaddrInet6    = 0x1c
+	SizeofSockaddrAny      = 0x404
+	SizeofSockaddrUnix     = 0x401
+	SizeofSockaddrDatalink = 0x80
+	SizeofLinger           = 0x8
+	SizeofIPMreq           = 0x8
+	SizeofIPv6Mreq         = 0x14
+	SizeofIPv6MTUInfo      = 0x20
+	SizeofMsghdr           = 0x30
+	SizeofCmsghdr          = 0xc
+	SizeofICMPv6Filter     = 0x20
 )
 
 const (
@@ -339,7 +342,6 @@ type Statfs_t struct {
 	Ffree     uint64
 	Fsid      Fsid64_t
 	Vfstype   int32
-	_         [4]byte
 	Fsize     uint64
 	Vfsnumber int32
 	Vfsoff    int32
diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_386.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_386.go
index cefe2f8..9f47b87 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_darwin_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_386.go
@@ -59,24 +59,24 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           int32
-	Mode          uint16
-	Nlink         uint16
-	Ino           uint64
-	Uid           uint32
-	Gid           uint32
-	Rdev          int32
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       int32
-	Flags         uint32
-	Gen           uint32
-	Lspare        int32
-	Qspare        [2]int64
+	Dev     int32
+	Mode    uint16
+	Nlink   uint16
+	Ino     uint64
+	Uid     uint32
+	Gid     uint32
+	Rdev    int32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Qspare  [2]int64
 }
 
 type Statfs_t struct {
diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go
index c6bb883..966798a 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go
@@ -63,25 +63,25 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           int32
-	Mode          uint16
-	Nlink         uint16
-	Ino           uint64
-	Uid           uint32
-	Gid           uint32
-	Rdev          int32
-	_             [4]byte
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       int32
-	Flags         uint32
-	Gen           uint32
-	Lspare        int32
-	Qspare        [2]int64
+	Dev     int32
+	Mode    uint16
+	Nlink   uint16
+	Ino     uint64
+	Uid     uint32
+	Gid     uint32
+	Rdev    int32
+	_       [4]byte
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Qspare  [2]int64
 }
 
 type Statfs_t struct {
diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm.go
index 94c23bc..4fe4c9c 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm.go
@@ -60,24 +60,24 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           int32
-	Mode          uint16
-	Nlink         uint16
-	Ino           uint64
-	Uid           uint32
-	Gid           uint32
-	Rdev          int32
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       int32
-	Flags         uint32
-	Gen           uint32
-	Lspare        int32
-	Qspare        [2]int64
+	Dev     int32
+	Mode    uint16
+	Nlink   uint16
+	Ino     uint64
+	Uid     uint32
+	Gid     uint32
+	Rdev    int32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Qspare  [2]int64
 }
 
 type Statfs_t struct {
diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go
index c82a930..21999e4 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go
@@ -63,25 +63,25 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           int32
-	Mode          uint16
-	Nlink         uint16
-	Ino           uint64
-	Uid           uint32
-	Gid           uint32
-	Rdev          int32
-	_             [4]byte
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       int32
-	Flags         uint32
-	Gen           uint32
-	Lspare        int32
-	Qspare        [2]int64
+	Dev     int32
+	Mode    uint16
+	Nlink   uint16
+	Ino     uint64
+	Uid     uint32
+	Gid     uint32
+	Rdev    int32
+	_       [4]byte
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Qspare  [2]int64
 }
 
 type Statfs_t struct {
diff --git a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go
index 7b34e2e..c206f2b 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go
@@ -57,25 +57,25 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Ino      uint64
-	Nlink    uint32
-	Dev      uint32
-	Mode     uint16
-	Padding1 uint16
-	Uid      uint32
-	Gid      uint32
-	Rdev     uint32
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  uint32
-	Flags    uint32
-	Gen      uint32
-	Lspare   int32
-	Qspare1  int64
-	Qspare2  int64
+	Ino     uint64
+	Nlink   uint32
+	Dev     uint32
+	Mode    uint16
+	_1      uint16
+	Uid     uint32
+	Gid     uint32
+	Rdev    uint32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize uint32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Qspare1 int64
+	Qspare2 int64
 }
 
 type Statfs_t struct {
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go
index c146c1a..7312e95 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go
@@ -62,50 +62,50 @@ const (
 )
 
 type Stat_t struct {
-	Dev      uint64
-	Ino      uint64
-	Nlink    uint64
-	Mode     uint16
-	_0       int16
-	Uid      uint32
-	Gid      uint32
-	_1       int32
-	Rdev     uint64
-	Atim_ext int32
-	Atim     Timespec
-	Mtim_ext int32
-	Mtim     Timespec
-	Ctim_ext int32
-	Ctim     Timespec
-	Btim_ext int32
-	Birthtim Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint64
-	Spare    [10]uint64
+	Dev     uint64
+	Ino     uint64
+	Nlink   uint64
+	Mode    uint16
+	_0      int16
+	Uid     uint32
+	Gid     uint32
+	_1      int32
+	Rdev    uint64
+	_       int32
+	Atim    Timespec
+	_       int32
+	Mtim    Timespec
+	_       int32
+	Ctim    Timespec
+	_       int32
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint64
+	Spare   [10]uint64
 }
 
 type stat_freebsd11_t struct {
-	Dev      uint32
-	Ino      uint32
-	Mode     uint16
-	Nlink    uint16
-	Uid      uint32
-	Gid      uint32
-	Rdev     uint32
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint32
-	Lspare   int32
-	Birthtim Timespec
-	_        [8]byte
+	Dev     uint32
+	Ino     uint32
+	Mode    uint16
+	Nlink   uint16
+	Uid     uint32
+	Gid     uint32
+	Rdev    uint32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Btim    Timespec
+	_       [8]byte
 }
 
 type Statfs_t struct {
@@ -324,11 +324,108 @@ const (
 )
 
 const (
-	PTRACE_TRACEME = 0x0
-	PTRACE_CONT    = 0x7
-	PTRACE_KILL    = 0x8
+	PTRACE_ATTACH     = 0xa
+	PTRACE_CONT       = 0x7
+	PTRACE_DETACH     = 0xb
+	PTRACE_GETFPREGS  = 0x23
+	PTRACE_GETFSBASE  = 0x47
+	PTRACE_GETLWPLIST = 0xf
+	PTRACE_GETNUMLWPS = 0xe
+	PTRACE_GETREGS    = 0x21
+	PTRACE_GETXSTATE  = 0x45
+	PTRACE_IO         = 0xc
+	PTRACE_KILL       = 0x8
+	PTRACE_LWPEVENTS  = 0x18
+	PTRACE_LWPINFO    = 0xd
+	PTRACE_SETFPREGS  = 0x24
+	PTRACE_SETREGS    = 0x22
+	PTRACE_SINGLESTEP = 0x9
+	PTRACE_TRACEME    = 0x0
+)
+
+const (
+	PIOD_READ_D  = 0x1
+	PIOD_WRITE_D = 0x2
+	PIOD_READ_I  = 0x3
+	PIOD_WRITE_I = 0x4
+)
+
+const (
+	PL_FLAG_BORN   = 0x100
+	PL_FLAG_EXITED = 0x200
+	PL_FLAG_SI     = 0x20
+)
+
+const (
+	TRAP_BRKPT = 0x1
+	TRAP_TRACE = 0x2
 )
 
+type PtraceLwpInfoStruct struct {
+	Lwpid        int32
+	Event        int32
+	Flags        int32
+	Sigmask      Sigset_t
+	Siglist      Sigset_t
+	Siginfo      __Siginfo
+	Tdname       [20]int8
+	Child_pid    int32
+	Syscall_code uint32
+	Syscall_narg uint32
+}
+
+type __Siginfo struct {
+	Signo    int32
+	Errno    int32
+	Code     int32
+	Pid      int32
+	Uid      uint32
+	Status   int32
+	Addr     *byte
+	Value    [4]byte
+	X_reason [32]byte
+}
+
+type Sigset_t struct {
+	Val [4]uint32
+}
+
+type Reg struct {
+	Fs     uint32
+	Es     uint32
+	Ds     uint32
+	Edi    uint32
+	Esi    uint32
+	Ebp    uint32
+	Isp    uint32
+	Ebx    uint32
+	Edx    uint32
+	Ecx    uint32
+	Eax    uint32
+	Trapno uint32
+	Err    uint32
+	Eip    uint32
+	Cs     uint32
+	Eflags uint32
+	Esp    uint32
+	Ss     uint32
+	Gs     uint32
+}
+
+type FpReg struct {
+	Env   [7]uint32
+	Acc   [8][10]uint8
+	Ex_sw uint32
+	Pad   [64]uint8
+}
+
+type PtraceIoDesc struct {
+	Op   int32
+	Offs *byte
+	Addr *byte
+	Len  uint
+}
+
 type Kevent_t struct {
 	Ident  uint32
 	Filter int16
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go
index ac33a8d..29ba2f5 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go
@@ -62,45 +62,45 @@ const (
 )
 
 type Stat_t struct {
-	Dev      uint64
-	Ino      uint64
-	Nlink    uint64
-	Mode     uint16
-	_0       int16
-	Uid      uint32
-	Gid      uint32
-	_1       int32
-	Rdev     uint64
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Birthtim Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint64
-	Spare    [10]uint64
+	Dev     uint64
+	Ino     uint64
+	Nlink   uint64
+	Mode    uint16
+	_0      int16
+	Uid     uint32
+	Gid     uint32
+	_1      int32
+	Rdev    uint64
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint64
+	Spare   [10]uint64
 }
 
 type stat_freebsd11_t struct {
-	Dev      uint32
-	Ino      uint32
-	Mode     uint16
-	Nlink    uint16
-	Uid      uint32
-	Gid      uint32
-	Rdev     uint32
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint32
-	Lspare   int32
-	Birthtim Timespec
+	Dev     uint32
+	Ino     uint32
+	Mode    uint16
+	Nlink   uint16
+	Uid     uint32
+	Gid     uint32
+	Rdev    uint32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Btim    Timespec
 }
 
 type Statfs_t struct {
@@ -322,11 +322,115 @@ const (
 )
 
 const (
-	PTRACE_TRACEME = 0x0
-	PTRACE_CONT    = 0x7
-	PTRACE_KILL    = 0x8
+	PTRACE_ATTACH     = 0xa
+	PTRACE_CONT       = 0x7
+	PTRACE_DETACH     = 0xb
+	PTRACE_GETFPREGS  = 0x23
+	PTRACE_GETFSBASE  = 0x47
+	PTRACE_GETLWPLIST = 0xf
+	PTRACE_GETNUMLWPS = 0xe
+	PTRACE_GETREGS    = 0x21
+	PTRACE_GETXSTATE  = 0x45
+	PTRACE_IO         = 0xc
+	PTRACE_KILL       = 0x8
+	PTRACE_LWPEVENTS  = 0x18
+	PTRACE_LWPINFO    = 0xd
+	PTRACE_SETFPREGS  = 0x24
+	PTRACE_SETREGS    = 0x22
+	PTRACE_SINGLESTEP = 0x9
+	PTRACE_TRACEME    = 0x0
 )
 
+const (
+	PIOD_READ_D  = 0x1
+	PIOD_WRITE_D = 0x2
+	PIOD_READ_I  = 0x3
+	PIOD_WRITE_I = 0x4
+)
+
+const (
+	PL_FLAG_BORN   = 0x100
+	PL_FLAG_EXITED = 0x200
+	PL_FLAG_SI     = 0x20
+)
+
+const (
+	TRAP_BRKPT = 0x1
+	TRAP_TRACE = 0x2
+)
+
+type PtraceLwpInfoStruct struct {
+	Lwpid        int32
+	Event        int32
+	Flags        int32
+	Sigmask      Sigset_t
+	Siglist      Sigset_t
+	Siginfo      __Siginfo
+	Tdname       [20]int8
+	Child_pid    int32
+	Syscall_code uint32
+	Syscall_narg uint32
+}
+
+type __Siginfo struct {
+	Signo  int32
+	Errno  int32
+	Code   int32
+	Pid    int32
+	Uid    uint32
+	Status int32
+	Addr   *byte
+	Value  [8]byte
+	_      [40]byte
+}
+
+type Sigset_t struct {
+	Val [4]uint32
+}
+
+type Reg struct {
+	R15    int64
+	R14    int64
+	R13    int64
+	R12    int64
+	R11    int64
+	R10    int64
+	R9     int64
+	R8     int64
+	Rdi    int64
+	Rsi    int64
+	Rbp    int64
+	Rbx    int64
+	Rdx    int64
+	Rcx    int64
+	Rax    int64
+	Trapno uint32
+	Fs     uint16
+	Gs     uint16
+	Err    uint32
+	Es     uint16
+	Ds     uint16
+	Rip    int64
+	Cs     int64
+	Rflags int64
+	Rsp    int64
+	Ss     int64
+}
+
+type FpReg struct {
+	Env   [4]uint64
+	Acc   [8][16]uint8
+	Xacc  [16][16]uint8
+	Spare [12]uint64
+}
+
+type PtraceIoDesc struct {
+	Op   int32
+	Offs *byte
+	Addr *byte
+	Len  uint
+}
+
 type Kevent_t struct {
 	Ident  uint64
 	Filter int16
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go
index e27511a..b4090ef 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go
@@ -64,45 +64,45 @@ const (
 )
 
 type Stat_t struct {
-	Dev      uint64
-	Ino      uint64
-	Nlink    uint64
-	Mode     uint16
-	_0       int16
-	Uid      uint32
-	Gid      uint32
-	_1       int32
-	Rdev     uint64
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Birthtim Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint64
-	Spare    [10]uint64
+	Dev     uint64
+	Ino     uint64
+	Nlink   uint64
+	Mode    uint16
+	_0      int16
+	Uid     uint32
+	Gid     uint32
+	_1      int32
+	Rdev    uint64
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint64
+	Spare   [10]uint64
 }
 
 type stat_freebsd11_t struct {
-	Dev      uint32
-	Ino      uint32
-	Mode     uint16
-	Nlink    uint16
-	Uid      uint32
-	Gid      uint32
-	Rdev     uint32
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint32
-	Lspare   int32
-	Birthtim Timespec
+	Dev     uint32
+	Ino     uint32
+	Mode    uint16
+	Nlink   uint16
+	Uid     uint32
+	Gid     uint32
+	Rdev    uint32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Btim    Timespec
 }
 
 type Statfs_t struct {
@@ -322,11 +322,92 @@ const (
 )
 
 const (
-	PTRACE_TRACEME = 0x0
-	PTRACE_CONT    = 0x7
-	PTRACE_KILL    = 0x8
+	PTRACE_ATTACH     = 0xa
+	PTRACE_CONT       = 0x7
+	PTRACE_DETACH     = 0xb
+	PTRACE_GETFPREGS  = 0x23
+	PTRACE_GETFSBASE  = 0x47
+	PTRACE_GETLWPLIST = 0xf
+	PTRACE_GETNUMLWPS = 0xe
+	PTRACE_GETREGS    = 0x21
+	PTRACE_GETXSTATE  = 0x45
+	PTRACE_IO         = 0xc
+	PTRACE_KILL       = 0x8
+	PTRACE_LWPEVENTS  = 0x18
+	PTRACE_LWPINFO    = 0xd
+	PTRACE_SETFPREGS  = 0x24
+	PTRACE_SETREGS    = 0x22
+	PTRACE_SINGLESTEP = 0x9
+	PTRACE_TRACEME    = 0x0
+)
+
+const (
+	PIOD_READ_D  = 0x1
+	PIOD_WRITE_D = 0x2
+	PIOD_READ_I  = 0x3
+	PIOD_WRITE_I = 0x4
+)
+
+const (
+	PL_FLAG_BORN   = 0x100
+	PL_FLAG_EXITED = 0x200
+	PL_FLAG_SI     = 0x20
+)
+
+const (
+	TRAP_BRKPT = 0x1
+	TRAP_TRACE = 0x2
 )
 
+type PtraceLwpInfoStruct struct {
+	Lwpid        int32
+	Event        int32
+	Flags        int32
+	Sigmask      Sigset_t
+	Siglist      Sigset_t
+	Siginfo      __Siginfo
+	Tdname       [20]int8
+	Child_pid    int32
+	Syscall_code uint32
+	Syscall_narg uint32
+}
+
+type __Siginfo struct {
+	Signo    int32
+	Errno    int32
+	Code     int32
+	Pid      int32
+	Uid      uint32
+	Status   int32
+	Addr     *byte
+	Value    [4]byte
+	X_reason [32]byte
+}
+
+type Sigset_t struct {
+	Val [4]uint32
+}
+
+type Reg struct {
+	R      [13]uint32
+	R_sp   uint32
+	R_lr   uint32
+	R_pc   uint32
+	R_cpsr uint32
+}
+
+type FpReg struct {
+	Fpr_fpsr uint32
+	Fpr      [8][3]uint32
+}
+
+type PtraceIoDesc struct {
+	Op   int32
+	Offs *byte
+	Addr *byte
+	Len  uint
+}
+
 type Kevent_t struct {
 	Ident  uint32
 	Filter int16
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go
index 2aadc1a..1542a87 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go
@@ -62,45 +62,45 @@ const (
 )
 
 type Stat_t struct {
-	Dev      uint64
-	Ino      uint64
-	Nlink    uint64
-	Mode     uint16
-	_0       int16
-	Uid      uint32
-	Gid      uint32
-	_1       int32
-	Rdev     uint64
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Birthtim Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint64
-	Spare    [10]uint64
+	Dev     uint64
+	Ino     uint64
+	Nlink   uint64
+	Mode    uint16
+	_0      int16
+	Uid     uint32
+	Gid     uint32
+	_1      int32
+	Rdev    uint64
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint64
+	Spare   [10]uint64
 }
 
 type stat_freebsd11_t struct {
-	Dev      uint32
-	Ino      uint32
-	Mode     uint16
-	Nlink    uint16
-	Uid      uint32
-	Gid      uint32
-	Rdev     uint32
-	Atim     Timespec
-	Mtim     Timespec
-	Ctim     Timespec
-	Size     int64
-	Blocks   int64
-	Blksize  int32
-	Flags    uint32
-	Gen      uint32
-	Lspare   int32
-	Birthtim Timespec
+	Dev     uint32
+	Ino     uint32
+	Mode    uint16
+	Nlink   uint16
+	Uid     uint32
+	Gid     uint32
+	Rdev    uint32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	Lspare  int32
+	Btim    Timespec
 }
 
 type Statfs_t struct {
@@ -322,11 +322,93 @@ const (
 )
 
 const (
-	PTRACE_TRACEME = 0x0
-	PTRACE_CONT    = 0x7
-	PTRACE_KILL    = 0x8
+	PTRACE_ATTACH     = 0xa
+	PTRACE_CONT       = 0x7
+	PTRACE_DETACH     = 0xb
+	PTRACE_GETFPREGS  = 0x23
+	PTRACE_GETFSBASE  = 0x47
+	PTRACE_GETLWPLIST = 0xf
+	PTRACE_GETNUMLWPS = 0xe
+	PTRACE_GETREGS    = 0x21
+	PTRACE_GETXSTATE  = 0x45
+	PTRACE_IO         = 0xc
+	PTRACE_KILL       = 0x8
+	PTRACE_LWPEVENTS  = 0x18
+	PTRACE_LWPINFO    = 0xd
+	PTRACE_SETFPREGS  = 0x24
+	PTRACE_SETREGS    = 0x22
+	PTRACE_SINGLESTEP = 0x9
+	PTRACE_TRACEME    = 0x0
+)
+
+const (
+	PIOD_READ_D  = 0x1
+	PIOD_WRITE_D = 0x2
+	PIOD_READ_I  = 0x3
+	PIOD_WRITE_I = 0x4
+)
+
+const (
+	PL_FLAG_BORN   = 0x100
+	PL_FLAG_EXITED = 0x200
+	PL_FLAG_SI     = 0x20
+)
+
+const (
+	TRAP_BRKPT = 0x1
+	TRAP_TRACE = 0x2
 )
 
+type PtraceLwpInfoStruct struct {
+	Lwpid        int32
+	Event        int32
+	Flags        int32
+	Sigmask      Sigset_t
+	Siglist      Sigset_t
+	Siginfo      __Siginfo
+	Tdname       [20]int8
+	Child_pid    int32
+	Syscall_code uint32
+	Syscall_narg uint32
+}
+
+type __Siginfo struct {
+	Signo    int32
+	Errno    int32
+	Code     int32
+	Pid      int32
+	Uid      uint32
+	Status   int32
+	Addr     *byte
+	Value    [8]byte
+	X_reason [40]byte
+}
+
+type Sigset_t struct {
+	Val [4]uint32
+}
+
+type Reg struct {
+	X    [30]uint64
+	Lr   uint64
+	Sp   uint64
+	Elr  uint64
+	Spsr uint32
+}
+
+type FpReg struct {
+	Fp_q  [32]uint128
+	Fp_sr uint32
+	Fp_cr uint32
+}
+
+type PtraceIoDesc struct {
+	Op   int32
+	Offs *byte
+	Addr *byte
+	Len  uint
+}
+
 type Kevent_t struct {
 	Ident  uint64
 	Filter int16
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go
index a908f25..5492b96 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go
@@ -829,6 +829,8 @@ type Sigset_t struct {
 	Val [32]uint32
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1452,6 +1454,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2133,3 +2150,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go
index e63fa74..caf33b2 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go
@@ -842,6 +842,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1464,6 +1466,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2146,3 +2163,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go
index 34e4e6d..93aec7e 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go
@@ -818,6 +818,8 @@ type Sigset_t struct {
 	Val [32]uint32
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1442,6 +1444,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2124,3 +2141,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]uint8
+	Driver_name [64]uint8
+	Module_name [64]uint8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]uint8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]uint8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]uint8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]uint8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportHash struct {
+	Type       [64]uint8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]uint8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]uint8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]uint8
+}
+
+type CryptoReportKPP struct {
+	Type [64]uint8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]uint8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go
index 7f2e26f..0a03843 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go
@@ -821,6 +821,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1443,6 +1445,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2125,3 +2142,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go
index 66e408f..2de0e58 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go
@@ -823,6 +823,8 @@ type Sigset_t struct {
 	Val [32]uint32
 }
 
+const _C__NSIG = 0x80
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1448,6 +1450,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2130,3 +2147,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go
index e60575a..3735eb4 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go
@@ -823,6 +823,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x80
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1445,6 +1447,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2127,3 +2144,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go
index af5836a..073c299 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go
@@ -823,6 +823,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x80
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1445,6 +1447,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2127,3 +2144,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go
index 471706a..58d09f7 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go
@@ -823,6 +823,8 @@ type Sigset_t struct {
 	Val [32]uint32
 }
 
+const _C__NSIG = 0x80
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1448,6 +1450,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2130,3 +2147,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go
index 6cfa149..3f1e62e 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go
@@ -831,6 +831,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1453,6 +1455,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2135,3 +2152,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]uint8
+	Driver_name [64]uint8
+	Module_name [64]uint8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]uint8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]uint8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]uint8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]uint8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportHash struct {
+	Type       [64]uint8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]uint8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]uint8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]uint8
+}
+
+type CryptoReportKPP struct {
+	Type [64]uint8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]uint8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go
index acb3773..e67be11 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go
@@ -831,6 +831,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1453,6 +1455,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2135,3 +2152,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]uint8
+	Driver_name [64]uint8
+	Module_name [64]uint8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]uint8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]uint8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]uint8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]uint8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportHash struct {
+	Type       [64]uint8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]uint8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]uint8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]uint8
+}
+
+type CryptoReportKPP struct {
+	Type [64]uint8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]uint8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go
index 9735b25..f44f294 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go
@@ -848,6 +848,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1470,6 +1472,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2152,3 +2169,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]uint8
+	Driver_name [64]uint8
+	Module_name [64]uint8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]uint8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]uint8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]uint8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]uint8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]uint8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportLarval struct {
+	Type [64]uint8
+}
+
+type CryptoReportHash struct {
+	Type       [64]uint8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]uint8
+	Geniv       [64]uint8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]uint8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]uint8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]uint8
+}
+
+type CryptoReportKPP struct {
+	Type [64]uint8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]uint8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go
index 5369f65..90bf5dc 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go
@@ -844,6 +844,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1467,6 +1469,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2149,3 +2166,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go
index 552dbe5..4f054dc 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go
@@ -826,6 +826,8 @@ type Sigset_t struct {
 	Val [16]uint64
 }
 
+const _C__NSIG = 0x41
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1448,6 +1450,21 @@ type TpacketBlockDesc struct {
 	Hdr     [40]byte
 }
 
+type TpacketBDTS struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type TpacketHdrV1 struct {
+	Block_status        uint32
+	Num_pkts            uint32
+	Offset_to_first_pkt uint32
+	Blk_len             uint32
+	Seq_num             uint64
+	Ts_first_pkt        TpacketBDTS
+	Ts_last_pkt         TpacketBDTS
+}
+
 type TpacketReq struct {
 	Block_size uint32
 	Block_nr   uint32
@@ -2130,3 +2147,337 @@ type FanotifyResponse struct {
 	Fd       int32
 	Response uint32
 }
+
+const (
+	CRYPTO_MSG_BASE      = 0x10
+	CRYPTO_MSG_NEWALG    = 0x10
+	CRYPTO_MSG_DELALG    = 0x11
+	CRYPTO_MSG_UPDATEALG = 0x12
+	CRYPTO_MSG_GETALG    = 0x13
+	CRYPTO_MSG_DELRNG    = 0x14
+	CRYPTO_MSG_GETSTAT   = 0x15
+)
+
+const (
+	CRYPTOCFGA_UNSPEC           = 0x0
+	CRYPTOCFGA_PRIORITY_VAL     = 0x1
+	CRYPTOCFGA_REPORT_LARVAL    = 0x2
+	CRYPTOCFGA_REPORT_HASH      = 0x3
+	CRYPTOCFGA_REPORT_BLKCIPHER = 0x4
+	CRYPTOCFGA_REPORT_AEAD      = 0x5
+	CRYPTOCFGA_REPORT_COMPRESS  = 0x6
+	CRYPTOCFGA_REPORT_RNG       = 0x7
+	CRYPTOCFGA_REPORT_CIPHER    = 0x8
+	CRYPTOCFGA_REPORT_AKCIPHER  = 0x9
+	CRYPTOCFGA_REPORT_KPP       = 0xa
+	CRYPTOCFGA_REPORT_ACOMP     = 0xb
+	CRYPTOCFGA_STAT_LARVAL      = 0xc
+	CRYPTOCFGA_STAT_HASH        = 0xd
+	CRYPTOCFGA_STAT_BLKCIPHER   = 0xe
+	CRYPTOCFGA_STAT_AEAD        = 0xf
+	CRYPTOCFGA_STAT_COMPRESS    = 0x10
+	CRYPTOCFGA_STAT_RNG         = 0x11
+	CRYPTOCFGA_STAT_CIPHER      = 0x12
+	CRYPTOCFGA_STAT_AKCIPHER    = 0x13
+	CRYPTOCFGA_STAT_KPP         = 0x14
+	CRYPTOCFGA_STAT_ACOMP       = 0x15
+)
+
+type CryptoUserAlg struct {
+	Name        [64]int8
+	Driver_name [64]int8
+	Module_name [64]int8
+	Type        uint32
+	Mask        uint32
+	Refcnt      uint32
+	Flags       uint32
+}
+
+type CryptoStatAEAD struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatAKCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Verify_cnt   uint64
+	Sign_cnt     uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCipher struct {
+	Type         [64]int8
+	Encrypt_cnt  uint64
+	Encrypt_tlen uint64
+	Decrypt_cnt  uint64
+	Decrypt_tlen uint64
+	Err_cnt      uint64
+}
+
+type CryptoStatCompress struct {
+	Type            [64]int8
+	Compress_cnt    uint64
+	Compress_tlen   uint64
+	Decompress_cnt  uint64
+	Decompress_tlen uint64
+	Err_cnt         uint64
+}
+
+type CryptoStatHash struct {
+	Type      [64]int8
+	Hash_cnt  uint64
+	Hash_tlen uint64
+	Err_cnt   uint64
+}
+
+type CryptoStatKPP struct {
+	Type                      [64]int8
+	Setsecret_cnt             uint64
+	Generate_public_key_cnt   uint64
+	Compute_shared_secret_cnt uint64
+	Err_cnt                   uint64
+}
+
+type CryptoStatRNG struct {
+	Type          [64]int8
+	Generate_cnt  uint64
+	Generate_tlen uint64
+	Seed_cnt      uint64
+	Err_cnt       uint64
+}
+
+type CryptoStatLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportLarval struct {
+	Type [64]int8
+}
+
+type CryptoReportHash struct {
+	Type       [64]int8
+	Blocksize  uint32
+	Digestsize uint32
+}
+
+type CryptoReportCipher struct {
+	Type        [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+}
+
+type CryptoReportBlkCipher struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Min_keysize uint32
+	Max_keysize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportAEAD struct {
+	Type        [64]int8
+	Geniv       [64]int8
+	Blocksize   uint32
+	Maxauthsize uint32
+	Ivsize      uint32
+}
+
+type CryptoReportComp struct {
+	Type [64]int8
+}
+
+type CryptoReportRNG struct {
+	Type     [64]int8
+	Seedsize uint32
+}
+
+type CryptoReportAKCipher struct {
+	Type [64]int8
+}
+
+type CryptoReportKPP struct {
+	Type [64]int8
+}
+
+type CryptoReportAcomp struct {
+	Type [64]int8
+}
+
+const (
+	BPF_REG_0                           = 0x0
+	BPF_REG_1                           = 0x1
+	BPF_REG_2                           = 0x2
+	BPF_REG_3                           = 0x3
+	BPF_REG_4                           = 0x4
+	BPF_REG_5                           = 0x5
+	BPF_REG_6                           = 0x6
+	BPF_REG_7                           = 0x7
+	BPF_REG_8                           = 0x8
+	BPF_REG_9                           = 0x9
+	BPF_REG_10                          = 0xa
+	BPF_MAP_CREATE                      = 0x0
+	BPF_MAP_LOOKUP_ELEM                 = 0x1
+	BPF_MAP_UPDATE_ELEM                 = 0x2
+	BPF_MAP_DELETE_ELEM                 = 0x3
+	BPF_MAP_GET_NEXT_KEY                = 0x4
+	BPF_PROG_LOAD                       = 0x5
+	BPF_OBJ_PIN                         = 0x6
+	BPF_OBJ_GET                         = 0x7
+	BPF_PROG_ATTACH                     = 0x8
+	BPF_PROG_DETACH                     = 0x9
+	BPF_PROG_TEST_RUN                   = 0xa
+	BPF_PROG_GET_NEXT_ID                = 0xb
+	BPF_MAP_GET_NEXT_ID                 = 0xc
+	BPF_PROG_GET_FD_BY_ID               = 0xd
+	BPF_MAP_GET_FD_BY_ID                = 0xe
+	BPF_OBJ_GET_INFO_BY_FD              = 0xf
+	BPF_PROG_QUERY                      = 0x10
+	BPF_RAW_TRACEPOINT_OPEN             = 0x11
+	BPF_BTF_LOAD                        = 0x12
+	BPF_BTF_GET_FD_BY_ID                = 0x13
+	BPF_TASK_FD_QUERY                   = 0x14
+	BPF_MAP_LOOKUP_AND_DELETE_ELEM      = 0x15
+	BPF_MAP_TYPE_UNSPEC                 = 0x0
+	BPF_MAP_TYPE_HASH                   = 0x1
+	BPF_MAP_TYPE_ARRAY                  = 0x2
+	BPF_MAP_TYPE_PROG_ARRAY             = 0x3
+	BPF_MAP_TYPE_PERF_EVENT_ARRAY       = 0x4
+	BPF_MAP_TYPE_PERCPU_HASH            = 0x5
+	BPF_MAP_TYPE_PERCPU_ARRAY           = 0x6
+	BPF_MAP_TYPE_STACK_TRACE            = 0x7
+	BPF_MAP_TYPE_CGROUP_ARRAY           = 0x8
+	BPF_MAP_TYPE_LRU_HASH               = 0x9
+	BPF_MAP_TYPE_LRU_PERCPU_HASH        = 0xa
+	BPF_MAP_TYPE_LPM_TRIE               = 0xb
+	BPF_MAP_TYPE_ARRAY_OF_MAPS          = 0xc
+	BPF_MAP_TYPE_HASH_OF_MAPS           = 0xd
+	BPF_MAP_TYPE_DEVMAP                 = 0xe
+	BPF_MAP_TYPE_SOCKMAP                = 0xf
+	BPF_MAP_TYPE_CPUMAP                 = 0x10
+	BPF_MAP_TYPE_XSKMAP                 = 0x11
+	BPF_MAP_TYPE_SOCKHASH               = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE         = 0x13
+	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY    = 0x14
+	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE  = 0x15
+	BPF_MAP_TYPE_QUEUE                  = 0x16
+	BPF_MAP_TYPE_STACK                  = 0x17
+	BPF_PROG_TYPE_UNSPEC                = 0x0
+	BPF_PROG_TYPE_SOCKET_FILTER         = 0x1
+	BPF_PROG_TYPE_KPROBE                = 0x2
+	BPF_PROG_TYPE_SCHED_CLS             = 0x3
+	BPF_PROG_TYPE_SCHED_ACT             = 0x4
+	BPF_PROG_TYPE_TRACEPOINT            = 0x5
+	BPF_PROG_TYPE_XDP                   = 0x6
+	BPF_PROG_TYPE_PERF_EVENT            = 0x7
+	BPF_PROG_TYPE_CGROUP_SKB            = 0x8
+	BPF_PROG_TYPE_CGROUP_SOCK           = 0x9
+	BPF_PROG_TYPE_LWT_IN                = 0xa
+	BPF_PROG_TYPE_LWT_OUT               = 0xb
+	BPF_PROG_TYPE_LWT_XMIT              = 0xc
+	BPF_PROG_TYPE_SOCK_OPS              = 0xd
+	BPF_PROG_TYPE_SK_SKB                = 0xe
+	BPF_PROG_TYPE_CGROUP_DEVICE         = 0xf
+	BPF_PROG_TYPE_SK_MSG                = 0x10
+	BPF_PROG_TYPE_RAW_TRACEPOINT        = 0x11
+	BPF_PROG_TYPE_CGROUP_SOCK_ADDR      = 0x12
+	BPF_PROG_TYPE_LWT_SEG6LOCAL         = 0x13
+	BPF_PROG_TYPE_LIRC_MODE2            = 0x14
+	BPF_PROG_TYPE_SK_REUSEPORT          = 0x15
+	BPF_PROG_TYPE_FLOW_DISSECTOR        = 0x16
+	BPF_CGROUP_INET_INGRESS             = 0x0
+	BPF_CGROUP_INET_EGRESS              = 0x1
+	BPF_CGROUP_INET_SOCK_CREATE         = 0x2
+	BPF_CGROUP_SOCK_OPS                 = 0x3
+	BPF_SK_SKB_STREAM_PARSER            = 0x4
+	BPF_SK_SKB_STREAM_VERDICT           = 0x5
+	BPF_CGROUP_DEVICE                   = 0x6
+	BPF_SK_MSG_VERDICT                  = 0x7
+	BPF_CGROUP_INET4_BIND               = 0x8
+	BPF_CGROUP_INET6_BIND               = 0x9
+	BPF_CGROUP_INET4_CONNECT            = 0xa
+	BPF_CGROUP_INET6_CONNECT            = 0xb
+	BPF_CGROUP_INET4_POST_BIND          = 0xc
+	BPF_CGROUP_INET6_POST_BIND          = 0xd
+	BPF_CGROUP_UDP4_SENDMSG             = 0xe
+	BPF_CGROUP_UDP6_SENDMSG             = 0xf
+	BPF_LIRC_MODE2                      = 0x10
+	BPF_FLOW_DISSECTOR                  = 0x11
+	BPF_STACK_BUILD_ID_EMPTY            = 0x0
+	BPF_STACK_BUILD_ID_VALID            = 0x1
+	BPF_STACK_BUILD_ID_IP               = 0x2
+	BPF_ADJ_ROOM_NET                    = 0x0
+	BPF_HDR_START_MAC                   = 0x0
+	BPF_HDR_START_NET                   = 0x1
+	BPF_LWT_ENCAP_SEG6                  = 0x0
+	BPF_LWT_ENCAP_SEG6_INLINE           = 0x1
+	BPF_OK                              = 0x0
+	BPF_DROP                            = 0x2
+	BPF_REDIRECT                        = 0x7
+	BPF_SOCK_OPS_VOID                   = 0x0
+	BPF_SOCK_OPS_TIMEOUT_INIT           = 0x1
+	BPF_SOCK_OPS_RWND_INIT              = 0x2
+	BPF_SOCK_OPS_TCP_CONNECT_CB         = 0x3
+	BPF_SOCK_OPS_ACTIVE_ESTABLISHED_CB  = 0x4
+	BPF_SOCK_OPS_PASSIVE_ESTABLISHED_CB = 0x5
+	BPF_SOCK_OPS_NEEDS_ECN              = 0x6
+	BPF_SOCK_OPS_BASE_RTT               = 0x7
+	BPF_SOCK_OPS_RTO_CB                 = 0x8
+	BPF_SOCK_OPS_RETRANS_CB             = 0x9
+	BPF_SOCK_OPS_STATE_CB               = 0xa
+	BPF_SOCK_OPS_TCP_LISTEN_CB          = 0xb
+	BPF_TCP_ESTABLISHED                 = 0x1
+	BPF_TCP_SYN_SENT                    = 0x2
+	BPF_TCP_SYN_RECV                    = 0x3
+	BPF_TCP_FIN_WAIT1                   = 0x4
+	BPF_TCP_FIN_WAIT2                   = 0x5
+	BPF_TCP_TIME_WAIT                   = 0x6
+	BPF_TCP_CLOSE                       = 0x7
+	BPF_TCP_CLOSE_WAIT                  = 0x8
+	BPF_TCP_LAST_ACK                    = 0x9
+	BPF_TCP_LISTEN                      = 0xa
+	BPF_TCP_CLOSING                     = 0xb
+	BPF_TCP_NEW_SYN_RECV                = 0xc
+	BPF_TCP_MAX_STATES                  = 0xd
+	BPF_FIB_LKUP_RET_SUCCESS            = 0x0
+	BPF_FIB_LKUP_RET_BLACKHOLE          = 0x1
+	BPF_FIB_LKUP_RET_UNREACHABLE        = 0x2
+	BPF_FIB_LKUP_RET_PROHIBIT           = 0x3
+	BPF_FIB_LKUP_RET_NOT_FWDED          = 0x4
+	BPF_FIB_LKUP_RET_FWD_DISABLED       = 0x5
+	BPF_FIB_LKUP_RET_UNSUPP_LWT         = 0x6
+	BPF_FIB_LKUP_RET_NO_NEIGH           = 0x7
+	BPF_FIB_LKUP_RET_FRAG_NEEDED        = 0x8
+	BPF_FD_TYPE_RAW_TRACEPOINT          = 0x0
+	BPF_FD_TYPE_TRACEPOINT              = 0x1
+	BPF_FD_TYPE_KPROBE                  = 0x2
+	BPF_FD_TYPE_KRETPROBE               = 0x3
+	BPF_FD_TYPE_UPROBE                  = 0x4
+	BPF_FD_TYPE_URETPROBE               = 0x5
+)
+
+type CapUserHeader struct {
+	Version uint32
+	Pid     int32
+}
+
+type CapUserData struct {
+	Effective   uint32
+	Permitted   uint32
+	Inheritable uint32
+}
+
+const (
+	LINUX_CAPABILITY_VERSION_1 = 0x19980330
+	LINUX_CAPABILITY_VERSION_2 = 0x20071026
+	LINUX_CAPABILITY_VERSION_3 = 0x20080522
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go
index 2dae0c1..86736ab 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go
@@ -57,23 +57,23 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           uint64
-	Mode          uint32
-	Ino           uint64
-	Nlink         uint32
-	Uid           uint32
-	Gid           uint32
-	Rdev          uint64
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       uint32
-	Flags         uint32
-	Gen           uint32
-	Spare         [2]uint32
+	Dev     uint64
+	Mode    uint32
+	Ino     uint64
+	Nlink   uint32
+	Uid     uint32
+	Gid     uint32
+	Rdev    uint64
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize uint32
+	Flags   uint32
+	Gen     uint32
+	Spare   [2]uint32
 }
 
 type Statfs_t [0]byte
@@ -411,6 +411,7 @@ type Ptmget struct {
 
 const (
 	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x400
 	AT_SYMLINK_NOFOLLOW = 0x200
 )
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go
index 1f0e76c..3427811 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go
@@ -58,26 +58,26 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           uint64
-	Mode          uint32
-	Pad_cgo_0     [4]byte
-	Ino           uint64
-	Nlink         uint32
-	Uid           uint32
-	Gid           uint32
-	Pad_cgo_1     [4]byte
-	Rdev          uint64
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       uint32
-	Flags         uint32
-	Gen           uint32
-	Spare         [2]uint32
-	Pad_cgo_2     [4]byte
+	Dev     uint64
+	Mode    uint32
+	_       [4]byte
+	Ino     uint64
+	Nlink   uint32
+	Uid     uint32
+	Gid     uint32
+	_       [4]byte
+	Rdev    uint64
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize uint32
+	Flags   uint32
+	Gen     uint32
+	Spare   [2]uint32
+	_       [4]byte
 }
 
 type Statfs_t [0]byte
@@ -418,6 +418,7 @@ type Ptmget struct {
 
 const (
 	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x400
 	AT_SYMLINK_NOFOLLOW = 0x200
 )
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go
index 53f2159..399f37a 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go
@@ -59,26 +59,26 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           uint64
-	Mode          uint32
-	Pad_cgo_0     [4]byte
-	Ino           uint64
-	Nlink         uint32
-	Uid           uint32
-	Gid           uint32
-	Pad_cgo_1     [4]byte
-	Rdev          uint64
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       uint32
-	Flags         uint32
-	Gen           uint32
-	Spare         [2]uint32
-	Pad_cgo_2     [4]byte
+	Dev     uint64
+	Mode    uint32
+	_       [4]byte
+	Ino     uint64
+	Nlink   uint32
+	Uid     uint32
+	Gid     uint32
+	_       [4]byte
+	Rdev    uint64
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize uint32
+	Flags   uint32
+	Gen     uint32
+	Spare   [2]uint32
+	_       [4]byte
 }
 
 type Statfs_t [0]byte
@@ -416,6 +416,7 @@ type Ptmget struct {
 
 const (
 	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x400
 	AT_SYMLINK_NOFOLLOW = 0x200
 )
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go
index 43da2c4..32f0c15 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go
@@ -58,26 +58,26 @@ type Rlimit struct {
 type _Gid_t uint32
 
 type Stat_t struct {
-	Dev           uint64
-	Mode          uint32
-	Pad_cgo_0     [4]byte
-	Ino           uint64
-	Nlink         uint32
-	Uid           uint32
-	Gid           uint32
-	Pad_cgo_1     [4]byte
-	Rdev          uint64
-	Atimespec     Timespec
-	Mtimespec     Timespec
-	Ctimespec     Timespec
-	Birthtimespec Timespec
-	Size          int64
-	Blocks        int64
-	Blksize       uint32
-	Flags         uint32
-	Gen           uint32
-	Spare         [2]uint32
-	Pad_cgo_2     [4]byte
+	Dev     uint64
+	Mode    uint32
+	_       [4]byte
+	Ino     uint64
+	Nlink   uint32
+	Uid     uint32
+	Gid     uint32
+	_       [4]byte
+	Rdev    uint64
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Btim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize uint32
+	Flags   uint32
+	Gen     uint32
+	Spare   [2]uint32
+	_       [4]byte
 }
 
 type Statfs_t [0]byte
@@ -418,6 +418,7 @@ type Ptmget struct {
 
 const (
 	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x400
 	AT_SYMLINK_NOFOLLOW = 0x200
 )
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go
index 900fb44..61ea001 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go
@@ -436,6 +436,7 @@ type Winsize struct {
 
 const (
 	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x4
 	AT_SYMLINK_NOFOLLOW = 0x2
 )
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go
index 028fa78..87a493f 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go
@@ -436,6 +436,7 @@ type Winsize struct {
 
 const (
 	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x4
 	AT_SYMLINK_NOFOLLOW = 0x2
 )
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go
index b45d5ee..d80836e 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go
@@ -437,6 +437,7 @@ type Winsize struct {
 
 const (
 	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x4
 	AT_SYMLINK_NOFOLLOW = 0x2
 )
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go
new file mode 100644
index 0000000..4e15874
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go
@@ -0,0 +1,565 @@
+// cgo -godefs -- -fsigned-char types_openbsd.go | go run mkpost.go
+// Code generated by the command above; see README.md. DO NOT EDIT.
+
+// +build arm64,openbsd
+
+package unix
+
+const (
+	SizeofPtr      = 0x8
+	SizeofShort    = 0x2
+	SizeofInt      = 0x4
+	SizeofLong     = 0x8
+	SizeofLongLong = 0x8
+)
+
+type (
+	_C_short     int16
+	_C_int       int32
+	_C_long      int64
+	_C_long_long int64
+)
+
+type Timespec struct {
+	Sec  int64
+	Nsec int64
+}
+
+type Timeval struct {
+	Sec  int64
+	Usec int64
+}
+
+type Rusage struct {
+	Utime    Timeval
+	Stime    Timeval
+	Maxrss   int64
+	Ixrss    int64
+	Idrss    int64
+	Isrss    int64
+	Minflt   int64
+	Majflt   int64
+	Nswap    int64
+	Inblock  int64
+	Oublock  int64
+	Msgsnd   int64
+	Msgrcv   int64
+	Nsignals int64
+	Nvcsw    int64
+	Nivcsw   int64
+}
+
+type Rlimit struct {
+	Cur uint64
+	Max uint64
+}
+
+type _Gid_t uint32
+
+type Stat_t struct {
+	Mode    uint32
+	Dev     int32
+	Ino     uint64
+	Nlink   uint32
+	Uid     uint32
+	Gid     uint32
+	Rdev    int32
+	Atim    Timespec
+	Mtim    Timespec
+	Ctim    Timespec
+	Size    int64
+	Blocks  int64
+	Blksize int32
+	Flags   uint32
+	Gen     uint32
+	_       Timespec
+}
+
+type Statfs_t struct {
+	F_flags       uint32
+	F_bsize       uint32
+	F_iosize      uint32
+	F_blocks      uint64
+	F_bfree       uint64
+	F_bavail      int64
+	F_files       uint64
+	F_ffree       uint64
+	F_favail      int64
+	F_syncwrites  uint64
+	F_syncreads   uint64
+	F_asyncwrites uint64
+	F_asyncreads  uint64
+	F_fsid        Fsid
+	F_namemax     uint32
+	F_owner       uint32
+	F_ctime       uint64
+	F_fstypename  [16]int8
+	F_mntonname   [90]int8
+	F_mntfromname [90]int8
+	F_mntfromspec [90]int8
+	_             [2]byte
+	Mount_info    [160]byte
+}
+
+type Flock_t struct {
+	Start  int64
+	Len    int64
+	Pid    int32
+	Type   int16
+	Whence int16
+}
+
+type Dirent struct {
+	Fileno uint64
+	Off    int64
+	Reclen uint16
+	Type   uint8
+	Namlen uint8
+	_      [4]uint8
+	Name   [256]int8
+}
+
+type Fsid struct {
+	Val [2]int32
+}
+
+const (
+	PathMax = 0x400
+)
+
+type RawSockaddrInet4 struct {
+	Len    uint8
+	Family uint8
+	Port   uint16
+	Addr   [4]byte /* in_addr */
+	Zero   [8]int8
+}
+
+type RawSockaddrInet6 struct {
+	Len      uint8
+	Family   uint8
+	Port     uint16
+	Flowinfo uint32
+	Addr     [16]byte /* in6_addr */
+	Scope_id uint32
+}
+
+type RawSockaddrUnix struct {
+	Len    uint8
+	Family uint8
+	Path   [104]int8
+}
+
+type RawSockaddrDatalink struct {
+	Len    uint8
+	Family uint8
+	Index  uint16
+	Type   uint8
+	Nlen   uint8
+	Alen   uint8
+	Slen   uint8
+	Data   [24]int8
+}
+
+type RawSockaddr struct {
+	Len    uint8
+	Family uint8
+	Data   [14]int8
+}
+
+type RawSockaddrAny struct {
+	Addr RawSockaddr
+	Pad  [92]int8
+}
+
+type _Socklen uint32
+
+type Linger struct {
+	Onoff  int32
+	Linger int32
+}
+
+type Iovec struct {
+	Base *byte
+	Len  uint64
+}
+
+type IPMreq struct {
+	Multiaddr [4]byte /* in_addr */
+	Interface [4]byte /* in_addr */
+}
+
+type IPv6Mreq struct {
+	Multiaddr [16]byte /* in6_addr */
+	Interface uint32
+}
+
+type Msghdr struct {
+	Name       *byte
+	Namelen    uint32
+	Iov        *Iovec
+	Iovlen     uint32
+	Control    *byte
+	Controllen uint32
+	Flags      int32
+}
+
+type Cmsghdr struct {
+	Len   uint32
+	Level int32
+	Type  int32
+}
+
+type Inet6Pktinfo struct {
+	Addr    [16]byte /* in6_addr */
+	Ifindex uint32
+}
+
+type IPv6MTUInfo struct {
+	Addr RawSockaddrInet6
+	Mtu  uint32
+}
+
+type ICMPv6Filter struct {
+	Filt [8]uint32
+}
+
+const (
+	SizeofSockaddrInet4    = 0x10
+	SizeofSockaddrInet6    = 0x1c
+	SizeofSockaddrAny      = 0x6c
+	SizeofSockaddrUnix     = 0x6a
+	SizeofSockaddrDatalink = 0x20
+	SizeofLinger           = 0x8
+	SizeofIPMreq           = 0x8
+	SizeofIPv6Mreq         = 0x14
+	SizeofMsghdr           = 0x30
+	SizeofCmsghdr          = 0xc
+	SizeofInet6Pktinfo     = 0x14
+	SizeofIPv6MTUInfo      = 0x20
+	SizeofICMPv6Filter     = 0x20
+)
+
+const (
+	PTRACE_TRACEME = 0x0
+	PTRACE_CONT    = 0x7
+	PTRACE_KILL    = 0x8
+)
+
+type Kevent_t struct {
+	Ident  uint64
+	Filter int16
+	Flags  uint16
+	Fflags uint32
+	Data   int64
+	Udata  *byte
+}
+
+type FdSet struct {
+	Bits [32]uint32
+}
+
+const (
+	SizeofIfMsghdr         = 0xa8
+	SizeofIfData           = 0x90
+	SizeofIfaMsghdr        = 0x18
+	SizeofIfAnnounceMsghdr = 0x1a
+	SizeofRtMsghdr         = 0x60
+	SizeofRtMetrics        = 0x38
+)
+
+type IfMsghdr struct {
+	Msglen  uint16
+	Version uint8
+	Type    uint8
+	Hdrlen  uint16
+	Index   uint16
+	Tableid uint16
+	Pad1    uint8
+	Pad2    uint8
+	Addrs   int32
+	Flags   int32
+	Xflags  int32
+	Data    IfData
+}
+
+type IfData struct {
+	Type         uint8
+	Addrlen      uint8
+	Hdrlen       uint8
+	Link_state   uint8
+	Mtu          uint32
+	Metric       uint32
+	Rdomain      uint32
+	Baudrate     uint64
+	Ipackets     uint64
+	Ierrors      uint64
+	Opackets     uint64
+	Oerrors      uint64
+	Collisions   uint64
+	Ibytes       uint64
+	Obytes       uint64
+	Imcasts      uint64
+	Omcasts      uint64
+	Iqdrops      uint64
+	Oqdrops      uint64
+	Noproto      uint64
+	Capabilities uint32
+	Lastchange   Timeval
+}
+
+type IfaMsghdr struct {
+	Msglen  uint16
+	Version uint8
+	Type    uint8
+	Hdrlen  uint16
+	Index   uint16
+	Tableid uint16
+	Pad1    uint8
+	Pad2    uint8
+	Addrs   int32
+	Flags   int32
+	Metric  int32
+}
+
+type IfAnnounceMsghdr struct {
+	Msglen  uint16
+	Version uint8
+	Type    uint8
+	Hdrlen  uint16
+	Index   uint16
+	What    uint16
+	Name    [16]int8
+}
+
+type RtMsghdr struct {
+	Msglen   uint16
+	Version  uint8
+	Type     uint8
+	Hdrlen   uint16
+	Index    uint16
+	Tableid  uint16
+	Priority uint8
+	Mpls     uint8
+	Addrs    int32
+	Flags    int32
+	Fmask    int32
+	Pid      int32
+	Seq      int32
+	Errno    int32
+	Inits    uint32
+	Rmx      RtMetrics
+}
+
+type RtMetrics struct {
+	Pksent   uint64
+	Expire   int64
+	Locks    uint32
+	Mtu      uint32
+	Refcnt   uint32
+	Hopcount uint32
+	Recvpipe uint32
+	Sendpipe uint32
+	Ssthresh uint32
+	Rtt      uint32
+	Rttvar   uint32
+	Pad      uint32
+}
+
+type Mclpool struct{}
+
+const (
+	SizeofBpfVersion = 0x4
+	SizeofBpfStat    = 0x8
+	SizeofBpfProgram = 0x10
+	SizeofBpfInsn    = 0x8
+	SizeofBpfHdr     = 0x14
+)
+
+type BpfVersion struct {
+	Major uint16
+	Minor uint16
+}
+
+type BpfStat struct {
+	Recv uint32
+	Drop uint32
+}
+
+type BpfProgram struct {
+	Len   uint32
+	Insns *BpfInsn
+}
+
+type BpfInsn struct {
+	Code uint16
+	Jt   uint8
+	Jf   uint8
+	K    uint32
+}
+
+type BpfHdr struct {
+	Tstamp  BpfTimeval
+	Caplen  uint32
+	Datalen uint32
+	Hdrlen  uint16
+	_       [2]byte
+}
+
+type BpfTimeval struct {
+	Sec  uint32
+	Usec uint32
+}
+
+type Termios struct {
+	Iflag  uint32
+	Oflag  uint32
+	Cflag  uint32
+	Lflag  uint32
+	Cc     [20]uint8
+	Ispeed int32
+	Ospeed int32
+}
+
+type Winsize struct {
+	Row    uint16
+	Col    uint16
+	Xpixel uint16
+	Ypixel uint16
+}
+
+const (
+	AT_FDCWD            = -0x64
+	AT_SYMLINK_FOLLOW   = 0x4
+	AT_SYMLINK_NOFOLLOW = 0x2
+)
+
+type PollFd struct {
+	Fd      int32
+	Events  int16
+	Revents int16
+}
+
+const (
+	POLLERR    = 0x8
+	POLLHUP    = 0x10
+	POLLIN     = 0x1
+	POLLNVAL   = 0x20
+	POLLOUT    = 0x4
+	POLLPRI    = 0x2
+	POLLRDBAND = 0x80
+	POLLRDNORM = 0x40
+	POLLWRBAND = 0x100
+	POLLWRNORM = 0x4
+)
+
+type Sigset_t uint32
+
+type Utsname struct {
+	Sysname  [256]byte
+	Nodename [256]byte
+	Release  [256]byte
+	Version  [256]byte
+	Machine  [256]byte
+}
+
+const SizeofUvmexp = 0x158
+
+type Uvmexp struct {
+	Pagesize           int32
+	Pagemask           int32
+	Pageshift          int32
+	Npages             int32
+	Free               int32
+	Active             int32
+	Inactive           int32
+	Paging             int32
+	Wired              int32
+	Zeropages          int32
+	Reserve_pagedaemon int32
+	Reserve_kernel     int32
+	Unused01           int32
+	Vnodepages         int32
+	Vtextpages         int32
+	Freemin            int32
+	Freetarg           int32
+	Inactarg           int32
+	Wiredmax           int32
+	Anonmin            int32
+	Vtextmin           int32
+	Vnodemin           int32
+	Anonminpct         int32
+	Vtextminpct        int32
+	Vnodeminpct        int32
+	Nswapdev           int32
+	Swpages            int32
+	Swpginuse          int32
+	Swpgonly           int32
+	Nswget             int32
+	Nanon              int32
+	Unused05           int32
+	Unused06           int32
+	Faults             int32
+	Traps              int32
+	Intrs              int32
+	Swtch              int32
+	Softs              int32
+	Syscalls           int32
+	Pageins            int32
+	Unused07           int32
+	Unused08           int32
+	Pgswapin           int32
+	Pgswapout          int32
+	Forks              int32
+	Forks_ppwait       int32
+	Forks_sharevm      int32
+	Pga_zerohit        int32
+	Pga_zeromiss       int32
+	Unused09           int32
+	Fltnoram           int32
+	Fltnoanon          int32
+	Fltnoamap          int32
+	Fltpgwait          int32
+	Fltpgrele          int32
+	Fltrelck           int32
+	Fltrelckok         int32
+	Fltanget           int32
+	Fltanretry         int32
+	Fltamcopy          int32
+	Fltnamap           int32
+	Fltnomap           int32
+	Fltlget            int32
+	Fltget             int32
+	Flt_anon           int32
+	Flt_acow           int32
+	Flt_obj            int32
+	Flt_prcopy         int32
+	Flt_przero         int32
+	Pdwoke             int32
+	Pdrevs             int32
+	Pdswout            int32
+	Pdfreed            int32
+	Pdscans            int32
+	Pdanscan           int32
+	Pdobscan           int32
+	Pdreact            int32
+	Pdbusy             int32
+	Pdpageouts         int32
+	Pdpending          int32
+	Pddeact            int32
+	Unused11           int32
+	Unused12           int32
+	Unused13           int32
+	Fpswtch            int32
+	Kmapent            int32
+}
+
+const SizeofClockinfo = 0x14
+
+type Clockinfo struct {
+	Hz      int32
+	Tick    int32
+	Tickadj int32
+	Stathz  int32
+	Profhz  int32
+}
diff --git a/vendor/golang.org/x/text/feature/plural/gen.go b/vendor/golang.org/x/text/feature/plural/gen.go
index a0de986..42f2f86 100644
--- a/vendor/golang.org/x/text/feature/plural/gen.go
+++ b/vendor/golang.org/x/text/feature/plural/gen.go
@@ -7,7 +7,7 @@
 package main
 
 // This file generates data for the CLDR plural rules, as defined in
-//    http://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules
+//    https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules
 //
 // We assume a slightly simplified grammar:
 //
@@ -63,9 +63,9 @@ import (
 	"strconv"
 	"strings"
 
-	"golang.org/x/text/internal"
 	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/language"
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
 	"golang.org/x/text/unicode/cldr"
 )
 
@@ -198,7 +198,7 @@ func genPlurals(w *gen.CodeWriter, data *cldr.CLDR) {
 
 		rules := []pluralCheck{}
 		index := []byte{0}
-		langMap := map[int]byte{0: 0} // From compact language index to index
+		langMap := map[compact.ID]byte{0: 0}
 
 		for _, pRules := range plurals.PluralRules {
 			// Parse the rules.
@@ -251,7 +251,7 @@ func genPlurals(w *gen.CodeWriter, data *cldr.CLDR) {
 				if strings.TrimSpace(loc) == "" {
 					continue
 				}
-				lang, ok := language.CompactIndex(language.MustParse(loc))
+				lang, ok := compact.FromTag(language.MustParse(loc))
 				if !ok {
 					log.Printf("No compact index for locale %q", loc)
 				}
@@ -261,16 +261,28 @@ func genPlurals(w *gen.CodeWriter, data *cldr.CLDR) {
 		}
 		w.WriteVar(plurals.Type+"Rules", rules)
 		w.WriteVar(plurals.Type+"Index", index)
-		// Expand the values.
-		langToIndex := make([]byte, language.NumCompactTags)
+		// Expand the values: first by using the parent relationship.
+		langToIndex := make([]byte, compact.NumCompactTags)
 		for i := range langToIndex {
-			for p := i; ; p = int(internal.Parent[p]) {
+			for p := compact.ID(i); ; p = p.Parent() {
 				if x, ok := langMap[p]; ok {
 					langToIndex[i] = x
 					break
 				}
 			}
 		}
+		// Now expand by including entries with identical languages for which
+		// one isn't set.
+		for i, v := range langToIndex {
+			if v == 0 {
+				id, _ := compact.FromTag(language.Tag{
+					LangID: compact.ID(i).Tag().LangID,
+				})
+				if p := langToIndex[id]; p != 0 {
+					langToIndex[i] = p
+				}
+			}
+		}
 		w.WriteVar(plurals.Type+"LangToIndex", langToIndex)
 		// Need to convert array to slice because of golang.org/issue/7651.
 		// This will allow tables to be dropped when unused. This is especially
diff --git a/vendor/golang.org/x/text/feature/plural/plural.go b/vendor/golang.org/x/text/feature/plural/plural.go
index 61faf18..5b521b1 100644
--- a/vendor/golang.org/x/text/feature/plural/plural.go
+++ b/vendor/golang.org/x/text/feature/plural/plural.go
@@ -8,11 +8,12 @@
 //
 // The definitions in this package are based on the plural rule handling defined
 // in CLDR. See
-// http://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules for
+// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules for
 // details.
 package plural
 
 import (
+	"golang.org/x/text/internal/language/compact"
 	"golang.org/x/text/internal/number"
 	"golang.org/x/text/language"
 )
@@ -113,7 +114,7 @@ func getIntApprox(digits []byte, start, end, nMod, big int) (n int) {
 //      100000     []byte{1}           6      0
 //      100000.00  []byte{1}           6      3
 func (p *Rules) MatchDigits(t language.Tag, digits []byte, exp, scale int) Form {
-	index, _ := language.CompactIndex(t)
+	index := tagToID(t)
 
 	// Differentiate up to including mod 1000000 for the integer part.
 	n := getIntApprox(digits, 0, exp, 6, 1000000)
@@ -130,8 +131,7 @@ func (p *Rules) matchDisplayDigits(t language.Tag, d *number.Digits) (Form, int)
 }
 
 func validForms(p *Rules, t language.Tag) (forms []Form) {
-	index, _ := language.CompactIndex(t)
-	offset := p.langToIndex[index]
+	offset := p.langToIndex[tagToID(t)]
 	rules := p.rules[p.index[offset]:p.index[offset+1]]
 
 	forms = append(forms, Other)
@@ -146,13 +146,12 @@ func validForms(p *Rules, t language.Tag) (forms []Form) {
 }
 
 func (p *Rules) matchComponents(t language.Tag, n, f, scale int) Form {
-	index, _ := language.CompactIndex(t)
-	return matchPlural(p, index, n, f, scale)
+	return matchPlural(p, tagToID(t), n, f, scale)
 }
 
 // MatchPlural returns the plural form for the given language and plural
 // operands (as defined in
-// http://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules):
+// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules):
 //  where
 //  	n  absolute value of the source number (integer and decimals)
 //  input
@@ -165,11 +164,10 @@ func (p *Rules) matchComponents(t language.Tag, n, f, scale int) Form {
 // If any of the operand values is too large to fit in an int, it is okay to
 // pass the value modulo 10,000,000.
 func (p *Rules) MatchPlural(lang language.Tag, i, v, w, f, t int) Form {
-	index, _ := language.CompactIndex(lang)
-	return matchPlural(p, index, i, f, v)
+	return matchPlural(p, tagToID(lang), i, f, v)
 }
 
-func matchPlural(p *Rules, index int, n, f, v int) Form {
+func matchPlural(p *Rules, index compact.ID, n, f, v int) Form {
 	nMask := p.inclusionMasks[n%maxMod]
 	// Compute the fMask inline in the rules below, as it is relatively rare.
 	// fMask := p.inclusionMasks[f%maxMod]
@@ -256,3 +254,8 @@ func matchPlural(p *Rules, index int, n, f, v int) Form {
 	}
 	return Other
 }
+
+func tagToID(t language.Tag) compact.ID {
+	id, _ := compact.RegionalID(compact.Tag(t))
+	return id
+}
diff --git a/vendor/golang.org/x/text/feature/plural/tables.go b/vendor/golang.org/x/text/feature/plural/tables.go
index 64f9fe3..59ae9f2 100644
--- a/vendor/golang.org/x/text/feature/plural/tables.go
+++ b/vendor/golang.org/x/text/feature/plural/tables.go
@@ -78,27 +78,27 @@ var ordinalIndex = []uint8{ // 22 elements
 	0x28, 0x2f, 0x33, 0x37, 0x3b, 0x40,
 } // Size: 46 bytes
 
-var ordinalLangToIndex = []uint8{ // 768 elements
+var ordinalLangToIndex = []uint8{ // 775 elements
 	// Entry 0 - 3F
-	0x00, 0x0e, 0x0c, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x12, 0x12, 0x00, 0x00, 0x00, 0x00,
-	0x10, 0x00, 0x00, 0x10, 0x10, 0x00, 0x00, 0x05,
-	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 40 - 7F
-	0x00, 0x00, 0x12, 0x12, 0x12, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x0e, 0x0e, 0x0e, 0x0e, 0x0e, 0x00, 0x00,
+	0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x10, 0x10,
+	0x10, 0x10, 0x10, 0x00, 0x00, 0x05, 0x05, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x14, 0x14,
+	// Entry 40 - 7F
+	0x12, 0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e,
+	0x0e, 0x0e, 0x0e, 0x0e, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x14, 0x14, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 80 - BF
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c,
 	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
 	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
 	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
@@ -112,82 +112,84 @@ var ordinalLangToIndex = []uint8{ // 768 elements
 	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
 	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
 	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
-	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c,
-	0x0c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 100 - 13F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x02, 0x02, 0x00, 0x00, 0x00, 0x02, 0x02, 0x02,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02,
+	0x00, 0x00, 0x00, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	// Entry 140 - 17F
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x02, 0x02, 0x02, 0x00, 0x00, 0x00, 0x00,
-	0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x11, 0x11, 0x00, 0x00, 0x00, 0x00,
+	0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x11, 0x11, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x03, 0x03, 0x02, 0x02, 0x00, 0x00, 0x00, 0x00,
+	0x11, 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x11,
+	0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x03,
+	0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x09, 0x09, 0x09,
-	0x09, 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x0a, 0x0a, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x09, 0x09, 0x09, 0x09,
+	0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x0a, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 1C0 - 1FF
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x0f, 0x0f, 0x00, 0x00, 0x00, 0x00,
-	0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x0f, 0x0f, 0x00, 0x00,
+	0x00, 0x00, 0x02, 0x0d, 0x0d, 0x02, 0x02, 0x02,
+	0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 200 - 23F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x13, 0x13,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x13, 0x13, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 240 - 27F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x02, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02,
+	0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0b,
-	0x0b, 0x0b, 0x0b, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x01, 0x01, 0x01, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x0b, 0x0b, 0x0b, 0x0b, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x01,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x07, 0x07, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x07, 0x07, 0x02, 0x00, 0x00, 0x00, 0x00,
 	// Entry 2C0 - 2FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-} // Size: 792 bytes
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x0c,
+} // Size: 799 bytes
 
 var ordinalInclusionMasks = []uint64{ // 100 elements
 	// Entry 0 - 1F
@@ -400,27 +402,27 @@ var cardinalIndex = []uint8{ // 36 elements
 	0x95, 0x9c, 0xa1, 0xa6,
 } // Size: 60 bytes
 
-var cardinalLangToIndex = []uint8{ // 768 elements
+var cardinalLangToIndex = []uint8{ // 775 elements
 	// Entry 0 - 3F
-	0x00, 0x04, 0x04, 0x08, 0x08, 0x08, 0x00, 0x00,
-	0x06, 0x06, 0x01, 0x01, 0x21, 0x21, 0x21, 0x21,
+	0x00, 0x08, 0x08, 0x08, 0x00, 0x00, 0x06, 0x06,
+	0x01, 0x01, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
 	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
 	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
 	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x01, 0x01, 0x08, 0x08, 0x04, 0x04,
-	0x08, 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x1a,
-	0x1a, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x06,
+	0x01, 0x01, 0x08, 0x08, 0x04, 0x04, 0x08, 0x08,
+	0x08, 0x08, 0x08, 0x00, 0x00, 0x1a, 0x1a, 0x08,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x00, 0x00,
 	// Entry 40 - 7F
-	0x00, 0x00, 0x01, 0x01, 0x01, 0x00, 0x00, 0x00,
-	0x1e, 0x1e, 0x08, 0x08, 0x13, 0x00, 0x00, 0x13,
-	0x13, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00, 0x00,
-	0x00, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
-	0x08, 0x08, 0x18, 0x18, 0x00, 0x00, 0x22, 0x22,
-	0x09, 0x09, 0x09, 0x00, 0x00, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x00, 0x00, 0x16,
-	0x16, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x01, 0x01, 0x00, 0x00, 0x00, 0x1e, 0x1e,
+	0x08, 0x08, 0x13, 0x13, 0x13, 0x13, 0x13, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x08,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+	0x18, 0x18, 0x00, 0x00, 0x22, 0x22, 0x09, 0x09,
+	0x09, 0x00, 0x00, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x00, 0x00, 0x16, 0x16, 0x00,
+	0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 80 - BF
-	0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
@@ -434,82 +436,84 @@ var cardinalLangToIndex = []uint8{ // 768 elements
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08,
 	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
-	// Entry 100 - 13F
 	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
+	// Entry 100 - 13F
 	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
-	0x04, 0x04, 0x08, 0x08, 0x00, 0x00, 0x01, 0x01,
-	0x01, 0x02, 0x02, 0x02, 0x02, 0x02, 0x04, 0x04,
-	0x0c, 0x0c, 0x08, 0x08, 0x08, 0x02, 0x02, 0x02,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04,
+	0x08, 0x08, 0x00, 0x00, 0x01, 0x01, 0x01, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x04, 0x04, 0x0c, 0x0c,
+	0x08, 0x08, 0x08, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	// Entry 140 - 17F
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x02, 0x02, 0x02, 0x08, 0x08, 0x04, 0x04,
-	0x1f, 0x1f, 0x14, 0x14, 0x04, 0x04, 0x08, 0x08,
-	0x08, 0x08, 0x01, 0x01, 0x06, 0x00, 0x00, 0x20,
-	0x20, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x17,
-	0x17, 0x01, 0x01, 0x13, 0x13, 0x13, 0x16, 0x16,
-	0x08, 0x08, 0x02, 0x02, 0x00, 0x00, 0x00, 0x00,
+	0x02, 0x02, 0x08, 0x08, 0x04, 0x04, 0x1f, 0x1f,
+	0x14, 0x14, 0x04, 0x04, 0x08, 0x08, 0x08, 0x08,
+	0x01, 0x01, 0x06, 0x00, 0x00, 0x20, 0x20, 0x08,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x17, 0x17, 0x01,
+	0x01, 0x13, 0x13, 0x13, 0x16, 0x16, 0x08, 0x08,
+	0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 180 - 1BF
-	0x00, 0x00, 0x04, 0x0a, 0x0a, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x10, 0x00, 0x00, 0x00, 0x08, 0x08,
-	0x08, 0x08, 0x00, 0x08, 0x08, 0x02, 0x02, 0x08,
-	0x00, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x08,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08, 0x08,
-	0x00, 0x00, 0x0f, 0x0f, 0x08, 0x10, 0x10, 0x08,
+	0x00, 0x04, 0x0a, 0x0a, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x10, 0x17, 0x00, 0x00, 0x00, 0x08, 0x08,
+	0x04, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x02,
+	0x02, 0x08, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08,
+	0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x01,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08,
+	0x08, 0x08, 0x00, 0x00, 0x0f, 0x0f, 0x08, 0x10,
 	// Entry 1C0 - 1FF
-	0x08, 0x0e, 0x0e, 0x08, 0x08, 0x08, 0x08, 0x00,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1b, 0x1b, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x0d, 0x0d, 0x08, 0x08, 0x08,
-	0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00,
-	0x08, 0x08, 0x0b, 0x0b, 0x08, 0x08, 0x08, 0x08,
-	0x01, 0x01, 0x00, 0x00, 0x00, 0x00, 0x1c, 0x1c,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x10,
+	0x10, 0x08, 0x08, 0x0e, 0x0e, 0x08, 0x08, 0x08,
+	0x08, 0x00, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x1b, 0x1b, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0d, 0x0d, 0x08,
+	0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06,
+	0x00, 0x00, 0x08, 0x08, 0x0b, 0x0b, 0x08, 0x08,
+	0x08, 0x08, 0x12, 0x01, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x1c, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 200 - 23F
-	0x10, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00, 0x00,
-	0x00, 0x08, 0x08, 0x08, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x00, 0x00, 0x08, 0x08,
-	0x08, 0x08, 0x08, 0x00, 0x08, 0x06, 0x00, 0x00,
-	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
-	0x08, 0x08, 0x08, 0x06, 0x00, 0x00, 0x06, 0x06,
-	0x08, 0x19, 0x19, 0x0d, 0x0d, 0x08, 0x08, 0x03,
-	0x04, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x00, 0x08, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08,
+	0x08, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00,
+	0x00, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00, 0x08,
+	0x06, 0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x08,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x08, 0x19, 0x19, 0x0d, 0x0d,
+	0x08, 0x08, 0x03, 0x04, 0x03, 0x04, 0x04, 0x04,
 	// Entry 240 - 27F
-	0x04, 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00,
-	0x08, 0x08, 0x00, 0x00, 0x12, 0x12, 0x12, 0x08,
-	0x08, 0x1d, 0x1d, 0x1d, 0x1d, 0x1d, 0x1d, 0x1d,
-	0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08,
-	0x00, 0x00, 0x08, 0x08, 0x08, 0x10, 0x10, 0x10,
-	0x10, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x11,
-	0x00, 0x00, 0x11, 0x11, 0x05, 0x05, 0x18, 0x18,
-	0x15, 0x15, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00,
+	0x00, 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x12,
+	0x12, 0x12, 0x08, 0x08, 0x1d, 0x1d, 0x1d, 0x1d,
+	0x1d, 0x1d, 0x1d, 0x00, 0x00, 0x08, 0x08, 0x00,
+	0x00, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x08,
+	0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x00, 0x00,
+	0x00, 0x00, 0x13, 0x11, 0x11, 0x11, 0x11, 0x11,
+	0x05, 0x05, 0x18, 0x18, 0x15, 0x15, 0x10, 0x10,
 	// Entry 280 - 2BF
+	0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x13,
+	0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13,
+	0x13, 0x13, 0x08, 0x08, 0x08, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08, 0x08,
 	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
-	0x08, 0x08, 0x08, 0x13, 0x13, 0x13, 0x13, 0x13,
-	0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x08, 0x08,
-	0x08, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08,
-	0x08, 0x08, 0x08, 0x08, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0x06, 0x06, 0x06, 0x08, 0x08, 0x08, 0x08,
-	0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x06,
+	0x08, 0x08, 0x08, 0x0c, 0x08, 0x00, 0x00, 0x08,
 	// Entry 2C0 - 2FF
-	0x00, 0x00, 0x07, 0x07, 0x08, 0x08, 0x1d, 0x1d,
-	0x04, 0x04, 0x04, 0x08, 0x00, 0x00, 0x00, 0x00,
-	0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08,
-	0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x06, 0x08,
-	0x08, 0x00, 0x00, 0x08, 0x08, 0x08, 0x00, 0x00,
-	0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01,
-} // Size: 792 bytes
+	0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x07,
+	0x07, 0x08, 0x08, 0x1d, 0x1d, 0x04, 0x04, 0x04,
+	0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x08,
+	0x08, 0x08, 0x08, 0x06, 0x08, 0x08, 0x00, 0x00,
+	0x08, 0x08, 0x08, 0x00, 0x00, 0x04, 0x04, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x01, 0x01, 0x04, 0x04,
+} // Size: 799 bytes
 
 var cardinalInclusionMasks = []uint64{ // 100 elements
 	// Entry 0 - 1F
@@ -545,4 +549,4 @@ var cardinalInclusionMasks = []uint64{ // 100 elements
 
 // Slots used for cardinal: A6 of 0xFF rules; 24 of 0xFF indexes; 37 of 64 sets
 
-// Total table size 3846 bytes (3KiB); checksum: B8556665
+// Total table size 3860 bytes (3KiB); checksum: 4E56F7B1
diff --git a/vendor/golang.org/x/text/internal/catmsg/catmsg.go b/vendor/golang.org/x/text/internal/catmsg/catmsg.go
index 32d6c20..c0bf86f 100644
--- a/vendor/golang.org/x/text/internal/catmsg/catmsg.go
+++ b/vendor/golang.org/x/text/internal/catmsg/catmsg.go
@@ -104,20 +104,24 @@ const (
 	msgFirst
 	msgRaw
 	msgString
-	numFixed
+	msgAffix
+	// Leave some arbitrary room for future expansion: 20 should suffice.
+	numInternal = 20
 )
 
 const prefix = "golang.org/x/text/internal/catmsg."
 
 var (
+	// TODO: find a more stable way to link handles to message types.
 	mutex sync.Mutex
 	names = map[string]Handle{
 		prefix + "Vars":   msgVars,
 		prefix + "First":  msgFirst,
 		prefix + "Raw":    msgRaw,
 		prefix + "String": msgString,
+		prefix + "Affix":  msgAffix,
 	}
-	handlers = make([]Handler, numFixed)
+	handlers = make([]Handler, numInternal)
 )
 
 func init() {
@@ -161,6 +165,20 @@ func init() {
 		}
 		return true
 	}
+
+	handlers[msgAffix] = func(d *Decoder) bool {
+		// TODO: use an alternative method for common cases.
+		prefix := d.DecodeString()
+		suffix := d.DecodeString()
+		if prefix != "" {
+			d.Render(prefix)
+		}
+		ret := d.ExecuteMessage()
+		if suffix != "" {
+			d.Render(suffix)
+		}
+		return ret
+	}
 }
 
 var (
@@ -374,3 +392,24 @@ func (s String) Compile(e *Encoder) (err error) {
 	}
 	return err
 }
+
+// Affix is a message that adds a prefix and suffix to another message.
+// This is mostly used add back whitespace to a translation that was stripped
+// before sending it out.
+type Affix struct {
+	Message Message
+	Prefix  string
+	Suffix  string
+}
+
+// Compile implements Message.
+func (a Affix) Compile(e *Encoder) (err error) {
+	// TODO: consider adding a special message type that just adds a single
+	// return. This is probably common enough to handle the majority of cases.
+	// Get some stats first, though.
+	e.EncodeMessageType(msgAffix)
+	e.EncodeString(a.Prefix)
+	e.EncodeString(a.Suffix)
+	e.EncodeMessage(a.Message)
+	return nil
+}
diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go
index f4f37f4..855aed7 100644
--- a/vendor/golang.org/x/text/internal/format/parser.go
+++ b/vendor/golang.org/x/text/internal/format/parser.go
@@ -244,6 +244,7 @@ simpleFormat:
 		p.Status = StatusBadArgNum
 	case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb.
 		p.Status = StatusMissingArg
+		p.ArgNum++
 	case verb == 'v':
 		// Go syntax
 		p.SharpV = p.Sharp
diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go
index eac8328..3cddbbd 100644
--- a/vendor/golang.org/x/text/internal/internal.go
+++ b/vendor/golang.org/x/text/internal/internal.go
@@ -2,8 +2,6 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:generate go run gen.go
-
 // Package internal contains non-exported functionality that are used by
 // packages in the text repository.
 package internal // import "golang.org/x/text/internal"
diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
similarity index 50%
rename from vendor/golang.org/x/text/language/common.go
rename to vendor/golang.org/x/text/internal/language/common.go
index 9d86e18..cdfdb74 100644
--- a/vendor/golang.org/x/text/language/common.go
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -4,13 +4,13 @@ package language
 
 // This file contains code common to the maketables.go and the package code.
 
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
 
 const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
+	Deprecated AliasType = iota
+	Macro
+	Legacy
 
-	langAliasTypeUnknown langAliasType = -1
+	AliasTypeUnknown AliasType = -1
 )
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 0000000..46a0015
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+	if t.LangID > langNoIndexOffset {
+		return 0, false
+	}
+	cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+	cci |= CompactCoreInfo(t.ScriptID) << 12
+	cci |= CompactCoreInfo(t.RegionID)
+	return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+	return Tag{
+		LangID:   Language(c >> 20),
+		RegionID: Region(c & 0x3ff),
+		ScriptID: Script(c>>12) & 0xff,
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 0000000..1b36935
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+	cci, ok := language.GetCompactCore(t)
+	if !ok {
+		return 0, false
+	}
+	i := sort.Search(len(coreTags), func(i int) bool {
+		return cci <= coreTags[i]
+	})
+	if i == len(coreTags) || coreTags[i] != cci {
+		return 0, false
+	}
+	return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+	return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+	if int(id) >= len(coreTags) {
+		return specialTags[int(id)-len(coreTags)]
+	}
+	return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+	tags := strings.Split(specialTagsStr, " ")
+	specialTags = make([]language.Tag, len(tags))
+	for i, t := range tags {
+		specialTags[i] = language.MustParse(t)
+	}
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go
new file mode 100644
index 0000000..0c36a05
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen.go
@@ -0,0 +1,64 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+	"flag"
+	"fmt"
+	"log"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test",
+		false,
+		"test existing tables; can be used to compare web data with package data.")
+	outputFile = flag.String("output",
+		"tables.go",
+		"output file for generated tables")
+)
+
+func main() {
+	gen.Init()
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "compact")
+
+	fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`)
+
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
+
+	b.writeCompactIndex()
+}
+
+type builder struct {
+	w    *gen.CodeWriter
+	data *cldr.CLDR
+	supp *cldr.SupplementalData
+}
+
+func newBuilder(w *gen.CodeWriter) *builder {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	if err != nil {
+		log.Fatal(err)
+	}
+	b := builder{
+		w:    w,
+		data: data,
+		supp: data.Supplemental(),
+	}
+	return &b
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
new file mode 100644
index 0000000..136cefa
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
@@ -0,0 +1,113 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+package main
+
+// This file generates derivative tables based on the language package itself.
+
+import (
+	"fmt"
+	"log"
+	"sort"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// Compact indices:
+// Note -va-X variants only apply to localization variants.
+// BCP variants only ever apply to language.
+// The only ambiguity between tags is with regions.
+
+func (b *builder) writeCompactIndex() {
+	// Collect all language tags for which we have any data in CLDR.
+	m := map[language.Tag]bool{}
+	for _, lang := range b.data.Locales() {
+		// We include all locales unconditionally to be consistent with en_US.
+		// We want en_US, even though it has no data associated with it.
+
+		// TODO: put any of the languages for which no data exists at the end
+		// of the index. This allows all components based on ICU to use that
+		// as the cutoff point.
+		// if x := data.RawLDML(lang); false ||
+		// 	x.LocaleDisplayNames != nil ||
+		// 	x.Characters != nil ||
+		// 	x.Delimiters != nil ||
+		// 	x.Measurement != nil ||
+		// 	x.Dates != nil ||
+		// 	x.Numbers != nil ||
+		// 	x.Units != nil ||
+		// 	x.ListPatterns != nil ||
+		// 	x.Collations != nil ||
+		// 	x.Segmentations != nil ||
+		// 	x.Rbnf != nil ||
+		// 	x.Annotations != nil ||
+		// 	x.Metadata != nil {
+
+		// TODO: support POSIX natively, albeit non-standard.
+		tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
+		m[tag] = true
+		// }
+	}
+
+	// TODO: plural rules are also defined for the deprecated tags:
+	//    iw mo sh tl
+	// Consider removing these as compact tags.
+
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range b.supp.Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				m[language.Make(lang)] = true
+			}
+		}
+	}
+
+	var coreTags []language.CompactCoreInfo
+	var special []string
+
+	for t := range m {
+		if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
+			log.Fatalf("Unexpected extension %v in %v", x, t)
+		}
+		if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
+			cci, ok := language.GetCompactCore(t)
+			if !ok {
+				log.Fatalf("Locale for non-basic language %q", t)
+			}
+			coreTags = append(coreTags, cci)
+		} else {
+			special = append(special, t.String())
+		}
+	}
+
+	w := b.w
+
+	sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] })
+	sort.Strings(special)
+
+	w.WriteComment(`
+	NumCompactTags is the number of common tags. The maximum tag is
+	NumCompactTags-1.`)
+	w.WriteConst("NumCompactTags", len(m))
+
+	fmt.Fprintln(w, "const (")
+	for i, t := range coreTags {
+		fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i)
+	}
+	for i, t := range special {
+		fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags))
+	}
+	fmt.Fprintln(w, ")")
+
+	w.WriteVar("coreTags", coreTags)
+
+	w.WriteConst("specialTagsStr", strings.Join(special, " "))
+}
+
+func ident(s string) string {
+	return strings.Replace(s, "-", "", -1) + "Index"
+}
diff --git a/vendor/golang.org/x/text/internal/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
similarity index 57%
rename from vendor/golang.org/x/text/internal/gen.go
rename to vendor/golang.org/x/text/internal/language/compact/gen_parents.go
index 1d678af..9543d58 100644
--- a/vendor/golang.org/x/text/internal/gen.go
+++ b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
@@ -1,4 +1,4 @@
-// Copyright 2015 The Go Authors. All rights reserved.
+// Copyright 2018 The Go Authors. All rights reserved.
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
@@ -10,7 +10,8 @@ import (
 	"log"
 
 	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/language"
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
 	"golang.org/x/text/unicode/cldr"
 )
 
@@ -25,28 +26,29 @@ func main() {
 	}
 
 	w := gen.NewCodeWriter()
-	defer w.WriteGoFile("tables.go", "internal")
+	defer w.WriteGoFile("parents.go", "compact")
 
 	// Create parents table.
-	parents := make([]uint16, language.NumCompactTags)
+	type ID uint16
+	parents := make([]ID, compact.NumCompactTags)
 	for _, loc := range data.Locales() {
 		tag := language.MustParse(loc)
-		index, ok := language.CompactIndex(tag)
+		index, ok := compact.FromTag(tag)
 		if !ok {
 			continue
 		}
-		parentIndex := 0 // und
+		parentIndex := compact.ID(0) // und
 		for p := tag.Parent(); p != language.Und; p = p.Parent() {
-			if x, ok := language.CompactIndex(p); ok {
+			if x, ok := compact.FromTag(p); ok {
 				parentIndex = x
 				break
 			}
 		}
-		parents[index] = uint16(parentIndex)
+		parents[index] = ID(parentIndex)
 	}
 
 	w.WriteComment(`
-	Parent maps a compact index of a tag to the compact index of the parent of
+	parents maps a compact index of a tag to the compact index of the parent of
 	this tag.`)
-	w.WriteVar("Parent", parents)
+	w.WriteVar("parents", parents)
 }
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 0000000..83816a7
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+	// NOTE: exported tags will become part of the public API.
+	language ID
+	locale   ID
+	full     fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+	IsRoot() bool
+	Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+	if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+		if r, err := language.ParseRegion(region[:2]); err == nil {
+			tFull := t
+			t, _ = t.SetTypeForKey("rg", "")
+			// TODO: should we not consider "va" for the language tag?
+			var exact1, exact2 bool
+			tag.language, exact1 = FromTag(t)
+			t.RegionID = r
+			tag.locale, exact2 = FromTag(t)
+			if !exact1 || !exact2 {
+				tag.full = tFull
+			}
+			return tag
+		}
+	}
+	lang, ok := FromTag(t)
+	tag.language = lang
+	tag.locale = lang
+	if !ok {
+		tag.full = t
+	}
+	return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+	if t.full != nil {
+		return t.full.(language.Tag)
+	}
+	tag := t.language.Tag()
+	if t.language != t.locale {
+		loc := t.locale.Tag()
+		tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+	}
+	return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+	return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+	return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+	return t.full != nil ||
+		int(t.language) >= len(coreTags) ||
+		t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if t.full != nil {
+		return t.full.IsRoot()
+	}
+	return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.full != nil {
+		return Make(t.full.Parent())
+	}
+	if t.language != t.locale {
+		// Simulate stripping -u-rg-xxxxxx
+		return Tag{language: t.language, locale: t.language}
+	}
+	// TODO: use parent lookup table once cycle from internal package is
+	// removed. Probably by internalizing the table and declaring this fast
+	// enough.
+	// lang := compactID(internal.Parent(uint16(t.language)))
+	lang, _ := FromTag(t.language.Tag().Parent())
+	return Tag{language: lang, locale: lang}
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+	p := strings.Index(s[1:], "-")
+	if p == -1 {
+		return s[1:], ""
+	}
+	p++
+	return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+	return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+	return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+	if t.full == nil {
+		return Tag{language: t.language, locale: t.language}
+	}
+	tt := t.Tag()
+	tt.SetTypeForKey("rg", "")
+	tt.SetTypeForKey("va", "")
+	return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+	rt := Tag{language: t.locale, locale: t.locale}
+	if t.full == nil {
+		return rt
+	}
+	b := language.Builder{}
+	tag := t.Tag()
+	// tag, _ = tag.SetTypeForKey("rg", "")
+	b.SetTag(t.locale.Tag())
+	if v := tag.Variants(); v != "" {
+		for _, v := range strings.Split(v, "-") {
+			b.AddVariant(v)
+		}
+	}
+	for _, e := range tag.Extensions() {
+		b.AddExt(e)
+	}
+	return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+	// TODO: perhaps give more frequent tags a lower index.
+	// TODO: we could make the indexes stable. This will excluded some
+	//       possibilities for optimization, so don't do this quite yet.
+	exact = true
+
+	b, s, r := t.Raw()
+	if t.HasString() {
+		if t.IsPrivateUse() {
+			// We have no entries for user-defined tags.
+			return 0, false
+		}
+		hasExtra := false
+		if t.HasVariants() {
+			if t.HasExtensions() {
+				build := language.Builder{}
+				build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+				build.AddVariant(t.Variants())
+				exact = false
+				t = build.Make()
+			}
+			hasExtra = true
+		} else if _, ok := t.Extension('u'); ok {
+			// TODO: va may mean something else. Consider not considering it.
+			// Strip all but the 'va' entry.
+			old := t
+			variant := t.TypeForKey("va")
+			t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+			if variant != "" {
+				t, _ = t.SetTypeForKey("va", variant)
+				hasExtra = true
+			}
+			exact = old == t
+		} else {
+			exact = false
+		}
+		if hasExtra {
+			// We have some variants.
+			for i, s := range specialTags {
+				if s == t {
+					return ID(i + len(coreTags)), exact
+				}
+			}
+			exact = false
+		}
+	}
+	if x, ok := getCoreIndex(t); ok {
+		return x, exact
+	}
+	exact = false
+	if r != 0 && s == 0 {
+		// Deal with cases where an extra script is inserted for the region.
+		t, _ := t.Maximize()
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	for t = t.Parent(); t != root; t = t.Parent() {
+		// No variants specified: just compare core components.
+		// The key has the form lllssrrr, where l, s, and r are nibbles for
+		// respectively the langID, scriptID, and regionID.
+		if x, ok := getCoreIndex(t); ok {
+			return x, exact
+		}
+	}
+	return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 0000000..8d81072
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+	// Entry 0 - 3F
+	0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+	0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+	0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+	0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+	0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+	// Entry 40 - 7F
+	0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+	0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+	0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+	0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+	0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+	0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+	0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+	0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+	// Entry 80 - BF
+	0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+	// Entry C0 - FF
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+	0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+	0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+	// Entry 100 - 13F
+	0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+	0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+	0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+	0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	// Entry 140 - 17F
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+	0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+	0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+	0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+	0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+	0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+	0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+	// Entry 180 - 1BF
+	0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+	0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+	0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+	0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+	0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+	0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+	0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+	0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+	// Entry 1C0 - 1FF
+	0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+	0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+	0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+	0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+	0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+	0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+	0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+	0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+	// Entry 200 - 23F
+	0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+	0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+	0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+	0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+	0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+	0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+	0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+	// Entry 240 - 27F
+	0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+	0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+	0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+	0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+	0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+	0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+	0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+	0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+	// Entry 280 - 2BF
+	0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+	0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+	0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+	0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+	0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+	0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+	0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+	0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+	// Entry 2C0 - 2FF
+	0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+	0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+	0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+	0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+	0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+	0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+	0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+	0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+	// Entry 300 - 33F
+	0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 0000000..554ca35
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+	undIndex          ID = 0
+	afIndex           ID = 1
+	afNAIndex         ID = 2
+	afZAIndex         ID = 3
+	agqIndex          ID = 4
+	agqCMIndex        ID = 5
+	akIndex           ID = 6
+	akGHIndex         ID = 7
+	amIndex           ID = 8
+	amETIndex         ID = 9
+	arIndex           ID = 10
+	ar001Index        ID = 11
+	arAEIndex         ID = 12
+	arBHIndex         ID = 13
+	arDJIndex         ID = 14
+	arDZIndex         ID = 15
+	arEGIndex         ID = 16
+	arEHIndex         ID = 17
+	arERIndex         ID = 18
+	arILIndex         ID = 19
+	arIQIndex         ID = 20
+	arJOIndex         ID = 21
+	arKMIndex         ID = 22
+	arKWIndex         ID = 23
+	arLBIndex         ID = 24
+	arLYIndex         ID = 25
+	arMAIndex         ID = 26
+	arMRIndex         ID = 27
+	arOMIndex         ID = 28
+	arPSIndex         ID = 29
+	arQAIndex         ID = 30
+	arSAIndex         ID = 31
+	arSDIndex         ID = 32
+	arSOIndex         ID = 33
+	arSSIndex         ID = 34
+	arSYIndex         ID = 35
+	arTDIndex         ID = 36
+	arTNIndex         ID = 37
+	arYEIndex         ID = 38
+	arsIndex          ID = 39
+	asIndex           ID = 40
+	asINIndex         ID = 41
+	asaIndex          ID = 42
+	asaTZIndex        ID = 43
+	astIndex          ID = 44
+	astESIndex        ID = 45
+	azIndex           ID = 46
+	azCyrlIndex       ID = 47
+	azCyrlAZIndex     ID = 48
+	azLatnIndex       ID = 49
+	azLatnAZIndex     ID = 50
+	basIndex          ID = 51
+	basCMIndex        ID = 52
+	beIndex           ID = 53
+	beBYIndex         ID = 54
+	bemIndex          ID = 55
+	bemZMIndex        ID = 56
+	bezIndex          ID = 57
+	bezTZIndex        ID = 58
+	bgIndex           ID = 59
+	bgBGIndex         ID = 60
+	bhIndex           ID = 61
+	bmIndex           ID = 62
+	bmMLIndex         ID = 63
+	bnIndex           ID = 64
+	bnBDIndex         ID = 65
+	bnINIndex         ID = 66
+	boIndex           ID = 67
+	boCNIndex         ID = 68
+	boINIndex         ID = 69
+	brIndex           ID = 70
+	brFRIndex         ID = 71
+	brxIndex          ID = 72
+	brxINIndex        ID = 73
+	bsIndex           ID = 74
+	bsCyrlIndex       ID = 75
+	bsCyrlBAIndex     ID = 76
+	bsLatnIndex       ID = 77
+	bsLatnBAIndex     ID = 78
+	caIndex           ID = 79
+	caADIndex         ID = 80
+	caESIndex         ID = 81
+	caFRIndex         ID = 82
+	caITIndex         ID = 83
+	ccpIndex          ID = 84
+	ccpBDIndex        ID = 85
+	ccpINIndex        ID = 86
+	ceIndex           ID = 87
+	ceRUIndex         ID = 88
+	cggIndex          ID = 89
+	cggUGIndex        ID = 90
+	chrIndex          ID = 91
+	chrUSIndex        ID = 92
+	ckbIndex          ID = 93
+	ckbIQIndex        ID = 94
+	ckbIRIndex        ID = 95
+	csIndex           ID = 96
+	csCZIndex         ID = 97
+	cuIndex           ID = 98
+	cuRUIndex         ID = 99
+	cyIndex           ID = 100
+	cyGBIndex         ID = 101
+	daIndex           ID = 102
+	daDKIndex         ID = 103
+	daGLIndex         ID = 104
+	davIndex          ID = 105
+	davKEIndex        ID = 106
+	deIndex           ID = 107
+	deATIndex         ID = 108
+	deBEIndex         ID = 109
+	deCHIndex         ID = 110
+	deDEIndex         ID = 111
+	deITIndex         ID = 112
+	deLIIndex         ID = 113
+	deLUIndex         ID = 114
+	djeIndex          ID = 115
+	djeNEIndex        ID = 116
+	dsbIndex          ID = 117
+	dsbDEIndex        ID = 118
+	duaIndex          ID = 119
+	duaCMIndex        ID = 120
+	dvIndex           ID = 121
+	dyoIndex          ID = 122
+	dyoSNIndex        ID = 123
+	dzIndex           ID = 124
+	dzBTIndex         ID = 125
+	ebuIndex          ID = 126
+	ebuKEIndex        ID = 127
+	eeIndex           ID = 128
+	eeGHIndex         ID = 129
+	eeTGIndex         ID = 130
+	elIndex           ID = 131
+	elCYIndex         ID = 132
+	elGRIndex         ID = 133
+	enIndex           ID = 134
+	en001Index        ID = 135
+	en150Index        ID = 136
+	enAGIndex         ID = 137
+	enAIIndex         ID = 138
+	enASIndex         ID = 139
+	enATIndex         ID = 140
+	enAUIndex         ID = 141
+	enBBIndex         ID = 142
+	enBEIndex         ID = 143
+	enBIIndex         ID = 144
+	enBMIndex         ID = 145
+	enBSIndex         ID = 146
+	enBWIndex         ID = 147
+	enBZIndex         ID = 148
+	enCAIndex         ID = 149
+	enCCIndex         ID = 150
+	enCHIndex         ID = 151
+	enCKIndex         ID = 152
+	enCMIndex         ID = 153
+	enCXIndex         ID = 154
+	enCYIndex         ID = 155
+	enDEIndex         ID = 156
+	enDGIndex         ID = 157
+	enDKIndex         ID = 158
+	enDMIndex         ID = 159
+	enERIndex         ID = 160
+	enFIIndex         ID = 161
+	enFJIndex         ID = 162
+	enFKIndex         ID = 163
+	enFMIndex         ID = 164
+	enGBIndex         ID = 165
+	enGDIndex         ID = 166
+	enGGIndex         ID = 167
+	enGHIndex         ID = 168
+	enGIIndex         ID = 169
+	enGMIndex         ID = 170
+	enGUIndex         ID = 171
+	enGYIndex         ID = 172
+	enHKIndex         ID = 173
+	enIEIndex         ID = 174
+	enILIndex         ID = 175
+	enIMIndex         ID = 176
+	enINIndex         ID = 177
+	enIOIndex         ID = 178
+	enJEIndex         ID = 179
+	enJMIndex         ID = 180
+	enKEIndex         ID = 181
+	enKIIndex         ID = 182
+	enKNIndex         ID = 183
+	enKYIndex         ID = 184
+	enLCIndex         ID = 185
+	enLRIndex         ID = 186
+	enLSIndex         ID = 187
+	enMGIndex         ID = 188
+	enMHIndex         ID = 189
+	enMOIndex         ID = 190
+	enMPIndex         ID = 191
+	enMSIndex         ID = 192
+	enMTIndex         ID = 193
+	enMUIndex         ID = 194
+	enMWIndex         ID = 195
+	enMYIndex         ID = 196
+	enNAIndex         ID = 197
+	enNFIndex         ID = 198
+	enNGIndex         ID = 199
+	enNLIndex         ID = 200
+	enNRIndex         ID = 201
+	enNUIndex         ID = 202
+	enNZIndex         ID = 203
+	enPGIndex         ID = 204
+	enPHIndex         ID = 205
+	enPKIndex         ID = 206
+	enPNIndex         ID = 207
+	enPRIndex         ID = 208
+	enPWIndex         ID = 209
+	enRWIndex         ID = 210
+	enSBIndex         ID = 211
+	enSCIndex         ID = 212
+	enSDIndex         ID = 213
+	enSEIndex         ID = 214
+	enSGIndex         ID = 215
+	enSHIndex         ID = 216
+	enSIIndex         ID = 217
+	enSLIndex         ID = 218
+	enSSIndex         ID = 219
+	enSXIndex         ID = 220
+	enSZIndex         ID = 221
+	enTCIndex         ID = 222
+	enTKIndex         ID = 223
+	enTOIndex         ID = 224
+	enTTIndex         ID = 225
+	enTVIndex         ID = 226
+	enTZIndex         ID = 227
+	enUGIndex         ID = 228
+	enUMIndex         ID = 229
+	enUSIndex         ID = 230
+	enVCIndex         ID = 231
+	enVGIndex         ID = 232
+	enVIIndex         ID = 233
+	enVUIndex         ID = 234
+	enWSIndex         ID = 235
+	enZAIndex         ID = 236
+	enZMIndex         ID = 237
+	enZWIndex         ID = 238
+	eoIndex           ID = 239
+	eo001Index        ID = 240
+	esIndex           ID = 241
+	es419Index        ID = 242
+	esARIndex         ID = 243
+	esBOIndex         ID = 244
+	esBRIndex         ID = 245
+	esBZIndex         ID = 246
+	esCLIndex         ID = 247
+	esCOIndex         ID = 248
+	esCRIndex         ID = 249
+	esCUIndex         ID = 250
+	esDOIndex         ID = 251
+	esEAIndex         ID = 252
+	esECIndex         ID = 253
+	esESIndex         ID = 254
+	esGQIndex         ID = 255
+	esGTIndex         ID = 256
+	esHNIndex         ID = 257
+	esICIndex         ID = 258
+	esMXIndex         ID = 259
+	esNIIndex         ID = 260
+	esPAIndex         ID = 261
+	esPEIndex         ID = 262
+	esPHIndex         ID = 263
+	esPRIndex         ID = 264
+	esPYIndex         ID = 265
+	esSVIndex         ID = 266
+	esUSIndex         ID = 267
+	esUYIndex         ID = 268
+	esVEIndex         ID = 269
+	etIndex           ID = 270
+	etEEIndex         ID = 271
+	euIndex           ID = 272
+	euESIndex         ID = 273
+	ewoIndex          ID = 274
+	ewoCMIndex        ID = 275
+	faIndex           ID = 276
+	faAFIndex         ID = 277
+	faIRIndex         ID = 278
+	ffIndex           ID = 279
+	ffCMIndex         ID = 280
+	ffGNIndex         ID = 281
+	ffMRIndex         ID = 282
+	ffSNIndex         ID = 283
+	fiIndex           ID = 284
+	fiFIIndex         ID = 285
+	filIndex          ID = 286
+	filPHIndex        ID = 287
+	foIndex           ID = 288
+	foDKIndex         ID = 289
+	foFOIndex         ID = 290
+	frIndex           ID = 291
+	frBEIndex         ID = 292
+	frBFIndex         ID = 293
+	frBIIndex         ID = 294
+	frBJIndex         ID = 295
+	frBLIndex         ID = 296
+	frCAIndex         ID = 297
+	frCDIndex         ID = 298
+	frCFIndex         ID = 299
+	frCGIndex         ID = 300
+	frCHIndex         ID = 301
+	frCIIndex         ID = 302
+	frCMIndex         ID = 303
+	frDJIndex         ID = 304
+	frDZIndex         ID = 305
+	frFRIndex         ID = 306
+	frGAIndex         ID = 307
+	frGFIndex         ID = 308
+	frGNIndex         ID = 309
+	frGPIndex         ID = 310
+	frGQIndex         ID = 311
+	frHTIndex         ID = 312
+	frKMIndex         ID = 313
+	frLUIndex         ID = 314
+	frMAIndex         ID = 315
+	frMCIndex         ID = 316
+	frMFIndex         ID = 317
+	frMGIndex         ID = 318
+	frMLIndex         ID = 319
+	frMQIndex         ID = 320
+	frMRIndex         ID = 321
+	frMUIndex         ID = 322
+	frNCIndex         ID = 323
+	frNEIndex         ID = 324
+	frPFIndex         ID = 325
+	frPMIndex         ID = 326
+	frREIndex         ID = 327
+	frRWIndex         ID = 328
+	frSCIndex         ID = 329
+	frSNIndex         ID = 330
+	frSYIndex         ID = 331
+	frTDIndex         ID = 332
+	frTGIndex         ID = 333
+	frTNIndex         ID = 334
+	frVUIndex         ID = 335
+	frWFIndex         ID = 336
+	frYTIndex         ID = 337
+	furIndex          ID = 338
+	furITIndex        ID = 339
+	fyIndex           ID = 340
+	fyNLIndex         ID = 341
+	gaIndex           ID = 342
+	gaIEIndex         ID = 343
+	gdIndex           ID = 344
+	gdGBIndex         ID = 345
+	glIndex           ID = 346
+	glESIndex         ID = 347
+	gswIndex          ID = 348
+	gswCHIndex        ID = 349
+	gswFRIndex        ID = 350
+	gswLIIndex        ID = 351
+	guIndex           ID = 352
+	guINIndex         ID = 353
+	guwIndex          ID = 354
+	guzIndex          ID = 355
+	guzKEIndex        ID = 356
+	gvIndex           ID = 357
+	gvIMIndex         ID = 358
+	haIndex           ID = 359
+	haGHIndex         ID = 360
+	haNEIndex         ID = 361
+	haNGIndex         ID = 362
+	hawIndex          ID = 363
+	hawUSIndex        ID = 364
+	heIndex           ID = 365
+	heILIndex         ID = 366
+	hiIndex           ID = 367
+	hiINIndex         ID = 368
+	hrIndex           ID = 369
+	hrBAIndex         ID = 370
+	hrHRIndex         ID = 371
+	hsbIndex          ID = 372
+	hsbDEIndex        ID = 373
+	huIndex           ID = 374
+	huHUIndex         ID = 375
+	hyIndex           ID = 376
+	hyAMIndex         ID = 377
+	idIndex           ID = 378
+	idIDIndex         ID = 379
+	igIndex           ID = 380
+	igNGIndex         ID = 381
+	iiIndex           ID = 382
+	iiCNIndex         ID = 383
+	inIndex           ID = 384
+	ioIndex           ID = 385
+	isIndex           ID = 386
+	isISIndex         ID = 387
+	itIndex           ID = 388
+	itCHIndex         ID = 389
+	itITIndex         ID = 390
+	itSMIndex         ID = 391
+	itVAIndex         ID = 392
+	iuIndex           ID = 393
+	iwIndex           ID = 394
+	jaIndex           ID = 395
+	jaJPIndex         ID = 396
+	jboIndex          ID = 397
+	jgoIndex          ID = 398
+	jgoCMIndex        ID = 399
+	jiIndex           ID = 400
+	jmcIndex          ID = 401
+	jmcTZIndex        ID = 402
+	jvIndex           ID = 403
+	jwIndex           ID = 404
+	kaIndex           ID = 405
+	kaGEIndex         ID = 406
+	kabIndex          ID = 407
+	kabDZIndex        ID = 408
+	kajIndex          ID = 409
+	kamIndex          ID = 410
+	kamKEIndex        ID = 411
+	kcgIndex          ID = 412
+	kdeIndex          ID = 413
+	kdeTZIndex        ID = 414
+	keaIndex          ID = 415
+	keaCVIndex        ID = 416
+	khqIndex          ID = 417
+	khqMLIndex        ID = 418
+	kiIndex           ID = 419
+	kiKEIndex         ID = 420
+	kkIndex           ID = 421
+	kkKZIndex         ID = 422
+	kkjIndex          ID = 423
+	kkjCMIndex        ID = 424
+	klIndex           ID = 425
+	klGLIndex         ID = 426
+	klnIndex          ID = 427
+	klnKEIndex        ID = 428
+	kmIndex           ID = 429
+	kmKHIndex         ID = 430
+	knIndex           ID = 431
+	knINIndex         ID = 432
+	koIndex           ID = 433
+	koKPIndex         ID = 434
+	koKRIndex         ID = 435
+	kokIndex          ID = 436
+	kokINIndex        ID = 437
+	ksIndex           ID = 438
+	ksINIndex         ID = 439
+	ksbIndex          ID = 440
+	ksbTZIndex        ID = 441
+	ksfIndex          ID = 442
+	ksfCMIndex        ID = 443
+	kshIndex          ID = 444
+	kshDEIndex        ID = 445
+	kuIndex           ID = 446
+	kwIndex           ID = 447
+	kwGBIndex         ID = 448
+	kyIndex           ID = 449
+	kyKGIndex         ID = 450
+	lagIndex          ID = 451
+	lagTZIndex        ID = 452
+	lbIndex           ID = 453
+	lbLUIndex         ID = 454
+	lgIndex           ID = 455
+	lgUGIndex         ID = 456
+	lktIndex          ID = 457
+	lktUSIndex        ID = 458
+	lnIndex           ID = 459
+	lnAOIndex         ID = 460
+	lnCDIndex         ID = 461
+	lnCFIndex         ID = 462
+	lnCGIndex         ID = 463
+	loIndex           ID = 464
+	loLAIndex         ID = 465
+	lrcIndex          ID = 466
+	lrcIQIndex        ID = 467
+	lrcIRIndex        ID = 468
+	ltIndex           ID = 469
+	ltLTIndex         ID = 470
+	luIndex           ID = 471
+	luCDIndex         ID = 472
+	luoIndex          ID = 473
+	luoKEIndex        ID = 474
+	luyIndex          ID = 475
+	luyKEIndex        ID = 476
+	lvIndex           ID = 477
+	lvLVIndex         ID = 478
+	masIndex          ID = 479
+	masKEIndex        ID = 480
+	masTZIndex        ID = 481
+	merIndex          ID = 482
+	merKEIndex        ID = 483
+	mfeIndex          ID = 484
+	mfeMUIndex        ID = 485
+	mgIndex           ID = 486
+	mgMGIndex         ID = 487
+	mghIndex          ID = 488
+	mghMZIndex        ID = 489
+	mgoIndex          ID = 490
+	mgoCMIndex        ID = 491
+	mkIndex           ID = 492
+	mkMKIndex         ID = 493
+	mlIndex           ID = 494
+	mlINIndex         ID = 495
+	mnIndex           ID = 496
+	mnMNIndex         ID = 497
+	moIndex           ID = 498
+	mrIndex           ID = 499
+	mrINIndex         ID = 500
+	msIndex           ID = 501
+	msBNIndex         ID = 502
+	msMYIndex         ID = 503
+	msSGIndex         ID = 504
+	mtIndex           ID = 505
+	mtMTIndex         ID = 506
+	muaIndex          ID = 507
+	muaCMIndex        ID = 508
+	myIndex           ID = 509
+	myMMIndex         ID = 510
+	mznIndex          ID = 511
+	mznIRIndex        ID = 512
+	nahIndex          ID = 513
+	naqIndex          ID = 514
+	naqNAIndex        ID = 515
+	nbIndex           ID = 516
+	nbNOIndex         ID = 517
+	nbSJIndex         ID = 518
+	ndIndex           ID = 519
+	ndZWIndex         ID = 520
+	ndsIndex          ID = 521
+	ndsDEIndex        ID = 522
+	ndsNLIndex        ID = 523
+	neIndex           ID = 524
+	neINIndex         ID = 525
+	neNPIndex         ID = 526
+	nlIndex           ID = 527
+	nlAWIndex         ID = 528
+	nlBEIndex         ID = 529
+	nlBQIndex         ID = 530
+	nlCWIndex         ID = 531
+	nlNLIndex         ID = 532
+	nlSRIndex         ID = 533
+	nlSXIndex         ID = 534
+	nmgIndex          ID = 535
+	nmgCMIndex        ID = 536
+	nnIndex           ID = 537
+	nnNOIndex         ID = 538
+	nnhIndex          ID = 539
+	nnhCMIndex        ID = 540
+	noIndex           ID = 541
+	nqoIndex          ID = 542
+	nrIndex           ID = 543
+	nsoIndex          ID = 544
+	nusIndex          ID = 545
+	nusSSIndex        ID = 546
+	nyIndex           ID = 547
+	nynIndex          ID = 548
+	nynUGIndex        ID = 549
+	omIndex           ID = 550
+	omETIndex         ID = 551
+	omKEIndex         ID = 552
+	orIndex           ID = 553
+	orINIndex         ID = 554
+	osIndex           ID = 555
+	osGEIndex         ID = 556
+	osRUIndex         ID = 557
+	paIndex           ID = 558
+	paArabIndex       ID = 559
+	paArabPKIndex     ID = 560
+	paGuruIndex       ID = 561
+	paGuruINIndex     ID = 562
+	papIndex          ID = 563
+	plIndex           ID = 564
+	plPLIndex         ID = 565
+	prgIndex          ID = 566
+	prg001Index       ID = 567
+	psIndex           ID = 568
+	psAFIndex         ID = 569
+	ptIndex           ID = 570
+	ptAOIndex         ID = 571
+	ptBRIndex         ID = 572
+	ptCHIndex         ID = 573
+	ptCVIndex         ID = 574
+	ptGQIndex         ID = 575
+	ptGWIndex         ID = 576
+	ptLUIndex         ID = 577
+	ptMOIndex         ID = 578
+	ptMZIndex         ID = 579
+	ptPTIndex         ID = 580
+	ptSTIndex         ID = 581
+	ptTLIndex         ID = 582
+	quIndex           ID = 583
+	quBOIndex         ID = 584
+	quECIndex         ID = 585
+	quPEIndex         ID = 586
+	rmIndex           ID = 587
+	rmCHIndex         ID = 588
+	rnIndex           ID = 589
+	rnBIIndex         ID = 590
+	roIndex           ID = 591
+	roMDIndex         ID = 592
+	roROIndex         ID = 593
+	rofIndex          ID = 594
+	rofTZIndex        ID = 595
+	ruIndex           ID = 596
+	ruBYIndex         ID = 597
+	ruKGIndex         ID = 598
+	ruKZIndex         ID = 599
+	ruMDIndex         ID = 600
+	ruRUIndex         ID = 601
+	ruUAIndex         ID = 602
+	rwIndex           ID = 603
+	rwRWIndex         ID = 604
+	rwkIndex          ID = 605
+	rwkTZIndex        ID = 606
+	sahIndex          ID = 607
+	sahRUIndex        ID = 608
+	saqIndex          ID = 609
+	saqKEIndex        ID = 610
+	sbpIndex          ID = 611
+	sbpTZIndex        ID = 612
+	sdIndex           ID = 613
+	sdPKIndex         ID = 614
+	sdhIndex          ID = 615
+	seIndex           ID = 616
+	seFIIndex         ID = 617
+	seNOIndex         ID = 618
+	seSEIndex         ID = 619
+	sehIndex          ID = 620
+	sehMZIndex        ID = 621
+	sesIndex          ID = 622
+	sesMLIndex        ID = 623
+	sgIndex           ID = 624
+	sgCFIndex         ID = 625
+	shIndex           ID = 626
+	shiIndex          ID = 627
+	shiLatnIndex      ID = 628
+	shiLatnMAIndex    ID = 629
+	shiTfngIndex      ID = 630
+	shiTfngMAIndex    ID = 631
+	siIndex           ID = 632
+	siLKIndex         ID = 633
+	skIndex           ID = 634
+	skSKIndex         ID = 635
+	slIndex           ID = 636
+	slSIIndex         ID = 637
+	smaIndex          ID = 638
+	smiIndex          ID = 639
+	smjIndex          ID = 640
+	smnIndex          ID = 641
+	smnFIIndex        ID = 642
+	smsIndex          ID = 643
+	snIndex           ID = 644
+	snZWIndex         ID = 645
+	soIndex           ID = 646
+	soDJIndex         ID = 647
+	soETIndex         ID = 648
+	soKEIndex         ID = 649
+	soSOIndex         ID = 650
+	sqIndex           ID = 651
+	sqALIndex         ID = 652
+	sqMKIndex         ID = 653
+	sqXKIndex         ID = 654
+	srIndex           ID = 655
+	srCyrlIndex       ID = 656
+	srCyrlBAIndex     ID = 657
+	srCyrlMEIndex     ID = 658
+	srCyrlRSIndex     ID = 659
+	srCyrlXKIndex     ID = 660
+	srLatnIndex       ID = 661
+	srLatnBAIndex     ID = 662
+	srLatnMEIndex     ID = 663
+	srLatnRSIndex     ID = 664
+	srLatnXKIndex     ID = 665
+	ssIndex           ID = 666
+	ssyIndex          ID = 667
+	stIndex           ID = 668
+	svIndex           ID = 669
+	svAXIndex         ID = 670
+	svFIIndex         ID = 671
+	svSEIndex         ID = 672
+	swIndex           ID = 673
+	swCDIndex         ID = 674
+	swKEIndex         ID = 675
+	swTZIndex         ID = 676
+	swUGIndex         ID = 677
+	syrIndex          ID = 678
+	taIndex           ID = 679
+	taINIndex         ID = 680
+	taLKIndex         ID = 681
+	taMYIndex         ID = 682
+	taSGIndex         ID = 683
+	teIndex           ID = 684
+	teINIndex         ID = 685
+	teoIndex          ID = 686
+	teoKEIndex        ID = 687
+	teoUGIndex        ID = 688
+	tgIndex           ID = 689
+	tgTJIndex         ID = 690
+	thIndex           ID = 691
+	thTHIndex         ID = 692
+	tiIndex           ID = 693
+	tiERIndex         ID = 694
+	tiETIndex         ID = 695
+	tigIndex          ID = 696
+	tkIndex           ID = 697
+	tkTMIndex         ID = 698
+	tlIndex           ID = 699
+	tnIndex           ID = 700
+	toIndex           ID = 701
+	toTOIndex         ID = 702
+	trIndex           ID = 703
+	trCYIndex         ID = 704
+	trTRIndex         ID = 705
+	tsIndex           ID = 706
+	ttIndex           ID = 707
+	ttRUIndex         ID = 708
+	twqIndex          ID = 709
+	twqNEIndex        ID = 710
+	tzmIndex          ID = 711
+	tzmMAIndex        ID = 712
+	ugIndex           ID = 713
+	ugCNIndex         ID = 714
+	ukIndex           ID = 715
+	ukUAIndex         ID = 716
+	urIndex           ID = 717
+	urINIndex         ID = 718
+	urPKIndex         ID = 719
+	uzIndex           ID = 720
+	uzArabIndex       ID = 721
+	uzArabAFIndex     ID = 722
+	uzCyrlIndex       ID = 723
+	uzCyrlUZIndex     ID = 724
+	uzLatnIndex       ID = 725
+	uzLatnUZIndex     ID = 726
+	vaiIndex          ID = 727
+	vaiLatnIndex      ID = 728
+	vaiLatnLRIndex    ID = 729
+	vaiVaiiIndex      ID = 730
+	vaiVaiiLRIndex    ID = 731
+	veIndex           ID = 732
+	viIndex           ID = 733
+	viVNIndex         ID = 734
+	voIndex           ID = 735
+	vo001Index        ID = 736
+	vunIndex          ID = 737
+	vunTZIndex        ID = 738
+	waIndex           ID = 739
+	waeIndex          ID = 740
+	waeCHIndex        ID = 741
+	woIndex           ID = 742
+	woSNIndex         ID = 743
+	xhIndex           ID = 744
+	xogIndex          ID = 745
+	xogUGIndex        ID = 746
+	yavIndex          ID = 747
+	yavCMIndex        ID = 748
+	yiIndex           ID = 749
+	yi001Index        ID = 750
+	yoIndex           ID = 751
+	yoBJIndex         ID = 752
+	yoNGIndex         ID = 753
+	yueIndex          ID = 754
+	yueHansIndex      ID = 755
+	yueHansCNIndex    ID = 756
+	yueHantIndex      ID = 757
+	yueHantHKIndex    ID = 758
+	zghIndex          ID = 759
+	zghMAIndex        ID = 760
+	zhIndex           ID = 761
+	zhHansIndex       ID = 762
+	zhHansCNIndex     ID = 763
+	zhHansHKIndex     ID = 764
+	zhHansMOIndex     ID = 765
+	zhHansSGIndex     ID = 766
+	zhHantIndex       ID = 767
+	zhHantHKIndex     ID = 768
+	zhHantMOIndex     ID = 769
+	zhHantTWIndex     ID = 770
+	zuIndex           ID = 771
+	zuZAIndex         ID = 772
+	caESvalenciaIndex ID = 773
+	enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+	// Entry 0 - 1F
+	0x00000000, 0x01600000, 0x016000d2, 0x01600161,
+	0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
+	0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
+	0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
+	0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
+	0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
+	0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
+	0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+	// Entry 20 - 3F
+	0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
+	0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
+	0x04300000, 0x04300099, 0x04400000, 0x0440012f,
+	0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
+	0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
+	0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+	0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
+	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+	// Entry 40 - 5F
+	0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
+	0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
+	0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
+	0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
+	0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
+	0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
+	0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
+	0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+	// Entry 60 - 7F
+	0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
+	0x10000000, 0x1000007b, 0x10100000, 0x10100063,
+	0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
+	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
+	0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
+	0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
+	0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
+	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+	// Entry 80 - 9F
+	0x13000000, 0x13000080, 0x13000122, 0x13600000,
+	0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+	0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+	0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+	0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+	0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+	0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
+	0x13900060, 0x13900061, 0x13900063, 0x13900064,
+	// Entry A0 - BF
+	0x1390006d, 0x13900072, 0x13900073, 0x13900074,
+	0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
+	0x13900080, 0x13900081, 0x13900083, 0x1390008a,
+	0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
+	0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
+	0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
+	0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
+	0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+	// Entry C0 - DF
+	0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
+	0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
+	0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
+	0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
+	0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
+	0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
+	0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
+	0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+	// Entry E0 - FF
+	0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
+	0x13900131, 0x13900133, 0x13900135, 0x13900139,
+	0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
+	0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+	0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+	0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+	0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
+	0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+	// Entry 100 - 11F
+	0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
+	0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
+	0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
+	0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
+	0x14500000, 0x1450006e, 0x14600000, 0x14600052,
+	0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
+	0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
+	0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+	// Entry 120 - 13F
+	0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+	0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+	0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+	0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+	0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
+	0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
+	0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
+	0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+	// Entry 140 - 15F
+	0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
+	0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
+	0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
+	0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
+	0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
+	0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
+	0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
+	0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+	// Entry 160 - 17F
+	0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
+	0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
+	0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
+	0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
+	0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
+	0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
+	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
+	0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+	// Entry 180 - 19F
+	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
+	0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
+	0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
+	0x200000a2, 0x20300000, 0x20700000, 0x20700052,
+	0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
+	0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
+	0x21200067, 0x21600000, 0x21700000, 0x217000a4,
+	0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+	// Entry 1A0 - 1BF
+	0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
+	0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
+	0x24400052, 0x24500000, 0x24500082, 0x24600000,
+	0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
+	0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
+	0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
+	0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
+	0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+	// Entry 1C0 - 1DF
+	0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
+	0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
+	0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+	0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+	0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
+	0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
+	0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
+	0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+	// Entry 1E0 - 1FF
+	0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
+	0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
+	0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
+	0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
+	0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
+	0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
+	0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
+	0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+	// Entry 200 - 21F
+	0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
+	0x34700000, 0x347000da, 0x34700110, 0x34e00000,
+	0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
+	0x35100000, 0x35100099, 0x351000db, 0x36700000,
+	0x36700030, 0x36700036, 0x36700040, 0x3670005b,
+	0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
+	0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+	0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+	// Entry 220 - 23F
+	0x37a00000, 0x38000000, 0x38000117, 0x38700000,
+	0x38900000, 0x38900131, 0x39000000, 0x3900006f,
+	0x390000a4, 0x39500000, 0x39500099, 0x39800000,
+	0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
+	0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
+	0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+	0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+	0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+	// Entry 240 - 25F
+	0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
+	0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
+	0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+	0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+	0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
+	0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
+	0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
+	0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+	// Entry 260 - 27F
+	0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
+	0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
+	0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
+	0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+	0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+	0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
+	0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
+	0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+	// Entry 280 - 29F
+	0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
+	0x42300000, 0x42300164, 0x42900000, 0x42900062,
+	0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
+	0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
+	0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
+	0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
+	0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
+	0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+	// Entry 2A0 - 2BF
+	0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
+	0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
+	0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
+	0x46100000, 0x46100099, 0x46400000, 0x464000a4,
+	0x46400131, 0x46700000, 0x46700124, 0x46b00000,
+	0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
+	0x47100000, 0x47600000, 0x47600127, 0x47a00000,
+	0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+	// Entry 2C0 - 2DF
+	0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
+	0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
+	0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+	0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+	0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
+	0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
+	0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
+	0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+	// Entry 2E0 - 2FF
+	0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
+	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
+	0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+	0x50900052, 0x51200000, 0x51200001, 0x51800000,
+	0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
+	0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
+	0x528000ba, 0x52900000, 0x52938000, 0x52938053,
+	0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
+	// Entry 300 - 31F
+	0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
+	0x52f00161,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 0000000..ca135d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+	und = Tag{}
+
+	Und Tag = Tag{}
+
+	Afrikaans            Tag = Tag{language: afIndex, locale: afIndex}
+	Amharic              Tag = Tag{language: amIndex, locale: amIndex}
+	Arabic               Tag = Tag{language: arIndex, locale: arIndex}
+	ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+	Azerbaijani          Tag = Tag{language: azIndex, locale: azIndex}
+	Bulgarian            Tag = Tag{language: bgIndex, locale: bgIndex}
+	Bengali              Tag = Tag{language: bnIndex, locale: bnIndex}
+	Catalan              Tag = Tag{language: caIndex, locale: caIndex}
+	Czech                Tag = Tag{language: csIndex, locale: csIndex}
+	Danish               Tag = Tag{language: daIndex, locale: daIndex}
+	German               Tag = Tag{language: deIndex, locale: deIndex}
+	Greek                Tag = Tag{language: elIndex, locale: elIndex}
+	English              Tag = Tag{language: enIndex, locale: enIndex}
+	AmericanEnglish      Tag = Tag{language: enUSIndex, locale: enUSIndex}
+	BritishEnglish       Tag = Tag{language: enGBIndex, locale: enGBIndex}
+	Spanish              Tag = Tag{language: esIndex, locale: esIndex}
+	EuropeanSpanish      Tag = Tag{language: esESIndex, locale: esESIndex}
+	LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+	Estonian             Tag = Tag{language: etIndex, locale: etIndex}
+	Persian              Tag = Tag{language: faIndex, locale: faIndex}
+	Finnish              Tag = Tag{language: fiIndex, locale: fiIndex}
+	Filipino             Tag = Tag{language: filIndex, locale: filIndex}
+	French               Tag = Tag{language: frIndex, locale: frIndex}
+	CanadianFrench       Tag = Tag{language: frCAIndex, locale: frCAIndex}
+	Gujarati             Tag = Tag{language: guIndex, locale: guIndex}
+	Hebrew               Tag = Tag{language: heIndex, locale: heIndex}
+	Hindi                Tag = Tag{language: hiIndex, locale: hiIndex}
+	Croatian             Tag = Tag{language: hrIndex, locale: hrIndex}
+	Hungarian            Tag = Tag{language: huIndex, locale: huIndex}
+	Armenian             Tag = Tag{language: hyIndex, locale: hyIndex}
+	Indonesian           Tag = Tag{language: idIndex, locale: idIndex}
+	Icelandic            Tag = Tag{language: isIndex, locale: isIndex}
+	Italian              Tag = Tag{language: itIndex, locale: itIndex}
+	Japanese             Tag = Tag{language: jaIndex, locale: jaIndex}
+	Georgian             Tag = Tag{language: kaIndex, locale: kaIndex}
+	Kazakh               Tag = Tag{language: kkIndex, locale: kkIndex}
+	Khmer                Tag = Tag{language: kmIndex, locale: kmIndex}
+	Kannada              Tag = Tag{language: knIndex, locale: knIndex}
+	Korean               Tag = Tag{language: koIndex, locale: koIndex}
+	Kirghiz              Tag = Tag{language: kyIndex, locale: kyIndex}
+	Lao                  Tag = Tag{language: loIndex, locale: loIndex}
+	Lithuanian           Tag = Tag{language: ltIndex, locale: ltIndex}
+	Latvian              Tag = Tag{language: lvIndex, locale: lvIndex}
+	Macedonian           Tag = Tag{language: mkIndex, locale: mkIndex}
+	Malayalam            Tag = Tag{language: mlIndex, locale: mlIndex}
+	Mongolian            Tag = Tag{language: mnIndex, locale: mnIndex}
+	Marathi              Tag = Tag{language: mrIndex, locale: mrIndex}
+	Malay                Tag = Tag{language: msIndex, locale: msIndex}
+	Burmese              Tag = Tag{language: myIndex, locale: myIndex}
+	Nepali               Tag = Tag{language: neIndex, locale: neIndex}
+	Dutch                Tag = Tag{language: nlIndex, locale: nlIndex}
+	Norwegian            Tag = Tag{language: noIndex, locale: noIndex}
+	Punjabi              Tag = Tag{language: paIndex, locale: paIndex}
+	Polish               Tag = Tag{language: plIndex, locale: plIndex}
+	Portuguese           Tag = Tag{language: ptIndex, locale: ptIndex}
+	BrazilianPortuguese  Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+	EuropeanPortuguese   Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+	Romanian             Tag = Tag{language: roIndex, locale: roIndex}
+	Russian              Tag = Tag{language: ruIndex, locale: ruIndex}
+	Sinhala              Tag = Tag{language: siIndex, locale: siIndex}
+	Slovak               Tag = Tag{language: skIndex, locale: skIndex}
+	Slovenian            Tag = Tag{language: slIndex, locale: slIndex}
+	Albanian             Tag = Tag{language: sqIndex, locale: sqIndex}
+	Serbian              Tag = Tag{language: srIndex, locale: srIndex}
+	SerbianLatin         Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+	Swedish              Tag = Tag{language: svIndex, locale: svIndex}
+	Swahili              Tag = Tag{language: swIndex, locale: swIndex}
+	Tamil                Tag = Tag{language: taIndex, locale: taIndex}
+	Telugu               Tag = Tag{language: teIndex, locale: teIndex}
+	Thai                 Tag = Tag{language: thIndex, locale: thIndex}
+	Turkish              Tag = Tag{language: trIndex, locale: trIndex}
+	Ukrainian            Tag = Tag{language: ukIndex, locale: ukIndex}
+	Urdu                 Tag = Tag{language: urIndex, locale: urIndex}
+	Uzbek                Tag = Tag{language: uzIndex, locale: uzIndex}
+	Vietnamese           Tag = Tag{language: viIndex, locale: viIndex}
+	Chinese              Tag = Tag{language: zhIndex, locale: zhIndex}
+	SimplifiedChinese    Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+	TraditionalChinese   Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+	Zulu                 Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 0000000..4ae78e0
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"sort"
+	"strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+	Tag Tag
+
+	private    string // the x extension
+	variants   []string
+	extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+	t := b.Tag
+
+	if len(b.extensions) > 0 || len(b.variants) > 0 {
+		sort.Sort(sortVariants(b.variants))
+		sort.Strings(b.extensions)
+
+		if b.private != "" {
+			b.extensions = append(b.extensions, b.private)
+		}
+		n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+		buf := make([]byte, n)
+		p := t.genCoreBytes(buf)
+		t.pVariant = byte(p)
+		p += appendTokens(buf[p:], b.variants...)
+		t.pExt = uint16(p)
+		p += appendTokens(buf[p:], b.extensions...)
+		t.str = string(buf[:p])
+		// We may not always need to remake the string, but when or when not
+		// to do so is rather tricky.
+		scan := makeScanner(buf[:p])
+		t, _ = parse(&scan, "")
+		return t
+
+	} else if b.private != "" {
+		t.str = b.private
+		t.RemakeString()
+	}
+	return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+	b.Tag.LangID = t.LangID
+	b.Tag.RegionID = t.RegionID
+	b.Tag.ScriptID = t.ScriptID
+	// TODO: optimize
+	b.variants = b.variants[:0]
+	if variants := t.Variants(); variants != "" {
+		for _, vr := range strings.Split(variants[1:], "-") {
+			b.variants = append(b.variants, vr)
+		}
+	}
+	b.extensions, b.private = b.extensions[:0], ""
+	for _, e := range t.Extensions() {
+		b.AddExt(e)
+	}
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+	if e[0] == 'x' {
+		if b.private == "" {
+			b.private = e
+		}
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] += e[1:]
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+	if e[0] == 'x' {
+		b.private = e
+		return
+	}
+	for i, s := range b.extensions {
+		if s[0] == e[0] {
+			if e[0] == 'u' {
+				b.extensions[i] = e + s[1:]
+			} else {
+				b.extensions[i] = e
+			}
+			return
+		}
+	}
+	b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+	for _, v := range v {
+		if v != "" {
+			b.variants = append(b.variants, v)
+		}
+	}
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+	b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+	b.private = ""
+	b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+	for _, t := range token {
+		n += len(t) + 1
+	}
+	return
+}
+
+func appendTokens(b []byte, token ...string) int {
+	p := 0
+	for _, t := range token {
+		b[p] = '-'
+		copy(b[p+1:], t)
+		p += 1 + len(t)
+	}
+	return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+	return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+	s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+	return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 0000000..9b20b88
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+	base := make([]Language, 0, NumLanguages)
+	for i := 0; i < langNoIndexOffset; i++ {
+		// We included "und" already for the value 0.
+		if i != nonCanonicalUnd {
+			base = append(base, Language(i))
+		}
+	}
+	i := langNoIndexOffset
+	for _, v := range langNoIndex {
+		for k := 0; k < 8; k++ {
+			if v&1 == 1 {
+				base = append(base, Language(i))
+			}
+			v >>= 1
+			i++
+		}
+	}
+	return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go
new file mode 100644
index 0000000..cdcc7fe
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/gen.go
@@ -0,0 +1,1520 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build ignore
+
+// Language tag table generator.
+// Data read from the web.
+
+package main
+
+import (
+	"bufio"
+	"flag"
+	"fmt"
+	"io"
+	"io/ioutil"
+	"log"
+	"math"
+	"reflect"
+	"regexp"
+	"sort"
+	"strconv"
+	"strings"
+
+	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/unicode/cldr"
+)
+
+var (
+	test = flag.Bool("test",
+		false,
+		"test existing tables; can be used to compare web data with package data.")
+	outputFile = flag.String("output",
+		"tables.go",
+		"output file for generated tables")
+)
+
+var comment = []string{
+	`
+lang holds an alphabetically sorted list of ISO-639 language identifiers.
+All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+For 2-byte language identifiers, the two successive bytes have the following meaning:
+    - if the first letter of the 2- and 3-letter ISO codes are the same:
+      the second and third letter of the 3-letter ISO code.
+    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+For 3-byte language identifiers the 4th byte is 0.`,
+	`
+langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+in lookup tables. The language ids for these language codes are derived directly
+from the letters and are not consecutive.`,
+	`
+altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+to 2-letter language codes that cannot be derived using the method described above.
+Each 3-letter code is followed by its 1-byte langID.`,
+	`
+altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
+	`
+AliasMap maps langIDs to their suggested replacements.`,
+	`
+script is an alphabetically sorted list of ISO 15924 codes. The index
+of the script in the string, divided by 4, is the internal scriptID.`,
+	`
+isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+the UN.M49 codes used for groups.)`,
+	`
+regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+Each 2-letter codes is followed by two bytes with the following meaning:
+    - [A-Z}{2}: the first letter of the 2-letter code plus these two
+                letters form the 3-letter ISO code.
+    - 0, n:     index into altRegionISO3.`,
+	`
+regionTypes defines the status of a region for various standards.`,
+	`
+m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+codes indicating collections of regions.`,
+	`
+m49Index gives indexes into fromM49 based on the three most significant bits
+of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+The region code is stored in the 9 lsb of the indexed value.`,
+	`
+fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
+	`
+altRegionISO3 holds a list of 3-letter region codes that cannot be
+mapped to 2-letter codes using the default algorithm. This is a short list.`,
+	`
+altRegionIDs holds a list of regionIDs the positions of which match those
+of the 3-letter ISO codes in altRegionISO3.`,
+	`
+variantNumSpecialized is the number of specialized variants in variants.`,
+	`
+suppressScript is an index from langID to the dominant script for that language,
+if it exists.  If a script is given, it should be suppressed from the language tag.`,
+	`
+likelyLang is a lookup table, indexed by langID, for the most likely
+scripts and regions given incomplete information. If more entries exist for a
+given language, region and script are the index and size respectively
+of the list in likelyLangList.`,
+	`
+likelyLangList holds lists info associated with likelyLang.`,
+	`
+likelyRegion is a lookup table, indexed by regionID, for the most likely
+languages and scripts given incomplete information. If more entries exist
+for a given regionID, lang and script are the index and size respectively
+of the list in likelyRegionList.
+TODO: exclude containers and user-definable regions from the list.`,
+	`
+likelyRegionList holds lists info associated with likelyRegion.`,
+	`
+likelyScript is a lookup table, indexed by scriptID, for the most likely
+languages and regions given a script.`,
+	`
+nRegionGroups is the number of region groups.`,
+	`
+regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+where each set holds all groupings that are directly connected in a region
+containment graph.`,
+	`
+regionInclusionBits is an array of bit vectors where every vector represents
+a set of region groupings.  These sets are used to compute the distance
+between two regions for the purpose of language matching.`,
+	`
+regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+all groups that are reachable from the groups set in the respective entry.`,
+}
+
+// TODO: consider changing some of these structures to tries. This can reduce
+// memory, but may increase the need for memory allocations. This could be
+// mitigated if we can piggyback on language tags for common cases.
+
+func failOnError(e error) {
+	if e != nil {
+		log.Panic(e)
+	}
+}
+
+type setType int
+
+const (
+	Indexed setType = 1 + iota // all elements must be of same size
+	Linear
+)
+
+type stringSet struct {
+	s              []string
+	sorted, frozen bool
+
+	// We often need to update values after the creation of an index is completed.
+	// We include a convenience map for keeping track of this.
+	update map[string]string
+	typ    setType // used for checking.
+}
+
+func (ss *stringSet) clone() stringSet {
+	c := *ss
+	c.s = append([]string(nil), c.s...)
+	return c
+}
+
+func (ss *stringSet) setType(t setType) {
+	if ss.typ != t && ss.typ != 0 {
+		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
+	}
+}
+
+// parse parses a whitespace-separated string and initializes ss with its
+// components.
+func (ss *stringSet) parse(s string) {
+	scan := bufio.NewScanner(strings.NewReader(s))
+	scan.Split(bufio.ScanWords)
+	for scan.Scan() {
+		ss.add(scan.Text())
+	}
+}
+
+func (ss *stringSet) assertChangeable() {
+	if ss.frozen {
+		log.Panic("attempt to modify a frozen stringSet")
+	}
+}
+
+func (ss *stringSet) add(s string) {
+	ss.assertChangeable()
+	ss.s = append(ss.s, s)
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) freeze() {
+	ss.compact()
+	ss.frozen = true
+}
+
+func (ss *stringSet) compact() {
+	if ss.sorted {
+		return
+	}
+	a := ss.s
+	sort.Strings(a)
+	k := 0
+	for i := 1; i < len(a); i++ {
+		if a[k] != a[i] {
+			a[k+1] = a[i]
+			k++
+		}
+	}
+	ss.s = a[:k+1]
+	ss.sorted = ss.frozen
+}
+
+type funcSorter struct {
+	fn func(a, b string) bool
+	sort.StringSlice
+}
+
+func (s funcSorter) Less(i, j int) bool {
+	return s.fn(s.StringSlice[i], s.StringSlice[j])
+}
+
+func (ss *stringSet) sortFunc(f func(a, b string) bool) {
+	ss.compact()
+	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
+}
+
+func (ss *stringSet) remove(s string) {
+	ss.assertChangeable()
+	if i, ok := ss.find(s); ok {
+		copy(ss.s[i:], ss.s[i+1:])
+		ss.s = ss.s[:len(ss.s)-1]
+	}
+}
+
+func (ss *stringSet) replace(ol, nu string) {
+	ss.s[ss.index(ol)] = nu
+	ss.sorted = ss.frozen
+}
+
+func (ss *stringSet) index(s string) int {
+	ss.setType(Indexed)
+	i, ok := ss.find(s)
+	if !ok {
+		if i < len(ss.s) {
+			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
+		}
+		log.Panicf("find: item %q is not in list", s)
+
+	}
+	return i
+}
+
+func (ss *stringSet) find(s string) (int, bool) {
+	ss.compact()
+	i := sort.SearchStrings(ss.s, s)
+	return i, i != len(ss.s) && ss.s[i] == s
+}
+
+func (ss *stringSet) slice() []string {
+	ss.compact()
+	return ss.s
+}
+
+func (ss *stringSet) updateLater(v, key string) {
+	if ss.update == nil {
+		ss.update = map[string]string{}
+	}
+	ss.update[v] = key
+}
+
+// join joins the string and ensures that all entries are of the same length.
+func (ss *stringSet) join() string {
+	ss.setType(Indexed)
+	n := len(ss.s[0])
+	for _, s := range ss.s {
+		if len(s) != n {
+			log.Panicf("join: not all entries are of the same length: %q", s)
+		}
+	}
+	ss.s = append(ss.s, strings.Repeat("\xff", n))
+	return strings.Join(ss.s, "")
+}
+
+// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
+// All types use the same entry.
+// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
+// fields.
+type ianaEntry struct {
+	typ            string
+	description    []string
+	scope          string
+	added          string
+	preferred      string
+	deprecated     string
+	suppressScript string
+	macro          string
+	prefix         []string
+}
+
+type builder struct {
+	w    *gen.CodeWriter
+	hw   io.Writer // MultiWriter for w and w.Hash
+	data *cldr.CLDR
+	supp *cldr.SupplementalData
+
+	// indices
+	locale      stringSet // common locales
+	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
+	langNoIndex stringSet // 3-letter ISO codes with no associated data
+	script      stringSet // 4-letter ISO codes
+	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
+	variant     stringSet // 4-8-alphanumeric variant code.
+
+	// Region codes that are groups with their corresponding group IDs.
+	groups map[int]index
+
+	// langInfo
+	registry map[string]*ianaEntry
+}
+
+type index uint
+
+func newBuilder(w *gen.CodeWriter) *builder {
+	r := gen.OpenCLDRCoreZip()
+	defer r.Close()
+	d := &cldr.Decoder{}
+	data, err := d.DecodeZip(r)
+	failOnError(err)
+	b := builder{
+		w:    w,
+		hw:   io.MultiWriter(w, w.Hash),
+		data: data,
+		supp: data.Supplemental(),
+	}
+	b.parseRegistry()
+	return &b
+}
+
+func (b *builder) parseRegistry() {
+	r := gen.OpenIANAFile("assignments/language-subtag-registry")
+	defer r.Close()
+	b.registry = make(map[string]*ianaEntry)
+
+	scan := bufio.NewScanner(r)
+	scan.Split(bufio.ScanWords)
+	var record *ianaEntry
+	for more := scan.Scan(); more; {
+		key := scan.Text()
+		more = scan.Scan()
+		value := scan.Text()
+		switch key {
+		case "Type:":
+			record = &ianaEntry{typ: value}
+		case "Subtag:", "Tag:":
+			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
+				for a := s[0]; a <= s[1]; a = inc(a) {
+					b.addToRegistry(a, record)
+				}
+			} else {
+				b.addToRegistry(value, record)
+			}
+		case "Suppress-Script:":
+			record.suppressScript = value
+		case "Added:":
+			record.added = value
+		case "Deprecated:":
+			record.deprecated = value
+		case "Macrolanguage:":
+			record.macro = value
+		case "Preferred-Value:":
+			record.preferred = value
+		case "Prefix:":
+			record.prefix = append(record.prefix, value)
+		case "Scope:":
+			record.scope = value
+		case "Description:":
+			buf := []byte(value)
+			for more = scan.Scan(); more; more = scan.Scan() {
+				b := scan.Bytes()
+				if b[0] == '%' || b[len(b)-1] == ':' {
+					break
+				}
+				buf = append(buf, ' ')
+				buf = append(buf, b...)
+			}
+			record.description = append(record.description, string(buf))
+			continue
+		default:
+			continue
+		}
+		more = scan.Scan()
+	}
+	if scan.Err() != nil {
+		log.Panic(scan.Err())
+	}
+}
+
+func (b *builder) addToRegistry(key string, entry *ianaEntry) {
+	if info, ok := b.registry[key]; ok {
+		if info.typ != "language" || entry.typ != "extlang" {
+			log.Fatalf("parseRegistry: tag %q already exists", key)
+		}
+	} else {
+		b.registry[key] = entry
+	}
+}
+
+var commentIndex = make(map[string]string)
+
+func init() {
+	for _, s := range comment {
+		key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
+		commentIndex[key] = s
+	}
+}
+
+func (b *builder) comment(name string) {
+	if s := commentIndex[name]; len(s) > 0 {
+		b.w.WriteComment(s)
+	} else {
+		fmt.Fprintln(b.w)
+	}
+}
+
+func (b *builder) pf(f string, x ...interface{}) {
+	fmt.Fprintf(b.hw, f, x...)
+	fmt.Fprint(b.hw, "\n")
+}
+
+func (b *builder) p(x ...interface{}) {
+	fmt.Fprintln(b.hw, x...)
+}
+
+func (b *builder) addSize(s int) {
+	b.w.Size += s
+	b.pf("// Size: %d bytes", s)
+}
+
+func (b *builder) writeConst(name string, x interface{}) {
+	b.comment(name)
+	b.w.WriteConst(name, x)
+}
+
+// writeConsts computes f(v) for all v in values and writes the results
+// as constants named _v to a single constant block.
+func (b *builder) writeConsts(f func(string) int, values ...string) {
+	b.pf("const (")
+	for _, v := range values {
+		b.pf("\t_%s = %v", v, f(v))
+	}
+	b.pf(")")
+}
+
+// writeType writes the type of the given value, which must be a struct.
+func (b *builder) writeType(value interface{}) {
+	b.comment(reflect.TypeOf(value).Name())
+	b.w.WriteType(value)
+}
+
+func (b *builder) writeSlice(name string, ss interface{}) {
+	b.writeSliceAddSize(name, 0, ss)
+}
+
+func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
+	b.comment(name)
+	b.w.Size += extraSize
+	v := reflect.ValueOf(ss)
+	t := v.Type().Elem()
+	b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
+
+	fmt.Fprintf(b.w, "var %s = ", name)
+	b.w.WriteArray(ss)
+	b.p()
+}
+
+type FromTo struct {
+	From, To uint16
+}
+
+func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
+	ss.sortFunc(func(a, b string) bool {
+		return index(a) < index(b)
+	})
+	m := []FromTo{}
+	for _, s := range ss.s {
+		m = append(m, FromTo{index(s), index(ss.update[s])})
+	}
+	b.writeSlice(name, m)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s string) uint {
+	v := uint(0)
+	for i := 0; i < len(s); i++ {
+		v *= base
+		v += uint(s[i] - 'a')
+	}
+	return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+	for i := len(s) - 1; i >= 0; i-- {
+		s[i] = byte(v%base) + 'a'
+		v /= base
+	}
+}
+
+func (b *builder) writeBitVector(name string, ss []string) {
+	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
+	for _, s := range ss {
+		v := strToInt(s)
+		vec[v/8] |= 1 << (v % 8)
+	}
+	b.writeSlice(name, vec)
+}
+
+// TODO: convert this type into a list or two-stage trie.
+func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()))
+	for _, k := range m {
+		sz += len(k)
+	}
+	b.addSize(sz)
+	keys := []string{}
+	b.pf(`var %s = map[string]uint16{`, name)
+	for k := range m {
+		keys = append(keys, k)
+	}
+	sort.Strings(keys)
+	for _, k := range keys {
+		b.pf("\t%q: %v,", k, f(m[k]))
+	}
+	b.p("}")
+}
+
+func (b *builder) writeMap(name string, m interface{}) {
+	b.comment(name)
+	v := reflect.ValueOf(m)
+	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
+	b.addSize(sz)
+	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
+		return strings.IndexRune("{}, ", r) != -1
+	})
+	sort.Strings(f[1:])
+	b.pf(`var %s = %s{`, name, f[0])
+	for _, kv := range f[1:] {
+		b.pf("\t%s,", kv)
+	}
+	b.p("}")
+}
+
+func (b *builder) langIndex(s string) uint16 {
+	if s == "und" {
+		return 0
+	}
+	if i, ok := b.lang.find(s); ok {
+		return uint16(i)
+	}
+	return uint16(strToInt(s)) + uint16(len(b.lang.s))
+}
+
+// inc advances the string to its lexicographical successor.
+func inc(s string) string {
+	const maxTagLength = 4
+	var buf [maxTagLength]byte
+	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
+	for i := 0; i < len(s); i++ {
+		if s[i] <= 'Z' {
+			buf[i] -= 'a' - 'A'
+		}
+	}
+	return string(buf[:len(s)])
+}
+
+func (b *builder) parseIndices() {
+	meta := b.supp.Metadata
+
+	for k, v := range b.registry {
+		var ss *stringSet
+		switch v.typ {
+		case "language":
+			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
+				b.lang.add(k)
+				continue
+			} else {
+				ss = &b.langNoIndex
+			}
+		case "region":
+			ss = &b.region
+		case "script":
+			ss = &b.script
+		case "variant":
+			ss = &b.variant
+		default:
+			continue
+		}
+		ss.add(k)
+	}
+	// Include any language for which there is data.
+	for _, lang := range b.data.Locales() {
+		if x := b.data.RawLDML(lang); false ||
+			x.LocaleDisplayNames != nil ||
+			x.Characters != nil ||
+			x.Delimiters != nil ||
+			x.Measurement != nil ||
+			x.Dates != nil ||
+			x.Numbers != nil ||
+			x.Units != nil ||
+			x.ListPatterns != nil ||
+			x.Collations != nil ||
+			x.Segmentations != nil ||
+			x.Rbnf != nil ||
+			x.Annotations != nil ||
+			x.Metadata != nil {
+
+			from := strings.Split(lang, "_")
+			if lang := from[0]; lang != "root" {
+				b.lang.add(lang)
+			}
+		}
+	}
+	// Include locales for plural rules, which uses a different structure.
+	for _, plurals := range b.data.Supplemental().Plurals {
+		for _, rules := range plurals.PluralRules {
+			for _, lang := range strings.Split(rules.Locales, " ") {
+				if lang = strings.Split(lang, "_")[0]; lang != "root" {
+					b.lang.add(lang)
+				}
+			}
+		}
+	}
+	// Include languages in likely subtags.
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		b.lang.add(from[0])
+	}
+	// Include ISO-639 alpha-3 bibliographic entries.
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Reason == "bibliographic" {
+			b.langNoIndex.add(a.Type)
+		}
+	}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 {
+			b.region.add(reg.Type)
+		}
+	}
+
+	for _, s := range b.lang.s {
+		if len(s) == 3 {
+			b.langNoIndex.remove(s)
+		}
+	}
+	b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
+	b.writeConst("NumScripts", len(b.script.slice()))
+	b.writeConst("NumRegions", len(b.region.slice()))
+
+	// Add dummy codes at the start of each list to represent "unspecified".
+	b.lang.add("---")
+	b.script.add("----")
+	b.region.add("---")
+
+	// common locales
+	b.locale.parse(meta.DefaultContent.Locales)
+}
+
+// TODO: region inclusion data will probably not be use used in future matchers.
+
+func (b *builder) computeRegionGroups() {
+	b.groups = make(map[int]index)
+
+	// Create group indices.
+	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
+		b.groups[i] = index(len(b.groups))
+	}
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		if _, ok := b.groups[group]; !ok {
+			b.groups[group] = index(len(b.groups))
+		}
+	}
+	if len(b.groups) > 64 {
+		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
+	}
+	b.writeConst("nRegionGroups", len(b.groups))
+}
+
+var langConsts = []string{
+	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
+	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
+	"it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
+	"mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
+	"ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
+	"tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
+
+	// constants for grandfathered tags (if not already defined)
+	"jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
+	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
+}
+
+// writeLanguage generates all tables needed for language canonicalization.
+func (b *builder) writeLanguage() {
+	meta := b.supp.Metadata
+
+	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
+	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+	b.writeConst("langPrivateStart", b.langIndex("qaa"))
+	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
+
+	// Get language codes that need to be mapped (overlong 3-letter codes,
+	// deprecated 2-letter codes, legacy and grandfathered tags.)
+	langAliasMap := stringSet{}
+	aliasTypeMap := map[string]AliasType{}
+
+	// altLangISO3 get the alternative ISO3 names that need to be mapped.
+	altLangISO3 := stringSet{}
+	// Add dummy start to avoid the use of index 0.
+	altLangISO3.add("---")
+	altLangISO3.updateLater("---", "aa")
+
+	lang := b.lang.clone()
+	for _, a := range meta.Alias.LanguageAlias {
+		if a.Replacement == "" {
+			a.Replacement = "und"
+		}
+		// TODO: support mapping to tags
+		repl := strings.SplitN(a.Replacement, "_", 2)[0]
+		if a.Reason == "overlong" {
+			if len(a.Replacement) == 2 && len(a.Type) == 3 {
+				lang.updateLater(a.Replacement, a.Type)
+			}
+		} else if len(a.Type) <= 3 {
+			switch a.Reason {
+			case "macrolanguage":
+				aliasTypeMap[a.Type] = Macro
+			case "deprecated":
+				// handled elsewhere
+				continue
+			case "bibliographic", "legacy":
+				if a.Type == "no" {
+					continue
+				}
+				aliasTypeMap[a.Type] = Legacy
+			default:
+				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
+			}
+			langAliasMap.add(a.Type)
+			langAliasMap.updateLater(a.Type, repl)
+		}
+	}
+	// Manually add the mapping of "nb" (Norwegian) to its macro language.
+	// This can be removed if CLDR adopts this change.
+	langAliasMap.add("nb")
+	langAliasMap.updateLater("nb", "no")
+	aliasTypeMap["nb"] = Macro
+
+	for k, v := range b.registry {
+		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
+		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
+			langAliasMap.add(k)
+			langAliasMap.updateLater(k, v.preferred)
+			aliasTypeMap[k] = Deprecated
+		}
+	}
+	// Fix CLDR mappings.
+	lang.updateLater("tl", "tgl")
+	lang.updateLater("sh", "hbs")
+	lang.updateLater("mo", "mol")
+	lang.updateLater("no", "nor")
+	lang.updateLater("tw", "twi")
+	lang.updateLater("nb", "nob")
+	lang.updateLater("ak", "aka")
+	lang.updateLater("bh", "bih")
+
+	// Ensure that each 2-letter code is matched with a 3-letter code.
+	for _, v := range lang.s[1:] {
+		s, ok := lang.update[v]
+		if !ok {
+			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
+				continue
+			}
+			lang.update[v] = s
+		}
+		if v[0] != s[0] {
+			altLangISO3.add(s)
+			altLangISO3.updateLater(s, v)
+		}
+	}
+
+	// Complete canonicalized language tags.
+	lang.freeze()
+	for i, v := range lang.s {
+		// We can avoid these manual entries by using the IANA registry directly.
+		// Seems easier to update the list manually, as changes are rare.
+		// The panic in this loop will trigger if we miss an entry.
+		add := ""
+		if s, ok := lang.update[v]; ok {
+			if s[0] == v[0] {
+				add = s[1:]
+			} else {
+				add = string([]byte{0, byte(altLangISO3.index(s))})
+			}
+		} else if len(v) == 3 {
+			add = "\x00"
+		} else {
+			log.Panicf("no data for long form of %q", v)
+		}
+		lang.s[i] += add
+	}
+	b.writeConst("lang", tag.Index(lang.join()))
+
+	b.writeConst("langNoIndexOffset", len(b.lang.s))
+
+	// space of all valid 3-letter language identifiers.
+	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
+
+	altLangIndex := []uint16{}
+	for i, s := range altLangISO3.slice() {
+		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
+		if i > 0 {
+			idx := b.lang.index(altLangISO3.update[s])
+			altLangIndex = append(altLangIndex, uint16(idx))
+		}
+	}
+	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
+	b.writeSlice("altLangIndex", altLangIndex)
+
+	b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex)
+	types := make([]AliasType, len(langAliasMap.s))
+	for i, s := range langAliasMap.s {
+		types[i] = aliasTypeMap[s]
+	}
+	b.writeSlice("AliasTypes", types)
+}
+
+var scriptConsts = []string{
+	"Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
+	"Zzzz",
+}
+
+func (b *builder) writeScript() {
+	b.writeConsts(b.script.index, scriptConsts...)
+	b.writeConst("script", tag.Index(b.script.join()))
+
+	supp := make([]uint8, len(b.lang.slice()))
+	for i, v := range b.lang.slice()[1:] {
+		if sc := b.registry[v].suppressScript; sc != "" {
+			supp[i+1] = uint8(b.script.index(sc))
+		}
+	}
+	b.writeSlice("suppressScript", supp)
+
+	// There is only one deprecated script in CLDR. This value is hard-coded.
+	// We check here if the code must be updated.
+	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
+		if a.Type != "Qaai" {
+			log.Panicf("unexpected deprecated stript %q", a.Type)
+		}
+	}
+}
+
+func parseM49(s string) int16 {
+	if len(s) == 0 {
+		return 0
+	}
+	v, err := strconv.ParseUint(s, 10, 10)
+	failOnError(err)
+	return int16(v)
+}
+
+var regionConsts = []string{
+	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
+	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
+}
+
+func (b *builder) writeRegion() {
+	b.writeConsts(b.region.index, regionConsts...)
+
+	isoOffset := b.region.index("AA")
+	m49map := make([]int16, len(b.region.slice()))
+	fromM49map := make(map[int16]int)
+	altRegionISO3 := ""
+	altRegionIDs := []uint16{}
+
+	b.writeConst("isoRegionOffset", isoOffset)
+
+	// 2-letter region lookup and mapping to numeric codes.
+	regionISO := b.region.clone()
+	regionISO.s = regionISO.s[isoOffset:]
+	regionISO.sorted = false
+
+	regionTypes := make([]byte, len(b.region.s))
+
+	// Is the region valid BCP 47?
+	for s, e := range b.registry {
+		if len(s) == 2 && s == strings.ToUpper(s) {
+			i := b.region.index(s)
+			for _, d := range e.description {
+				if strings.Contains(d, "Private use") {
+					regionTypes[i] = iso3166UserAssigned
+				}
+			}
+			regionTypes[i] |= bcp47Region
+		}
+	}
+
+	// Is the region a valid ccTLD?
+	r := gen.OpenIANAFile("domains/root/db")
+	defer r.Close()
+
+	buf, err := ioutil.ReadAll(r)
+	failOnError(err)
+	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
+	for _, m := range re.FindAllSubmatch(buf, -1) {
+		i := b.region.index(strings.ToUpper(string(m[1])))
+		regionTypes[i] |= ccTLD
+	}
+
+	b.writeSlice("regionTypes", regionTypes)
+
+	iso3Set := make(map[string]int)
+	update := func(iso2, iso3 string) {
+		i := regionISO.index(iso2)
+		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
+			regionISO.s[i] += iso3[1:]
+			iso3Set[iso3] = -1
+		} else {
+			if ok && j >= 0 {
+				regionISO.s[i] += string([]byte{0, byte(j)})
+			} else {
+				iso3Set[iso3] = len(altRegionISO3)
+				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
+				altRegionISO3 += iso3
+				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		i := regionISO.index(tc.Type) + isoOffset
+		if d := m49map[i]; d != 0 {
+			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
+		}
+		m49 := parseM49(tc.Numeric)
+		m49map[i] = m49
+		if r := fromM49map[m49]; r == 0 {
+			fromM49map[m49] = i
+		} else if r != i {
+			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
+			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
+				fromM49map[m49] = i
+			}
+		}
+	}
+	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
+			from := parseM49(ta.Type)
+			if r := fromM49map[from]; r == 0 {
+				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
+			}
+		}
+	}
+	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
+		if len(tc.Alpha3) == 3 {
+			update(tc.Type, tc.Alpha3)
+		}
+	}
+	// This entries are not included in territoryCodes. Mostly 3-letter variants
+	// of deleted codes and an entry for QU.
+	for _, m := range []struct{ iso2, iso3 string }{
+		{"CT", "CTE"},
+		{"DY", "DHY"},
+		{"HV", "HVO"},
+		{"JT", "JTN"},
+		{"MI", "MID"},
+		{"NH", "NHB"},
+		{"NQ", "ATN"},
+		{"PC", "PCI"},
+		{"PU", "PUS"},
+		{"PZ", "PCZ"},
+		{"RH", "RHO"},
+		{"VD", "VDR"},
+		{"WK", "WAK"},
+		// These three-letter codes are used for others as well.
+		{"FQ", "ATF"},
+	} {
+		update(m.iso2, m.iso3)
+	}
+	for i, s := range regionISO.s {
+		if len(s) != 4 {
+			regionISO.s[i] = s + "  "
+		}
+	}
+	b.writeConst("regionISO", tag.Index(regionISO.join()))
+	b.writeConst("altRegionISO3", altRegionISO3)
+	b.writeSlice("altRegionIDs", altRegionIDs)
+
+	// Create list of deprecated regions.
+	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
+	// Transitionally-reserved mapping not included.
+	regionOldMap := stringSet{}
+	// Include regions in territoryAlias (not all are in the IANA registry!)
+	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
+		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
+			regionOldMap.add(reg.Type)
+			regionOldMap.updateLater(reg.Type, reg.Replacement)
+			i, _ := regionISO.find(reg.Type)
+			j, _ := regionISO.find(reg.Replacement)
+			if k := m49map[i+isoOffset]; k == 0 {
+				m49map[i+isoOffset] = m49map[j+isoOffset]
+			}
+		}
+	}
+	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
+		return uint16(b.region.index(s))
+	})
+	// 3-digit region lookup, groupings.
+	for i := 1; i < isoOffset; i++ {
+		m := parseM49(b.region.s[i])
+		m49map[i] = m
+		fromM49map[m] = i
+	}
+	b.writeSlice("m49", m49map)
+
+	const (
+		searchBits = 7
+		regionBits = 9
+	)
+	if len(m49map) >= 1<<regionBits {
+		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
+	}
+	m49Index := [9]int16{}
+	fromM49 := []uint16{}
+	m49 := []int{}
+	for k, _ := range fromM49map {
+		m49 = append(m49, int(k))
+	}
+	sort.Ints(m49)
+	for _, k := range m49[1:] {
+		val := (k & (1<<searchBits - 1)) << regionBits
+		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
+		m49Index[1:][k>>searchBits] = int16(len(fromM49))
+	}
+	b.writeSlice("m49Index", m49Index)
+	b.writeSlice("fromM49", fromM49)
+}
+
+const (
+	// TODO: put these lists in regionTypes as user data? Could be used for
+	// various optimizations and refinements and could be exposed in the API.
+	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
+	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
+	// DY and RH are actually not deleted, but indeterminately reserved.
+	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
+)
+
+const (
+	iso3166UserAssigned = 1 << iota
+	ccTLD
+	bcp47Region
+)
+
+func find(list []string, s string) int {
+	for i, t := range list {
+		if t == s {
+			return i
+		}
+	}
+	return -1
+}
+
+// writeVariants generates per-variant information and creates a map from variant
+// name to index value. We assign index values such that sorting multiple
+// variants by index value will result in the correct order.
+// There are two types of variants: specialized and general. Specialized variants
+// are only applicable to certain language or language-script pairs. Generalized
+// variants apply to any language. Generalized variants always sort after
+// specialized variants.  We will therefore always assign a higher index value
+// to a generalized variant than any other variant. Generalized variants are
+// sorted alphabetically among themselves.
+// Specialized variants may also sort after other specialized variants. Such
+// variants will be ordered after any of the variants they may follow.
+// We assume that if a variant x is followed by a variant y, then for any prefix
+// p of x, p-x is a prefix of y. This allows us to order tags based on the
+// maximum of the length of any of its prefixes.
+// TODO: it is possible to define a set of Prefix values on variants such that
+// a total order cannot be defined to the point that this algorithm breaks.
+// In other words, we cannot guarantee the same order of variants for the
+// future using the same algorithm or for non-compliant combinations of
+// variants. For this reason, consider using simple alphabetic sorting
+// of variants and ignore Prefix restrictions altogether.
+func (b *builder) writeVariant() {
+	generalized := stringSet{}
+	specialized := stringSet{}
+	specializedExtend := stringSet{}
+	// Collate the variants by type and check assumptions.
+	for _, v := range b.variant.slice() {
+		e := b.registry[v]
+		if len(e.prefix) == 0 {
+			generalized.add(v)
+			continue
+		}
+		c := strings.Split(e.prefix[0], "-")
+		hasScriptOrRegion := false
+		if len(c) > 1 {
+			_, hasScriptOrRegion = b.script.find(c[1])
+			if !hasScriptOrRegion {
+				_, hasScriptOrRegion = b.region.find(c[1])
+
+			}
+		}
+		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
+			// Variant is preceded by a language.
+			specialized.add(v)
+			continue
+		}
+		// Variant is preceded by another variant.
+		specializedExtend.add(v)
+		prefix := c[0] + "-"
+		if hasScriptOrRegion {
+			prefix += c[1]
+		}
+		for _, p := range e.prefix {
+			// Verify that the prefix minus the last element is a prefix of the
+			// predecessor element.
+			i := strings.LastIndex(p, "-")
+			pred := b.registry[p[i+1:]]
+			if find(pred.prefix, p[:i]) < 0 {
+				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
+			}
+			// The sorting used below does not work in the general case. It works
+			// if we assume that variants that may be followed by others only have
+			// prefixes of the same length. Verify this.
+			count := strings.Count(p[:i], "-")
+			for _, q := range pred.prefix {
+				if c := strings.Count(q, "-"); c != count {
+					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
+				}
+			}
+			if !strings.HasPrefix(p, prefix) {
+				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
+			}
+		}
+	}
+
+	// Sort extended variants.
+	a := specializedExtend.s
+	less := func(v, w string) bool {
+		// Sort by the maximum number of elements.
+		maxCount := func(s string) (max int) {
+			for _, p := range b.registry[s].prefix {
+				if c := strings.Count(p, "-"); c > max {
+					max = c
+				}
+			}
+			return
+		}
+		if cv, cw := maxCount(v), maxCount(w); cv != cw {
+			return cv < cw
+		}
+		// Sort by name as tie breaker.
+		return v < w
+	}
+	sort.Sort(funcSorter{less, sort.StringSlice(a)})
+	specializedExtend.frozen = true
+
+	// Create index from variant name to index.
+	variantIndex := make(map[string]uint8)
+	add := func(s []string) {
+		for _, v := range s {
+			variantIndex[v] = uint8(len(variantIndex))
+		}
+	}
+	add(specialized.slice())
+	add(specializedExtend.s)
+	numSpecialized := len(variantIndex)
+	add(generalized.slice())
+	if n := len(variantIndex); n > 255 {
+		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
+	}
+	b.writeMap("variantIndex", variantIndex)
+	b.writeConst("variantNumSpecialized", numSpecialized)
+}
+
+func (b *builder) writeLanguageInfo() {
+}
+
+// writeLikelyData writes tables that are used both for finding parent relations and for
+// language matching.  Each entry contains additional bits to indicate the status of the
+// data to know when it cannot be used for parent relations.
+func (b *builder) writeLikelyData() {
+	const (
+		isList = 1 << iota
+		scriptInFrom
+		regionInFrom
+	)
+	type ( // generated types
+		likelyScriptRegion struct {
+			region uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangScript struct {
+			lang   uint16
+			script uint8
+			flags  uint8
+		}
+		likelyLangRegion struct {
+			lang   uint16
+			region uint16
+		}
+		// likelyTag is used for getting likely tags for group regions, where
+		// the likely region might be a region contained in the group.
+		likelyTag struct {
+			lang   uint16
+			region uint16
+			script uint8
+		}
+	)
+	var ( // generated variables
+		likelyRegionGroup = make([]likelyTag, len(b.groups))
+		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
+		likelyRegion      = make([]likelyLangScript, len(b.region.s))
+		likelyScript      = make([]likelyLangRegion, len(b.script.s))
+		likelyLangList    = []likelyScriptRegion{}
+		likelyRegionList  = []likelyLangScript{}
+	)
+	type fromTo struct {
+		from, to []string
+	}
+	langToOther := map[int][]fromTo{}
+	regionToOther := map[int][]fromTo{}
+	for _, m := range b.supp.LikelySubtags.LikelySubtag {
+		from := strings.Split(m.From, "_")
+		to := strings.Split(m.To, "_")
+		if len(to) != 3 {
+			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
+		}
+		if len(from) > 3 {
+			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
+		}
+		if from[0] != to[0] && from[0] != "und" {
+			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
+		}
+		if len(from) == 3 {
+			if from[2] != to[2] {
+				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
+			}
+			if from[0] != "und" {
+				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
+			}
+		}
+		if len(from) == 1 || from[0] != "und" {
+			id := 0
+			if from[0] != "und" {
+				id = b.lang.index(from[0])
+			}
+			langToOther[id] = append(langToOther[id], fromTo{from, to})
+		} else if len(from) == 2 && len(from[1]) == 4 {
+			sid := b.script.index(from[1])
+			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
+			likelyScript[sid].region = uint16(b.region.index(to[2]))
+		} else {
+			r := b.region.index(from[len(from)-1])
+			if id, ok := b.groups[r]; ok {
+				if from[0] != "und" {
+					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
+				}
+				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
+				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
+				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
+			} else {
+				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
+			}
+		}
+	}
+	b.writeType(likelyLangRegion{})
+	b.writeSlice("likelyScript", likelyScript)
+
+	for id := range b.lang.s {
+		list := langToOther[id]
+		if len(list) == 1 {
+			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
+			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
+		} else if len(list) > 1 {
+			likelyLang[id].flags = isList
+			likelyLang[id].region = uint16(len(likelyLangList))
+			likelyLang[id].script = uint8(len(list))
+			for _, x := range list {
+				flags := uint8(0)
+				if len(x.from) > 1 {
+					if x.from[1] == x.to[2] {
+						flags = regionInFrom
+					} else {
+						flags = scriptInFrom
+					}
+				}
+				likelyLangList = append(likelyLangList, likelyScriptRegion{
+					region: uint16(b.region.index(x.to[2])),
+					script: uint8(b.script.index(x.to[1])),
+					flags:  flags,
+				})
+			}
+		}
+	}
+	// TODO: merge suppressScript data with this table.
+	b.writeType(likelyScriptRegion{})
+	b.writeSlice("likelyLang", likelyLang)
+	b.writeSlice("likelyLangList", likelyLangList)
+
+	for id := range b.region.s {
+		list := regionToOther[id]
+		if len(list) == 1 {
+			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
+			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
+			if len(list[0].from) > 2 {
+				likelyRegion[id].flags = scriptInFrom
+			}
+		} else if len(list) > 1 {
+			likelyRegion[id].flags = isList
+			likelyRegion[id].lang = uint16(len(likelyRegionList))
+			likelyRegion[id].script = uint8(len(list))
+			for i, x := range list {
+				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
+					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
+				}
+				x := likelyLangScript{
+					lang:   uint16(b.langIndex(x.to[0])),
+					script: uint8(b.script.index(x.to[1])),
+				}
+				if len(list[0].from) > 2 {
+					x.flags = scriptInFrom
+				}
+				likelyRegionList = append(likelyRegionList, x)
+			}
+		}
+	}
+	b.writeType(likelyLangScript{})
+	b.writeSlice("likelyRegion", likelyRegion)
+	b.writeSlice("likelyRegionList", likelyRegionList)
+
+	b.writeType(likelyTag{})
+	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+}
+
+func (b *builder) writeRegionInclusionData() {
+	var (
+		// mm holds for each group the set of groups with a distance of 1.
+		mm = make(map[int][]index)
+
+		// containment holds for each group the transitive closure of
+		// containment of other groups.
+		containment = make(map[index][]index)
+	)
+	for _, g := range b.supp.TerritoryContainment.Group {
+		// Skip UN and EURO zone as they are flattening the containment
+		// relationship.
+		if g.Type == "EZ" || g.Type == "UN" {
+			continue
+		}
+		group := b.region.index(g.Type)
+		groupIdx := b.groups[group]
+		for _, mem := range strings.Split(g.Contains, " ") {
+			r := b.region.index(mem)
+			mm[r] = append(mm[r], groupIdx)
+			if g, ok := b.groups[r]; ok {
+				mm[group] = append(mm[group], g)
+				containment[groupIdx] = append(containment[groupIdx], g)
+			}
+		}
+	}
+
+	regionContainment := make([]uint64, len(b.groups))
+	for _, g := range b.groups {
+		l := containment[g]
+
+		// Compute the transitive closure of containment.
+		for i := 0; i < len(l); i++ {
+			l = append(l, containment[l[i]]...)
+		}
+
+		// Compute the bitmask.
+		regionContainment[g] = 1 << g
+		for _, v := range l {
+			regionContainment[g] |= 1 << v
+		}
+	}
+	b.writeSlice("regionContainment", regionContainment)
+
+	regionInclusion := make([]uint8, len(b.region.s))
+	bvs := make(map[uint64]index)
+	// Make the first bitvector positions correspond with the groups.
+	for r, i := range b.groups {
+		bv := uint64(1 << i)
+		for _, g := range mm[r] {
+			bv |= 1 << g
+		}
+		bvs[bv] = i
+		regionInclusion[r] = uint8(bvs[bv])
+	}
+	for r := 1; r < len(b.region.s); r++ {
+		if _, ok := b.groups[r]; !ok {
+			bv := uint64(0)
+			for _, g := range mm[r] {
+				bv |= 1 << g
+			}
+			if bv == 0 {
+				// Pick the world for unspecified regions.
+				bv = 1 << b.groups[b.region.index("001")]
+			}
+			if _, ok := bvs[bv]; !ok {
+				bvs[bv] = index(len(bvs))
+			}
+			regionInclusion[r] = uint8(bvs[bv])
+		}
+	}
+	b.writeSlice("regionInclusion", regionInclusion)
+	regionInclusionBits := make([]uint64, len(bvs))
+	for k, v := range bvs {
+		regionInclusionBits[v] = uint64(k)
+	}
+	// Add bit vectors for increasingly large distances until a fixed point is reached.
+	regionInclusionNext := []uint8{}
+	for i := 0; i < len(regionInclusionBits); i++ {
+		bits := regionInclusionBits[i]
+		next := bits
+		for i := uint(0); i < uint(len(b.groups)); i++ {
+			if bits&(1<<i) != 0 {
+				next |= regionInclusionBits[i]
+			}
+		}
+		if _, ok := bvs[next]; !ok {
+			bvs[next] = index(len(bvs))
+			regionInclusionBits = append(regionInclusionBits, next)
+		}
+		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
+	}
+	b.writeSlice("regionInclusionBits", regionInclusionBits)
+	b.writeSlice("regionInclusionNext", regionInclusionNext)
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+func (b *builder) writeParents() {
+	b.writeType(parentRel{})
+
+	parents := []parentRel{}
+
+	// Construct parent overrides.
+	n := 0
+	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
+		// Skipping non-standard scripts to root is implemented using addTags.
+		if p.Parent == "root" {
+			continue
+		}
+
+		sub := strings.Split(p.Parent, "_")
+		parent := parentRel{lang: b.langIndex(sub[0])}
+		if len(sub) == 2 {
+			// TODO: check that all undefined scripts are indeed Latn in these
+			// cases.
+			parent.maxScript = uint8(b.script.index("Latn"))
+			parent.toRegion = uint16(b.region.index(sub[1]))
+		} else {
+			parent.script = uint8(b.script.index(sub[1]))
+			parent.maxScript = parent.script
+			parent.toRegion = uint16(b.region.index(sub[2]))
+		}
+		for _, c := range strings.Split(p.Locales, " ") {
+			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
+			parent.fromRegion = append(parent.fromRegion, uint16(region))
+		}
+		parents = append(parents, parent)
+		n += len(parent.fromRegion)
+	}
+	b.writeSliceAddSize("parents", n*2, parents)
+}
+
+func main() {
+	gen.Init()
+
+	gen.Repackage("gen_common.go", "common.go", "language")
+
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "language")
+
+	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
+
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
+
+	b.parseIndices()
+	b.writeType(FromTo{})
+	b.writeLanguage()
+	b.writeScript()
+	b.writeRegion()
+	b.writeVariant()
+	// TODO: b.writeLocale()
+	b.computeRegionGroups()
+	b.writeLikelyData()
+	b.writeRegionInclusionData()
+	b.writeParents()
+}
diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/internal/language/gen_common.go
similarity index 60%
rename from vendor/golang.org/x/text/language/gen_common.go
rename to vendor/golang.org/x/text/internal/language/gen_common.go
index 83ce180..c419cee 100644
--- a/vendor/golang.org/x/text/language/gen_common.go
+++ b/vendor/golang.org/x/text/internal/language/gen_common.go
@@ -8,13 +8,13 @@ package main
 
 // This file contains code common to the maketables.go and the package code.
 
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
 
 const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
+	Deprecated AliasType = iota
+	Macro
+	Legacy
 
-	langAliasTypeUnknown langAliasType = -1
+	AliasTypeUnknown AliasType = -1
 )
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 0000000..1e74d1a
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,596 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+	"errors"
+	"fmt"
+	"strings"
+)
+
+const (
+	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
+	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+	maxCoreSize = 12
+
+	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+	// is large enough to hold at least 99% of the BCP 47 tags.
+	max99thPercentileSize = 32
+
+	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
+	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+	maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+	// TODO: the following fields have the form TagTypeID. This name is chosen
+	// to allow refactoring the public package without conflicting with its
+	// Base, Script, and Region methods. Once the transition is fully completed
+	// the ID can be stripped from the name.
+
+	LangID   Language
+	RegionID Region
+	// TODO: we will soon run out of positions for ScriptID. Idea: instead of
+	// storing lang, region, and ScriptID codes, store only the compact index and
+	// have a lookup table from this code to its expansion. This greatly speeds
+	// up table lookup, speed up common variant cases.
+	// This will also immediately free up 3 extra bytes. Also, the pVariant
+	// field can now be moved to the lookup table, as the compact index uniquely
+	// determines the offset of a possible variant.
+	ScriptID Script
+	pVariant byte   // offset in str, includes preceding '-'
+	pExt     uint16 // offset of first extension, includes preceding '-'
+
+	// str is the string representation of the Tag. It will only be used if the
+	// tag has variants or extensions.
+	str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+	t, _ := Parse(s)
+	return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+	return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+	return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+	if int(t.pVariant) < len(t.str) {
+		return false
+	}
+	return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+	return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+	if t.str == "" {
+		return
+	}
+	extra := t.str[t.pVariant:]
+	if t.pVariant > 0 {
+		extra = extra[1:]
+	}
+	if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+		t.str = extra
+		t.pVariant = 0
+		t.pExt = 0
+		return
+	}
+	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+	b := buf[:t.genCoreBytes(buf[:])]
+	if extra != "" {
+		diff := len(b) - int(t.pVariant)
+		b = append(b, '-')
+		b = append(b, extra...)
+		t.pVariant = uint8(int(t.pVariant) + diff)
+		t.pExt = uint16(int(t.pExt) + diff)
+	} else {
+		t.pVariant = uint8(len(b))
+		t.pExt = uint16(len(b))
+	}
+	t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+	n := t.LangID.StringToBuf(buf[:])
+	if t.ScriptID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.ScriptID.String())
+	}
+	if t.RegionID != 0 {
+		n += copy(buf[n:], "-")
+		n += copy(buf[n:], t.RegionID.String())
+	}
+	return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+	if t.str != "" {
+		return t.str
+	}
+	if t.ScriptID == 0 && t.RegionID == 0 {
+		return t.LangID.String()
+	}
+	buf := [maxCoreSize]byte{}
+	return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+	if t.str != "" {
+		text = append(text, t.str...)
+	} else if t.ScriptID == 0 && t.RegionID == 0 {
+		text = append(text, t.LangID.String()...)
+	} else {
+		buf := [maxCoreSize]byte{}
+		text = buf[:t.genCoreBytes(buf[:])]
+	}
+	return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+	tag, err := Parse(string(text))
+	*t = tag
+	return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+	if t.pVariant == 0 {
+		return ""
+	}
+	return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+	if t.pExt > 0 {
+		return t.str[t.pVariant:t.pExt]
+	}
+	return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+	return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+	if t.str != "" {
+		// Strip the variants and extensions.
+		b, s, r := t.Raw()
+		t = Tag{LangID: b, ScriptID: s, RegionID: r}
+		if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID == t.ScriptID {
+				return Tag{LangID: t.LangID}
+			}
+		}
+		return t
+	}
+	if t.LangID != 0 {
+		if t.RegionID != 0 {
+			maxScript := t.ScriptID
+			if maxScript == 0 {
+				max, _ := addTags(t)
+				maxScript = max.ScriptID
+			}
+
+			for i := range parents {
+				if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+					for _, r := range parents[i].fromRegion {
+						if Region(r) == t.RegionID {
+							return Tag{
+								LangID:   t.LangID,
+								ScriptID: Script(parents[i].script),
+								RegionID: Region(parents[i].toRegion),
+							}
+						}
+					}
+				}
+			}
+
+			// Strip the script if it is the default one.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != maxScript {
+				return Tag{LangID: t.LangID, ScriptID: maxScript}
+			}
+			return Tag{LangID: t.LangID}
+		} else if t.ScriptID != 0 {
+			// The parent for an base-script pair with a non-default script is
+			// "und" instead of the base language.
+			base, _ := addTags(Tag{LangID: t.LangID})
+			if base.ScriptID != t.ScriptID {
+				return Und
+			}
+			return Tag{LangID: t.LangID}
+		}
+	}
+	return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+	scan := makeScannerString(s)
+	var end int
+	if n := len(scan.token); n != 1 {
+		return "", ErrSyntax
+	}
+	scan.toLower(0, len(scan.b))
+	end = parseExtension(&scan)
+	if end != len(s) {
+		return "", ErrSyntax
+	}
+	return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+	return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+	return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		if ext[0] == x {
+			return ext, true
+		}
+	}
+	return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+	e := []string{}
+	for i := int(t.pExt); i < len(t.str)-1; {
+		var ext string
+		i, ext = getExtension(t.str, i)
+		e = append(e, ext)
+	}
+	return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+	if start, end, _ := t.findTypeForKey(key); end != start {
+		return t.str[start:end]
+	}
+	return ""
+}
+
+var (
+	errPrivateUse       = errors.New("cannot set a key on a private use tag")
+	errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+	if t.IsPrivateUse() {
+		return t, errPrivateUse
+	}
+	if len(key) != 2 {
+		return t, errInvalidArguments
+	}
+
+	// Remove the setting if value is "".
+	if value == "" {
+		start, end, _ := t.findTypeForKey(key)
+		if start != end {
+			// Remove key tag and leading '-'.
+			start -= 4
+
+			// Remove a possible empty extension.
+			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+				start -= 2
+			}
+			if start == int(t.pVariant) && end == len(t.str) {
+				t.str = ""
+				t.pVariant, t.pExt = 0, 0
+			} else {
+				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+			}
+		}
+		return t, nil
+	}
+
+	if len(value) < 3 || len(value) > 8 {
+		return t, errInvalidArguments
+	}
+
+	var (
+		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
+		uStart int // start of the -u extension.
+	)
+
+	// Generate the tag string if needed.
+	if t.str == "" {
+		uStart = t.genCoreBytes(buf[:])
+		buf[uStart] = '-'
+		uStart++
+	}
+
+	// Create new key-type pair and parse it to verify.
+	b := buf[uStart:]
+	copy(b, "u-")
+	copy(b[2:], key)
+	b[4] = '-'
+	b = b[:5+copy(b[5:], value)]
+	scan := makeScanner(b)
+	if parseExtensions(&scan); scan.err != nil {
+		return t, scan.err
+	}
+
+	// Assemble the replacement string.
+	if t.str == "" {
+		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+		t.str = string(buf[:uStart+len(b)])
+	} else {
+		s := t.str
+		start, end, hasExt := t.findTypeForKey(key)
+		if start == end {
+			if hasExt {
+				b = b[2:]
+			}
+			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+		} else {
+			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+		}
+	}
+	return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+	p := int(t.pExt)
+	if len(key) != 2 || p == len(t.str) || p == 0 {
+		return p, p, false
+	}
+	s := t.str
+
+	// Find the correct extension.
+	for p++; s[p] != 'u'; p++ {
+		if s[p] > 'u' {
+			p--
+			return p, p, false
+		}
+		if p = nextExtension(s, p); p == len(s) {
+			return len(s), len(s), false
+		}
+	}
+	// Proceed to the hyphen following the extension name.
+	p++
+
+	// curKey is the key currently being processed.
+	curKey := ""
+
+	// Iterate over keys until we get the end of a section.
+	for {
+		// p points to the hyphen preceding the current token.
+		if p3 := p + 3; s[p3] == '-' {
+			// Found a key.
+			// Check whether we just processed the key that was requested.
+			if curKey == key {
+				return start, p, true
+			}
+			// Set to the next key and continue scanning type tokens.
+			curKey = s[p+1 : p3]
+			if curKey > key {
+				return p, p, true
+			}
+			// Start of the type token sequence.
+			start = p + 4
+			// A type is at least 3 characters long.
+			p += 7 // 4 + 3
+		} else {
+			// Attribute or type, which is at least 3 characters long.
+			p += 4
+		}
+		// p points past the third character of a type or attribute.
+		max := p + 5 // maximum length of token plus hyphen.
+		if len(s) < max {
+			max = len(s)
+		}
+		for ; p < max && s[p] != '-'; p++ {
+		}
+		// Bail if we have exhausted all tokens or if the next token starts
+		// a new extension.
+		if p == len(s) || s[p+2] == '-' {
+			if curKey == key {
+				return start, p, true
+			}
+			return p, p, true
+		}
+	}
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Language, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+	if len(s) != 4 {
+		return 0, ErrSyntax
+	}
+	var buf [4]byte
+	return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+	return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+	if n := len(s); n < 2 || 3 < n {
+		return 0, ErrSyntax
+	}
+	var buf [3]byte
+	return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+	if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+		return false
+	}
+	return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+	if r == 0 {
+		return false
+	}
+	return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+	if r == c {
+		return true
+	}
+	g := regionInclusion[r]
+	if g >= nRegionGroups {
+		return false
+	}
+	m := regionContainment[g]
+
+	d := regionInclusion[c]
+	b := regionInclusionBits[d]
+
+	// A contained country may belong to multiple disjoint groups. Matching any
+	// of these indicates containment. If the contained region is a group, it
+	// must strictly be a subset.
+	if d >= nRegionGroups {
+		return b&m != 0
+	}
+	return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+	// difference between ISO 3166-1 and IANA ccTLD.
+	if r == _GB {
+		r = _UK
+	}
+	if (r.typ() & ccTLD) == 0 {
+		return 0, errNoTLD
+	}
+	return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+	if cr := normRegion(r); cr != 0 {
+		return cr
+	}
+	return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+	ID  uint8
+	str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+	s = strings.ToLower(s)
+	if id, ok := variantIndex[s]; ok {
+		return Variant{id, s}, nil
+	}
+	return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+	return v.str
+}
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
similarity index 80%
rename from vendor/golang.org/x/text/language/lookup.go
rename to vendor/golang.org/x/text/internal/language/lookup.go
index 1d80ac3..6294b81 100644
--- a/vendor/golang.org/x/text/language/lookup.go
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -17,11 +17,11 @@ import (
 // if it could not be found.
 func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
 	if !tag.FixCase(form, key) {
-		return 0, errSyntax
+		return 0, ErrSyntax
 	}
 	i := idx.Index(key)
 	if i == -1 {
-		return 0, mkErrInvalid(key)
+		return 0, NewValueError(key)
 	}
 	return i, nil
 }
@@ -32,38 +32,45 @@ func searchUint(imap []uint16, key uint16) int {
 	})
 }
 
-type langID uint16
+type Language uint16
 
 // getLangID returns the langID of s if s is a canonical subtag
 // or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
+func getLangID(s []byte) (Language, error) {
 	if len(s) == 2 {
 		return getLangISO2(s)
 	}
 	return getLangISO3(s)
 }
 
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+	return normLang(id)
+}
+
 // mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
-	k := sort.Search(len(langAliasMap), func(i int) bool {
-		return langAliasMap[i].from >= uint16(id)
+func normLang(id Language) (Language, AliasType) {
+	k := sort.Search(len(AliasMap), func(i int) bool {
+		return AliasMap[i].From >= uint16(id)
 	})
-	if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
-		return langID(langAliasMap[k].to), langAliasTypes[k]
+	if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+		return Language(AliasMap[k].To), AliasTypes[k]
 	}
-	return id, langAliasTypeUnknown
+	return id, AliasTypeUnknown
 }
 
 // getLangISO2 returns the langID for the given 2-letter ISO language code
 // or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
+func getLangISO2(s []byte) (Language, error) {
 	if !tag.FixCase("zz", s) {
-		return 0, errSyntax
+		return 0, ErrSyntax
 	}
 	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
-		return langID(i), nil
+		return Language(i), nil
 	}
-	return 0, mkErrInvalid(s)
+	return 0, NewValueError(s)
 }
 
 const base = 'z' - 'a' + 1
@@ -88,7 +95,7 @@ func intToStr(v uint, s []byte) {
 
 // getLangISO3 returns the langID for the given 3-letter ISO language code
 // or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
+func getLangISO3(s []byte) (Language, error) {
 	if tag.FixCase("und", s) {
 		// first try to match canonical 3-letter entries
 		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
@@ -96,7 +103,7 @@ func getLangISO3(s []byte) (langID, error) {
 				// We treat "und" as special and always translate it to "unspecified".
 				// Note that ZZ and Zzzz are private use and are not treated as
 				// unspecified by default.
-				id := langID(i)
+				id := Language(i)
 				if id == nonCanonicalUnd {
 					return 0, nil
 				}
@@ -104,26 +111,26 @@ func getLangISO3(s []byte) (langID, error) {
 			}
 		}
 		if i := altLangISO3.Index(s); i != -1 {
-			return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+			return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
 		}
 		n := strToInt(s)
 		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
-			return langID(n) + langNoIndexOffset, nil
+			return Language(n) + langNoIndexOffset, nil
 		}
 		// Check for non-canonical uses of ISO3.
 		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
 			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return langID(i), nil
+				return Language(i), nil
 			}
 		}
-		return 0, mkErrInvalid(s)
+		return 0, NewValueError(s)
 	}
-	return 0, errSyntax
+	return 0, ErrSyntax
 }
 
-// stringToBuf writes the string to b and returns the number of bytes
+// StringToBuf writes the string to b and returns the number of bytes
 // written.  cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
+func (id Language) StringToBuf(b []byte) int {
 	if id >= langNoIndexOffset {
 		intToStr(uint(id)-langNoIndexOffset, b[:3])
 		return 3
@@ -140,7 +147,7 @@ func (id langID) stringToBuf(b []byte) int {
 // String returns the BCP 47 representation of the langID.
 // Use b as variable name, instead of id, to ensure the variable
 // used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
+func (b Language) String() string {
 	if b == 0 {
 		return "und"
 	} else if b >= langNoIndexOffset {
@@ -157,7 +164,7 @@ func (b langID) String() string {
 }
 
 // ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
+func (b Language) ISO3() string {
 	if b == 0 || b >= langNoIndexOffset {
 		return b.String()
 	}
@@ -173,15 +180,24 @@ func (b langID) ISO3() string {
 }
 
 // IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
+func (b Language) IsPrivateUse() bool {
 	return langPrivateStart <= b && b <= langPrivateEnd
 }
 
-type regionID uint16
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+	if b < langNoIndexOffset {
+		return Script(suppressScript[b])
+	}
+	return 0
+}
+
+type Region uint16
 
 // getRegionID returns the region id for s if s is a valid 2-letter region code
 // or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
+func getRegionID(s []byte) (Region, error) {
 	if len(s) == 3 {
 		if isAlpha(s[0]) {
 			return getRegionISO3(s)
@@ -195,34 +211,34 @@ func getRegionID(s []byte) (regionID, error) {
 
 // getRegionISO2 returns the regionID for the given 2-letter ISO country code
 // or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
+func getRegionISO2(s []byte) (Region, error) {
 	i, err := findIndex(regionISO, s, "ZZ")
 	if err != nil {
 		return 0, err
 	}
-	return regionID(i) + isoRegionOffset, nil
+	return Region(i) + isoRegionOffset, nil
 }
 
 // getRegionISO3 returns the regionID for the given 3-letter ISO country code
 // or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
+func getRegionISO3(s []byte) (Region, error) {
 	if tag.FixCase("ZZZ", s) {
 		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
 			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return regionID(i) + isoRegionOffset, nil
+				return Region(i) + isoRegionOffset, nil
 			}
 		}
 		for i := 0; i < len(altRegionISO3); i += 3 {
 			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
-				return regionID(altRegionIDs[i/3]), nil
+				return Region(altRegionIDs[i/3]), nil
 			}
 		}
-		return 0, mkErrInvalid(s)
+		return 0, NewValueError(s)
 	}
-	return 0, errSyntax
+	return 0, ErrSyntax
 }
 
-func getRegionM49(n int) (regionID, error) {
+func getRegionM49(n int) (Region, error) {
 	if 0 < n && n <= 999 {
 		const (
 			searchBits = 7
@@ -236,7 +252,7 @@ func getRegionM49(n int) (regionID, error) {
 			return buf[i] >= val
 		})
 		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
-			return regionID(r & regionMask), nil
+			return Region(r & regionMask), nil
 		}
 	}
 	var e ValueError
@@ -247,13 +263,13 @@ func getRegionM49(n int) (regionID, error) {
 // normRegion returns a region if r is deprecated or 0 otherwise.
 // TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
 // TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
+func normRegion(r Region) Region {
 	m := regionOldMap
 	k := sort.Search(len(m), func(i int) bool {
-		return m[i].from >= uint16(r)
+		return m[i].From >= uint16(r)
 	})
-	if k < len(m) && m[k].from == uint16(r) {
-		return regionID(m[k].to)
+	if k < len(m) && m[k].From == uint16(r) {
+		return Region(m[k].To)
 	}
 	return 0
 }
@@ -264,13 +280,13 @@ const (
 	bcp47Region
 )
 
-func (r regionID) typ() byte {
+func (r Region) typ() byte {
 	return regionTypes[r]
 }
 
 // String returns the BCP 47 representation for the region.
 // It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
+func (r Region) String() string {
 	if r < isoRegionOffset {
 		if r == 0 {
 			return "ZZ"
@@ -284,7 +300,7 @@ func (r regionID) String() string {
 // ISO3 returns the 3-letter ISO code of r.
 // Note that not all regions have a 3-letter ISO code.
 // In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
+func (r Region) ISO3() string {
 	if r < isoRegionOffset {
 		return "ZZZ"
 	}
@@ -301,29 +317,29 @@ func (r regionID) ISO3() string {
 
 // M49 returns the UN M.49 encoding of r, or 0 if this encoding
 // is not defined for r.
-func (r regionID) M49() int {
+func (r Region) M49() int {
 	return int(m49[r])
 }
 
 // IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
 // may include private-use tags that are assigned by CLDR and used in this
 // implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
+func (r Region) IsPrivateUse() bool {
 	return r.typ()&iso3166UserAssigned != 0
 }
 
-type scriptID uint8
+type Script uint8
 
 // getScriptID returns the script id for string s. It assumes that s
 // is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
 	i, err := findIndex(idx, s, "Zzzz")
-	return scriptID(i), err
+	return Script(i), err
 }
 
 // String returns the script code in title case.
 // It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
+func (s Script) String() string {
 	if s == 0 {
 		return "Zzzz"
 	}
@@ -331,7 +347,7 @@ func (s scriptID) String() string {
 }
 
 // IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
+func (s Script) IsPrivateUse() bool {
 	return _Qaaa <= s && s <= _Qabx
 }
 
@@ -389,7 +405,7 @@ func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
 		if v < 0 {
 			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
 		}
-		t.lang = langID(v)
+		t.LangID = Language(v)
 		return t, true
 	}
 	return t, false
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 0000000..75a2dbc
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+	isList = 1 << iota
+	scriptInFrom
+	regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+	if t.LangID == 0 {
+		t.LangID = id
+	}
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+	if t.ScriptID == 0 {
+		t.ScriptID = id
+	}
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+	if t.RegionID == 0 || t.RegionID.Contains(id) {
+		t.RegionID = id
+	}
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+	id, err := addTags(t)
+	if err != nil {
+		return t, err
+	} else if id.equalTags(t) {
+		return t, nil
+	}
+	id.RemakeString()
+	return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+	if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+		x := likelyRegionGroup[i]
+		if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+			t.RegionID = Region(x.region)
+		}
+		return true
+	}
+	return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+	return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+	// We leave private use identifiers alone.
+	if t.IsPrivateUse() {
+		return t, nil
+	}
+	if t.ScriptID != 0 && t.RegionID != 0 {
+		if t.LangID != 0 {
+			// already fully specified
+			specializeRegion(&t)
+			return t, nil
+		}
+		// Search matches for und-script-region. Note that for these cases
+		// region will never be a group so there is no need to check for this.
+		list := likelyRegion[t.RegionID : t.RegionID+1]
+		if x := list[0]; x.flags&isList != 0 {
+			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+		}
+		for _, x := range list {
+			// Deviating from the spec. See match_test.go for details.
+			if Script(x.script) == t.ScriptID {
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+	}
+	if t.LangID != 0 {
+		// Search matches for lang-script and lang-region, where lang != und.
+		if t.LangID < langNoIndexOffset {
+			x := likelyLang[t.LangID]
+			if x.flags&isList != 0 {
+				list := likelyLangList[x.region : x.region+uint16(x.script)]
+				if t.ScriptID != 0 {
+					for _, x := range list {
+						if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+							t.setUndefinedRegion(Region(x.region))
+							return t, nil
+						}
+					}
+				} else if t.RegionID != 0 {
+					count := 0
+					goodScript := true
+					tt := t
+					for _, x := range list {
+						// We visit all entries for which the script was not
+						// defined, including the ones where the region was not
+						// defined. This allows for proper disambiguation within
+						// regions.
+						if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+							tt.RegionID = Region(x.region)
+							tt.setUndefinedScript(Script(x.script))
+							goodScript = goodScript && tt.ScriptID == Script(x.script)
+							count++
+						}
+					}
+					if count == 1 {
+						return tt, nil
+					}
+					// Even if we fail to find a unique Region, we might have
+					// an unambiguous script.
+					if goodScript {
+						t.ScriptID = tt.ScriptID
+					}
+				}
+			}
+		}
+	} else {
+		// Search matches for und-script.
+		if t.ScriptID != 0 {
+			x := likelyScript[t.ScriptID]
+			if x.region != 0 {
+				t.setUndefinedRegion(Region(x.region))
+				t.setUndefinedLang(Language(x.lang))
+				return t, nil
+			}
+		}
+		// Search matches for und-region. If und-script-region exists, it would
+		// have been found earlier.
+		if t.RegionID != 0 {
+			if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+				x := likelyRegionGroup[i]
+				if x.region != 0 {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					t.RegionID = Region(x.region)
+				}
+			} else {
+				x := likelyRegion[t.RegionID]
+				if x.flags&isList != 0 {
+					x = likelyRegionList[x.lang]
+				}
+				if x.script != 0 && x.flags != scriptInFrom {
+					t.setUndefinedLang(Language(x.lang))
+					t.setUndefinedScript(Script(x.script))
+					return t, nil
+				}
+			}
+		}
+	}
+
+	// Search matches for lang.
+	if t.LangID < langNoIndexOffset {
+		x := likelyLang[t.LangID]
+		if x.flags&isList != 0 {
+			x = likelyLangList[x.region]
+		}
+		if x.region != 0 {
+			t.setUndefinedScript(Script(x.script))
+			t.setUndefinedRegion(Region(x.region))
+		}
+		specializeRegion(&t)
+		if t.LangID == 0 {
+			t.LangID = _en // default language
+		}
+		return t, nil
+	}
+	return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+	t.LangID = id.LangID
+	t.ScriptID = id.ScriptID
+	t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+	t, err := minimizeTags(t)
+	if err != nil {
+		return t, err
+	}
+	t.RemakeString()
+	return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+	if t.equalTags(Und) {
+		return t, nil
+	}
+	max, err := addTags(t)
+	if err != nil {
+		return t, err
+	}
+	for _, id := range [...]Tag{
+		{LangID: t.LangID},
+		{LangID: t.LangID, RegionID: t.RegionID},
+		{LangID: t.LangID, ScriptID: t.ScriptID},
+	} {
+		if x, err := addTags(id); err == nil && max.equalTags(x) {
+			t.setTagsFrom(id)
+			break
+		}
+	}
+	return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 0000000..2be83e1
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,594 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+	"bytes"
+	"errors"
+	"fmt"
+	"sort"
+
+	"golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+	return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+	for _, c := range s {
+		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+			return false
+		}
+	}
+	return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+	v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+	var e ValueError
+	copy(e.v[:], tag)
+	return e
+}
+
+func (e ValueError) tag() []byte {
+	n := bytes.IndexByte(e.v[:], 0)
+	if n == -1 {
+		n = 8
+	}
+	return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+	return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+	b     []byte
+	bytes [max99thPercentileSize]byte
+	token []byte
+	start int // start position of the current token
+	end   int // end position of the current token
+	next  int // next point for scan
+	err   error
+	done  bool
+}
+
+func makeScannerString(s string) scanner {
+	scan := scanner{}
+	if len(s) <= len(scan.bytes) {
+		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+	} else {
+		scan.b = []byte(s)
+	}
+	scan.init()
+	return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+	scan := scanner{b: b}
+	scan.init()
+	return scan
+}
+
+func (s *scanner) init() {
+	for i, c := range s.b {
+		if c == '_' {
+			s.b[i] = '-'
+		}
+	}
+	s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+	for i := start; i < end; i++ {
+		c := s.b[i]
+		if 'A' <= c && c <= 'Z' {
+			s.b[i] += 'a' - 'A'
+		}
+	}
+}
+
+func (s *scanner) setError(e error) {
+	if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+		s.err = e
+	}
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+	s.start = oldStart
+	if end := oldStart + newSize; end != oldEnd {
+		diff := end - oldEnd
+		if end < cap(s.b) {
+			b := make([]byte, len(s.b)+diff)
+			copy(b, s.b[:oldStart])
+			copy(b[end:], s.b[oldEnd:])
+			s.b = b
+		} else {
+			s.b = append(s.b[end:], s.b[oldEnd:]...)
+		}
+		s.next = end + (s.next - s.end)
+		s.end = end
+	}
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+	s.resizeRange(s.start, s.end, len(repl))
+	copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+	s.setError(e)
+	if s.start == 0 {
+		s.b = s.b[:+copy(s.b, s.b[s.next:])]
+		s.end = 0
+	} else {
+		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+		s.end = s.start - 1
+	}
+	s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+	diff := end - start
+	s.next -= diff
+	s.start -= diff
+	s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string.  Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+	end = s.end
+	s.token = nil
+	for s.start = s.next; s.next < len(s.b); {
+		i := bytes.IndexByte(s.b[s.next:], '-')
+		if i == -1 {
+			s.end = len(s.b)
+			s.next = len(s.b)
+			i = s.end - s.start
+		} else {
+			s.end = s.next + i
+			s.next = s.end + 1
+		}
+		token := s.b[s.start:s.end]
+		if i < 1 || i > 8 || !isAlphaNum(token) {
+			s.gobble(ErrSyntax)
+			continue
+		}
+		s.token = token
+		return end
+	}
+	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+		s.setError(ErrSyntax)
+		s.b = s.b[:len(s.b)-1]
+	}
+	s.done = true
+	return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+	end = s.end
+	s.scan()
+	for ; len(s.token) >= min; s.scan() {
+		end = s.end
+	}
+	return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+	// TODO: consider supporting old-style locale key-value pairs.
+	if s == "" {
+		return Und, ErrSyntax
+	}
+	if len(s) <= maxAltTaglen {
+		b := [maxAltTaglen]byte{}
+		for i, c := range s {
+			// Generating invalid UTF-8 is okay as it won't match.
+			if 'A' <= c && c <= 'Z' {
+				c += 'a' - 'A'
+			} else if c == '_' {
+				c = '-'
+			}
+			b[i] = byte(c)
+		}
+		if t, ok := grandfathered(b); ok {
+			return t, nil
+		}
+	}
+	scan := makeScannerString(s)
+	return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+	t = Und
+	var end int
+	if n := len(scan.token); n <= 1 {
+		scan.toLower(0, len(scan.b))
+		if n == 0 || scan.token[0] != 'x' {
+			return t, ErrSyntax
+		}
+		end = parseExtensions(scan)
+	} else if n >= 4 {
+		return Und, ErrSyntax
+	} else { // the usual case
+		t, end = parseTag(scan)
+		if n := len(scan.token); n == 1 {
+			t.pExt = uint16(end)
+			end = parseExtensions(scan)
+		} else if end < len(scan.b) {
+			scan.setError(ErrSyntax)
+			scan.b = scan.b[:end]
+		}
+	}
+	if int(t.pVariant) < len(scan.b) {
+		if end < len(s) {
+			s = s[:end]
+		}
+		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+			t.str = s
+		} else {
+			t.str = string(scan.b)
+		}
+	} else {
+		t.pVariant, t.pExt = 0, 0
+	}
+	return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+	var e error
+	// TODO: set an error if an unknown lang, script or region is encountered.
+	t.LangID, e = getLangID(scan.token)
+	scan.setError(e)
+	scan.replace(t.LangID.String())
+	langStart := scan.start
+	end = scan.scan()
+	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+		// to a tag of the form <extlang>.
+		lang, e := getLangID(scan.token)
+		if lang != 0 {
+			t.LangID = lang
+			copy(scan.b[langStart:], lang.String())
+			scan.b[langStart+3] = '-'
+			scan.start = langStart + 4
+		}
+		scan.gobble(e)
+		end = scan.scan()
+	}
+	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+		t.ScriptID, e = getScriptID(script, scan.token)
+		if t.ScriptID == 0 {
+			scan.gobble(e)
+		}
+		end = scan.scan()
+	}
+	if n := len(scan.token); n >= 2 && n <= 3 {
+		t.RegionID, e = getRegionID(scan.token)
+		if t.RegionID == 0 {
+			scan.gobble(e)
+		} else {
+			scan.replace(t.RegionID.String())
+		}
+		end = scan.scan()
+	}
+	scan.toLower(scan.start, len(scan.b))
+	t.pVariant = byte(end)
+	end = parseVariants(scan, end, t)
+	t.pExt = uint16(end)
+	return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+	start := scan.start
+	varIDBuf := [4]uint8{}
+	variantBuf := [4][]byte{}
+	varID := varIDBuf[:0]
+	variant := variantBuf[:0]
+	last := -1
+	needSort := false
+	for ; len(scan.token) >= 4; scan.scan() {
+		// TODO: measure the impact of needing this conversion and redesign
+		// the data structure if there is an issue.
+		v, ok := variantIndex[string(scan.token)]
+		if !ok {
+			// unknown variant
+			// TODO: allow user-defined variants?
+			scan.gobble(NewValueError(scan.token))
+			continue
+		}
+		varID = append(varID, v)
+		variant = append(variant, scan.token)
+		if !needSort {
+			if last < int(v) {
+				last = int(v)
+			} else {
+				needSort = true
+				// There is no legal combinations of more than 7 variants
+				// (and this is by no means a useful sequence).
+				const maxVariants = 8
+				if len(varID) > maxVariants {
+					break
+				}
+			}
+		}
+		end = scan.end
+	}
+	if needSort {
+		sort.Sort(variantsSort{varID, variant})
+		k, l := 0, -1
+		for i, v := range varID {
+			w := int(v)
+			if l == w {
+				// Remove duplicates.
+				continue
+			}
+			varID[k] = varID[i]
+			variant[k] = variant[i]
+			k++
+			l = w
+		}
+		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+			end = start - 1
+		} else {
+			scan.resizeRange(start, end, len(str))
+			copy(scan.b[scan.start:], str)
+			end = scan.end
+		}
+	}
+	return end
+}
+
+type variantsSort struct {
+	i []uint8
+	v [][]byte
+}
+
+func (s variantsSort) Len() int {
+	return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+	s.i[i], s.i[j] = s.i[j], s.i[i]
+	s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+	return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+	b [][]byte
+	n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+	return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+	b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+	for k := 0; k < b.n; k++ {
+		if b.b[i][k] == b.b[j][k] {
+			continue
+		}
+		return b.b[i][k] < b.b[j][k]
+	}
+	return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+	start := scan.start
+	exts := [][]byte{}
+	private := []byte{}
+	end := scan.end
+	for len(scan.token) == 1 {
+		extStart := scan.start
+		ext := scan.token[0]
+		end = parseExtension(scan)
+		extension := scan.b[extStart:end]
+		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+			scan.setError(ErrSyntax)
+			end = extStart
+			continue
+		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+			scan.b = scan.b[:end]
+			return end
+		} else if ext == 'x' {
+			private = extension
+			break
+		}
+		exts = append(exts, extension)
+	}
+	sort.Sort(bytesSort{exts, 1})
+	if len(private) > 0 {
+		exts = append(exts, private)
+	}
+	scan.b = scan.b[:start]
+	if len(exts) > 0 {
+		scan.b = append(scan.b, bytes.Join(exts, separator)...)
+	} else if start > 0 {
+		// Strip trailing '-'.
+		scan.b = scan.b[:start-1]
+	}
+	return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+	start, end := scan.start, scan.end
+	switch scan.token[0] {
+	case 'u':
+		attrStart := end
+		scan.scan()
+		for last := []byte{}; len(scan.token) > 2; scan.scan() {
+			if bytes.Compare(scan.token, last) != -1 {
+				// Attributes are unsorted. Start over from scratch.
+				p := attrStart + 1
+				scan.next = p
+				attrs := [][]byte{}
+				for scan.scan(); len(scan.token) > 2; scan.scan() {
+					attrs = append(attrs, scan.token)
+					end = scan.end
+				}
+				sort.Sort(bytesSort{attrs, 3})
+				copy(scan.b[p:], bytes.Join(attrs, separator))
+				break
+			}
+			last = scan.token
+			end = scan.end
+		}
+		var last, key []byte
+		for attrEnd := end; len(scan.token) == 2; last = key {
+			key = scan.token
+			keyEnd := scan.end
+			end = scan.acceptMinSize(3)
+			// TODO: check key value validity
+			if keyEnd == end || bytes.Compare(key, last) != 1 {
+				// We have an invalid key or the keys are not sorted.
+				// Start scanning keys from scratch and reorder.
+				p := attrEnd + 1
+				scan.next = p
+				keys := [][]byte{}
+				for scan.scan(); len(scan.token) == 2; {
+					keyStart, keyEnd := scan.start, scan.end
+					end = scan.acceptMinSize(3)
+					if keyEnd != end {
+						keys = append(keys, scan.b[keyStart:end])
+					} else {
+						scan.setError(ErrSyntax)
+						end = keyStart
+					}
+				}
+				sort.Stable(bytesSort{keys, 2})
+				if n := len(keys); n > 0 {
+					k := 0
+					for i := 1; i < n; i++ {
+						if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+							k++
+							keys[k] = keys[i]
+						} else if !bytes.Equal(keys[k], keys[i]) {
+							scan.setError(ErrDuplicateKey)
+						}
+					}
+					keys = keys[:k+1]
+				}
+				reordered := bytes.Join(keys, separator)
+				if e := p + len(reordered); e < end {
+					scan.deleteRange(e, end)
+					end = e
+				}
+				copy(scan.b[p:], reordered)
+				break
+			}
+		}
+	case 't':
+		scan.scan()
+		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+			_, end = parseTag(scan)
+			scan.toLower(start, end)
+		}
+		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+			end = scan.acceptMinSize(3)
+		}
+	case 'x':
+		end = scan.acceptMinSize(1)
+	default:
+		end = scan.acceptMinSize(2)
+	}
+	return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+	if s[p] == '-' {
+		p++
+	}
+	if s[p] == 'x' {
+		return len(s), s[p:]
+	}
+	end = nextExtension(s, p)
+	return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+	for n := len(s) - 3; p < n; {
+		if s[p] == '-' {
+			if s[p+2] == '-' {
+				return p
+			}
+			p += 3
+		} else {
+			p++
+		}
+	}
+	return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 0000000..239e2d2
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3431 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8665
+
+const NumScripts = 242
+
+const NumRegions = 357
+
+type FromTo struct {
+	From uint16
+	To   uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+	_af  = 22
+	_am  = 39
+	_ar  = 58
+	_az  = 88
+	_bg  = 126
+	_bn  = 165
+	_ca  = 215
+	_cs  = 250
+	_da  = 257
+	_de  = 269
+	_el  = 310
+	_en  = 313
+	_es  = 318
+	_et  = 320
+	_fa  = 328
+	_fi  = 337
+	_fil = 339
+	_fr  = 350
+	_gu  = 420
+	_he  = 444
+	_hi  = 446
+	_hr  = 465
+	_hu  = 469
+	_hy  = 471
+	_id  = 481
+	_is  = 504
+	_it  = 505
+	_ja  = 512
+	_ka  = 528
+	_kk  = 578
+	_km  = 586
+	_kn  = 593
+	_ko  = 596
+	_ky  = 650
+	_lo  = 696
+	_lt  = 704
+	_lv  = 711
+	_mk  = 767
+	_ml  = 772
+	_mn  = 779
+	_mo  = 784
+	_mr  = 795
+	_ms  = 799
+	_mul = 806
+	_my  = 817
+	_nb  = 839
+	_ne  = 849
+	_nl  = 871
+	_no  = 879
+	_pa  = 925
+	_pl  = 947
+	_pt  = 960
+	_ro  = 988
+	_ru  = 994
+	_sh  = 1031
+	_si  = 1036
+	_sk  = 1042
+	_sl  = 1046
+	_sq  = 1073
+	_sr  = 1074
+	_sv  = 1092
+	_sw  = 1093
+	_ta  = 1104
+	_te  = 1121
+	_th  = 1131
+	_tl  = 1146
+	_tn  = 1152
+	_tr  = 1162
+	_uk  = 1198
+	_ur  = 1204
+	_uz  = 1212
+	_vi  = 1219
+	_zh  = 1321
+	_zu  = 1327
+	_jbo = 515
+	_ami = 1650
+	_bnn = 2357
+	_hak = 438
+	_tlh = 14467
+	_lb  = 661
+	_nv  = 899
+	_pwn = 12055
+	_tao = 14188
+	_tay = 14198
+	_tsu = 14662
+	_nn  = 874
+	_sfb = 13629
+	_vgt = 15701
+	_sgg = 13660
+	_cmn = 3007
+	_nan = 835
+	_hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+//     - if the first letter of the 2- and 3-letter ISO codes are the same:
+//       the second and third letter of the 3-letter ISO code.
+//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+	// Entry 0 - 3F
+	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+	// Entry 40 - 7F
+	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+	// Entry 80 - BF
+	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+	// Entry C0 - FF
+	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+	// Entry 100 - 13F
+	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+	// Entry 140 - 17F
+	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+	// Entry 180 - 1BF
+	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+	// Entry 200 - 23F
+	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+	// Entry 240 - 27F
+	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+	// Entry 280 - 2BF
+	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+	// Entry 2C0 - 2FF
+	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+	// Entry 300 - 33F
+	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+	// Entry 380 - 3BF
+	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+	// Entry 3C0 - 3FF
+	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+	// Entry 400 - 43F
+	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+	// Entry 440 - 47F
+	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+	// Entry 480 - 4BF
+	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+	// Entry 4C0 - 4FF
+	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+	// Entry 500 - 53F
+	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+	// Entry 540 - 57F
+	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	// Entry 580 - 5BF
+	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+	// Entry 5C0 - 5FF
+	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+	// Entry 600 - 63F
+	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+	// Entry 640 - 67F
+	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+	// Entry 680 - 6BF
+	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+	// Entry 6C0 - 6FF
+	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+	// Entry 700 - 73F
+	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 740 - 77F
+	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+	// Entry 780 - 7BF
+	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+	// Entry 7C0 - 7FF
+	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+	// Entry 800 - 83F
+	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+	// Entry 840 - 87F
+	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+	// Entry 880 - 8BF
+	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+	0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var AliasMap = [164]FromTo{
+	0:   {From: 0x82, To: 0x88},
+	1:   {From: 0x187, To: 0x1ae},
+	2:   {From: 0x1f3, To: 0x1e1},
+	3:   {From: 0x1fb, To: 0x1bc},
+	4:   {From: 0x208, To: 0x512},
+	5:   {From: 0x20f, To: 0x20e},
+	6:   {From: 0x310, To: 0x3dc},
+	7:   {From: 0x347, To: 0x36f},
+	8:   {From: 0x407, To: 0x432},
+	9:   {From: 0x47a, To: 0x153},
+	10:  {From: 0x490, To: 0x451},
+	11:  {From: 0x4a2, To: 0x21},
+	12:  {From: 0x53e, To: 0x544},
+	13:  {From: 0x58f, To: 0x12d},
+	14:  {From: 0x630, To: 0x1eb1},
+	15:  {From: 0x651, To: 0x431},
+	16:  {From: 0x662, To: 0x431},
+	17:  {From: 0x6ed, To: 0x3a},
+	18:  {From: 0x6f8, To: 0x1d7},
+	19:  {From: 0x73e, To: 0x21a1},
+	20:  {From: 0x7b3, To: 0x56},
+	21:  {From: 0x7b9, To: 0x299b},
+	22:  {From: 0x7c5, To: 0x58},
+	23:  {From: 0x7e6, To: 0x145},
+	24:  {From: 0x80c, To: 0x5a},
+	25:  {From: 0x815, To: 0x8d},
+	26:  {From: 0x87e, To: 0x810},
+	27:  {From: 0x8c3, To: 0xee3},
+	28:  {From: 0x9ef, To: 0x331},
+	29:  {From: 0xa36, To: 0x2c5},
+	30:  {From: 0xa3d, To: 0xbf},
+	31:  {From: 0xabe, To: 0x3322},
+	32:  {From: 0xb38, To: 0x529},
+	33:  {From: 0xb75, To: 0x265a},
+	34:  {From: 0xb7e, To: 0xbc3},
+	35:  {From: 0xb9b, To: 0x44e},
+	36:  {From: 0xbbc, To: 0x4229},
+	37:  {From: 0xbbf, To: 0x529},
+	38:  {From: 0xbfe, To: 0x2da7},
+	39:  {From: 0xc2e, To: 0x3181},
+	40:  {From: 0xcb9, To: 0xf3},
+	41:  {From: 0xd08, To: 0xfa},
+	42:  {From: 0xdc8, To: 0x11a},
+	43:  {From: 0xdd7, To: 0x32d},
+	44:  {From: 0xdf8, To: 0xdfb},
+	45:  {From: 0xdfe, To: 0x531},
+	46:  {From: 0xedf, To: 0x205a},
+	47:  {From: 0xeee, To: 0x2e9a},
+	48:  {From: 0xf39, To: 0x367},
+	49:  {From: 0x10d0, To: 0x140},
+	50:  {From: 0x1104, To: 0x2d0},
+	51:  {From: 0x11a0, To: 0x1ec},
+	52:  {From: 0x1279, To: 0x21},
+	53:  {From: 0x1424, To: 0x15e},
+	54:  {From: 0x1470, To: 0x14e},
+	55:  {From: 0x151f, To: 0xd9b},
+	56:  {From: 0x1523, To: 0x390},
+	57:  {From: 0x1532, To: 0x19f},
+	58:  {From: 0x1580, To: 0x210},
+	59:  {From: 0x1583, To: 0x10d},
+	60:  {From: 0x15a3, To: 0x3caf},
+	61:  {From: 0x166a, To: 0x19b},
+	62:  {From: 0x16c8, To: 0x136},
+	63:  {From: 0x1700, To: 0x29f8},
+	64:  {From: 0x1718, To: 0x194},
+	65:  {From: 0x1727, To: 0xf3f},
+	66:  {From: 0x177a, To: 0x178},
+	67:  {From: 0x1809, To: 0x17b6},
+	68:  {From: 0x1816, To: 0x18f3},
+	69:  {From: 0x188a, To: 0x436},
+	70:  {From: 0x1979, To: 0x1d01},
+	71:  {From: 0x1a74, To: 0x2bb0},
+	72:  {From: 0x1a8a, To: 0x1f8},
+	73:  {From: 0x1b5a, To: 0x1fa},
+	74:  {From: 0x1b86, To: 0x1515},
+	75:  {From: 0x1d64, To: 0x2c9b},
+	76:  {From: 0x2038, To: 0x37b1},
+	77:  {From: 0x203d, To: 0x20dd},
+	78:  {From: 0x205a, To: 0x30b},
+	79:  {From: 0x20e3, To: 0x274},
+	80:  {From: 0x20ee, To: 0x263},
+	81:  {From: 0x20f2, To: 0x22d},
+	82:  {From: 0x20f9, To: 0x256},
+	83:  {From: 0x210f, To: 0x21eb},
+	84:  {From: 0x2135, To: 0x27d},
+	85:  {From: 0x2160, To: 0x913},
+	86:  {From: 0x2199, To: 0x121},
+	87:  {From: 0x21ce, To: 0x1561},
+	88:  {From: 0x21e6, To: 0x504},
+	89:  {From: 0x21f4, To: 0x49f},
+	90:  {From: 0x222d, To: 0x121},
+	91:  {From: 0x2237, To: 0x121},
+	92:  {From: 0x2262, To: 0x92a},
+	93:  {From: 0x2316, To: 0x3226},
+	94:  {From: 0x2382, To: 0x3365},
+	95:  {From: 0x2472, To: 0x2c7},
+	96:  {From: 0x24e4, To: 0x2ff},
+	97:  {From: 0x24f0, To: 0x2fa},
+	98:  {From: 0x24fa, To: 0x31f},
+	99:  {From: 0x2550, To: 0xb5b},
+	100: {From: 0x25a9, To: 0xe2},
+	101: {From: 0x263e, To: 0x2d0},
+	102: {From: 0x26c9, To: 0x26b4},
+	103: {From: 0x26f9, To: 0x3c8},
+	104: {From: 0x2727, To: 0x3caf},
+	105: {From: 0x2765, To: 0x26b4},
+	106: {From: 0x2789, To: 0x4358},
+	107: {From: 0x28ef, To: 0x2837},
+	108: {From: 0x2914, To: 0x351},
+	109: {From: 0x2986, To: 0x2da7},
+	110: {From: 0x2b1a, To: 0x38d},
+	111: {From: 0x2bfc, To: 0x395},
+	112: {From: 0x2c3f, To: 0x3caf},
+	113: {From: 0x2cfc, To: 0x3be},
+	114: {From: 0x2d13, To: 0x597},
+	115: {From: 0x2d47, To: 0x148},
+	116: {From: 0x2d48, To: 0x148},
+	117: {From: 0x2dff, To: 0x2f1},
+	118: {From: 0x2e08, To: 0x19cc},
+	119: {From: 0x2e1a, To: 0x2d95},
+	120: {From: 0x2e21, To: 0x292},
+	121: {From: 0x2e54, To: 0x7d},
+	122: {From: 0x2e65, To: 0x2282},
+	123: {From: 0x2ea0, To: 0x2e9b},
+	124: {From: 0x2eef, To: 0x2ed7},
+	125: {From: 0x3193, To: 0x3c4},
+	126: {From: 0x3366, To: 0x338e},
+	127: {From: 0x342a, To: 0x3dc},
+	128: {From: 0x34ee, To: 0x18d0},
+	129: {From: 0x35c8, To: 0x2c9b},
+	130: {From: 0x35e6, To: 0x412},
+	131: {From: 0x3658, To: 0x246},
+	132: {From: 0x3676, To: 0x3f4},
+	133: {From: 0x36fd, To: 0x445},
+	134: {From: 0x37c0, To: 0x121},
+	135: {From: 0x3816, To: 0x38f2},
+	136: {From: 0x382b, To: 0x2c9b},
+	137: {From: 0x382f, To: 0xa9},
+	138: {From: 0x3832, To: 0x3228},
+	139: {From: 0x386c, To: 0x39a6},
+	140: {From: 0x3892, To: 0x3fc0},
+	141: {From: 0x38a5, To: 0x39d7},
+	142: {From: 0x38b4, To: 0x1fa4},
+	143: {From: 0x38b5, To: 0x2e9a},
+	144: {From: 0x395c, To: 0x47e},
+	145: {From: 0x3b4e, To: 0xd91},
+	146: {From: 0x3b78, To: 0x137},
+	147: {From: 0x3c99, To: 0x4bc},
+	148: {From: 0x3fbd, To: 0x100},
+	149: {From: 0x4208, To: 0xa91},
+	150: {From: 0x42be, To: 0x573},
+	151: {From: 0x42f9, To: 0x3f60},
+	152: {From: 0x4378, To: 0x25a},
+	153: {From: 0x43cb, To: 0x36cb},
+	154: {From: 0x43cd, To: 0x10f},
+	155: {From: 0x44af, To: 0x3322},
+	156: {From: 0x44e3, To: 0x512},
+	157: {From: 0x45ca, To: 0x2409},
+	158: {From: 0x45dd, To: 0x26dc},
+	159: {From: 0x4610, To: 0x48ae},
+	160: {From: 0x46ae, To: 0x46a0},
+	161: {From: 0x473e, To: 0x4745},
+	162: {From: 0x4916, To: 0x31f},
+	163: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var AliasTypes = [164]AliasType{
+	// Entry 0 - 3F
+	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+	// Entry 40 - 7F
+	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+	// Entry 80 - BF
+	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+	0, 1, 1, 1,
+}
+
+const (
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists.  If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 40 - 7F
+	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	// Entry 80 - BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry C0 - FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 100 - 13F
+	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+	// Entry 140 - 17F
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 180 - 1BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+	// Entry 1C0 - 1FF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+	// Entry 200 - 23F
+	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 240 - 27F
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 280 - 2BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 2C0 - 2FF
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+	// Entry 300 - 33F
+	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 340 - 37F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 380 - 3BF
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+	// Entry 3C0 - 3FF
+	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 400 - 43F
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	// Entry 440 - 47F
+	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	// Entry 480 - 4BF
+	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 4C0 - 4FF
+	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	// Entry 500 - 53F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+	0x00, 0x00,
+}
+
+const (
+	_001 = 1
+	_419 = 31
+	_BR  = 65
+	_CA  = 73
+	_ES  = 110
+	_GB  = 123
+	_MD  = 188
+	_PT  = 238
+	_UK  = 306
+	_US  = 309
+	_ZZ  = 357
+	_XA  = 323
+	_XC  = 325
+	_XK  = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 40 - 7F
+	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 80 - BF
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry C0 - FF
+	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	// Entry 100 - 13F
+	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	// Entry 140 - 17F
+	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
+//                 letters form the 3-letter ISO code.
+//     - 0, n:     index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
+	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
+	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+	0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+	0:  {From: 0x44, To: 0xc4},
+	1:  {From: 0x58, To: 0xa7},
+	2:  {From: 0x5f, To: 0x60},
+	3:  {From: 0x66, To: 0x3b},
+	4:  {From: 0x79, To: 0x78},
+	5:  {From: 0x93, To: 0x37},
+	6:  {From: 0xa3, To: 0x133},
+	7:  {From: 0xc1, To: 0x133},
+	8:  {From: 0xd7, To: 0x13f},
+	9:  {From: 0xdc, To: 0x2b},
+	10: {From: 0xef, To: 0x133},
+	11: {From: 0xf2, To: 0xe2},
+	12: {From: 0xfc, To: 0x70},
+	13: {From: 0x103, To: 0x164},
+	14: {From: 0x12a, To: 0x126},
+	15: {From: 0x132, To: 0x7b},
+	16: {From: 0x13a, To: 0x13e},
+	17: {From: 0x141, To: 0x133},
+	18: {From: 0x15d, To: 0x15e},
+	19: {From: 0x163, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+	// Entry 0 - 3F
+	0, 1, 2, 3, 5, 9, 11, 13,
+	14, 15, 17, 18, 19, 21, 29, 30,
+	34, 35, 39, 53, 54, 57, 61, 142,
+	143, 145, 150, 151, 154, 155, 202, 419,
+	958, 0, 20, 784, 4, 28, 660, 8,
+	51, 530, 24, 10, 32, 16, 40, 36,
+	533, 248, 31, 70, 52, 50, 56, 854,
+	100, 48, 108, 204, 652, 60, 96, 68,
+	// Entry 40 - 7F
+	535, 76, 44, 64, 104, 74, 72, 112,
+	84, 124, 166, 180, 140, 178, 756, 384,
+	184, 152, 120, 156, 170, 0, 188, 891,
+	296, 192, 132, 531, 162, 196, 203, 278,
+	276, 0, 262, 208, 212, 214, 204, 12,
+	0, 218, 233, 818, 732, 232, 724, 231,
+	967, 0, 246, 242, 238, 583, 234, 0,
+	250, 249, 266, 826, 308, 268, 254, 831,
+	// Entry 80 - BF
+	288, 292, 304, 270, 324, 312, 226, 300,
+	239, 320, 316, 624, 328, 344, 334, 340,
+	191, 332, 348, 854, 0, 360, 372, 376,
+	833, 356, 86, 368, 364, 352, 380, 832,
+	388, 400, 392, 581, 404, 417, 116, 296,
+	174, 659, 408, 410, 414, 136, 398, 418,
+	422, 662, 438, 144, 430, 426, 440, 442,
+	428, 434, 504, 492, 498, 499, 663, 450,
+	// Entry C0 - FF
+	584, 581, 807, 466, 104, 496, 446, 580,
+	474, 478, 500, 470, 480, 462, 454, 484,
+	458, 508, 516, 540, 562, 574, 566, 548,
+	558, 528, 578, 524, 10, 520, 536, 570,
+	554, 512, 591, 0, 604, 258, 598, 608,
+	586, 616, 666, 612, 630, 275, 620, 581,
+	585, 600, 591, 634, 959, 960, 961, 962,
+	963, 964, 965, 966, 967, 968, 969, 970,
+	// Entry 100 - 13F
+	971, 972, 638, 716, 642, 688, 643, 646,
+	682, 90, 690, 729, 752, 702, 654, 705,
+	744, 703, 694, 674, 686, 706, 740, 728,
+	678, 810, 222, 534, 760, 748, 0, 796,
+	148, 260, 768, 764, 762, 772, 626, 795,
+	788, 776, 626, 792, 780, 798, 158, 834,
+	804, 800, 826, 581, 0, 840, 858, 860,
+	336, 670, 704, 862, 92, 850, 704, 548,
+	// Entry 140 - 17F
+	876, 581, 882, 973, 974, 975, 976, 977,
+	978, 979, 980, 981, 982, 983, 984, 985,
+	986, 987, 988, 989, 990, 991, 992, 993,
+	994, 995, 996, 997, 998, 720, 887, 175,
+	891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+	0, 59, 108, 143, 181, 220, 259, 291,
+	333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+	// Entry 0 - 3F
+	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+	// Entry 40 - 7F
+	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+	// Entry 80 - BF
+	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+	// Entry C0 - FF
+	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+	// Entry 100 - 13F
+	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+	// Entry 140 - 17F
+	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+	"1606nict": 0x0,
+	"1694acad": 0x1,
+	"1901":     0x2,
+	"1959acad": 0x3,
+	"1994":     0x4d,
+	"1996":     0x4,
+	"abl1943":  0x5,
+	"akuapem":  0x6,
+	"alalc97":  0x4f,
+	"aluku":    0x7,
+	"ao1990":   0x8,
+	"arevela":  0x9,
+	"arevmda":  0xa,
+	"asante":   0xb,
+	"baku1926": 0xc,
+	"balanka":  0xd,
+	"barla":    0xe,
+	"basiceng": 0xf,
+	"bauddha":  0x10,
+	"biscayan": 0x11,
+	"biske":    0x48,
+	"bohoric":  0x12,
+	"boont":    0x13,
+	"colb1945": 0x14,
+	"cornu":    0x15,
+	"dajnko":   0x16,
+	"ekavsk":   0x17,
+	"emodeng":  0x18,
+	"fonipa":   0x50,
+	"fonnapa":  0x51,
+	"fonupa":   0x52,
+	"fonxsamp": 0x53,
+	"hepburn":  0x19,
+	"heploc":   0x4e,
+	"hognorsk": 0x1a,
+	"hsistemo": 0x1b,
+	"ijekavsk": 0x1c,
+	"itihasa":  0x1d,
+	"jauer":    0x1e,
+	"jyutping": 0x1f,
+	"kkcor":    0x20,
+	"kociewie": 0x21,
+	"kscor":    0x22,
+	"laukika":  0x23,
+	"lipaw":    0x49,
+	"luna1918": 0x24,
+	"metelko":  0x25,
+	"monoton":  0x26,
+	"ndyuka":   0x27,
+	"nedis":    0x28,
+	"newfound": 0x29,
+	"njiva":    0x4a,
+	"nulik":    0x2a,
+	"osojs":    0x4b,
+	"oxendict": 0x2b,
+	"pahawh2":  0x2c,
+	"pahawh3":  0x2d,
+	"pahawh4":  0x2e,
+	"pamaka":   0x2f,
+	"petr1708": 0x30,
+	"pinyin":   0x31,
+	"polyton":  0x32,
+	"puter":    0x33,
+	"rigik":    0x34,
+	"rozaj":    0x35,
+	"rumgr":    0x36,
+	"scotland": 0x37,
+	"scouse":   0x38,
+	"simple":   0x54,
+	"solba":    0x4c,
+	"sotav":    0x39,
+	"spanglis": 0x3a,
+	"surmiran": 0x3b,
+	"sursilv":  0x3c,
+	"sutsilv":  0x3d,
+	"tarask":   0x3e,
+	"uccor":    0x3f,
+	"ucrcor":   0x40,
+	"ulster":   0x41,
+	"unifon":   0x42,
+	"vaidika":  0x43,
+	"valencia": 0x44,
+	"vallader": 0x45,
+	"wadegile": 0x46,
+	"xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+	lang   uint16
+	region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+	1:   {lang: 0x14e, region: 0x84},
+	3:   {lang: 0x2a2, region: 0x106},
+	4:   {lang: 0x1f, region: 0x99},
+	5:   {lang: 0x3a, region: 0x6b},
+	7:   {lang: 0x3b, region: 0x9c},
+	8:   {lang: 0x1d7, region: 0x28},
+	9:   {lang: 0x13, region: 0x9c},
+	10:  {lang: 0x5b, region: 0x95},
+	11:  {lang: 0x60, region: 0x52},
+	12:  {lang: 0xb9, region: 0xb4},
+	13:  {lang: 0x63, region: 0x95},
+	14:  {lang: 0xa5, region: 0x35},
+	15:  {lang: 0x3e9, region: 0x99},
+	17:  {lang: 0x529, region: 0x12e},
+	18:  {lang: 0x3b1, region: 0x99},
+	19:  {lang: 0x15e, region: 0x78},
+	20:  {lang: 0xc2, region: 0x95},
+	21:  {lang: 0x9d, region: 0xe7},
+	22:  {lang: 0xdb, region: 0x35},
+	23:  {lang: 0xf3, region: 0x49},
+	24:  {lang: 0x4f0, region: 0x12b},
+	25:  {lang: 0xe7, region: 0x13e},
+	26:  {lang: 0xe5, region: 0x135},
+	28:  {lang: 0xf1, region: 0x6b},
+	30:  {lang: 0x1a0, region: 0x5d},
+	31:  {lang: 0x3e2, region: 0x106},
+	33:  {lang: 0x1be, region: 0x99},
+	36:  {lang: 0x15e, region: 0x78},
+	39:  {lang: 0x133, region: 0x6b},
+	40:  {lang: 0x431, region: 0x27},
+	41:  {lang: 0x27, region: 0x6f},
+	43:  {lang: 0x210, region: 0x7d},
+	44:  {lang: 0xfe, region: 0x38},
+	46:  {lang: 0x19b, region: 0x99},
+	47:  {lang: 0x19e, region: 0x130},
+	48:  {lang: 0x3e9, region: 0x99},
+	49:  {lang: 0x136, region: 0x87},
+	50:  {lang: 0x1a4, region: 0x99},
+	51:  {lang: 0x39d, region: 0x99},
+	52:  {lang: 0x529, region: 0x12e},
+	53:  {lang: 0x254, region: 0xab},
+	54:  {lang: 0x529, region: 0x53},
+	55:  {lang: 0x1cb, region: 0xe7},
+	56:  {lang: 0x529, region: 0x53},
+	57:  {lang: 0x529, region: 0x12e},
+	58:  {lang: 0x2fd, region: 0x9b},
+	59:  {lang: 0x1bc, region: 0x97},
+	60:  {lang: 0x200, region: 0xa2},
+	61:  {lang: 0x1c5, region: 0x12b},
+	62:  {lang: 0x1ca, region: 0xaf},
+	65:  {lang: 0x1d5, region: 0x92},
+	67:  {lang: 0x142, region: 0x9e},
+	68:  {lang: 0x254, region: 0xab},
+	69:  {lang: 0x20e, region: 0x95},
+	70:  {lang: 0x200, region: 0xa2},
+	72:  {lang: 0x135, region: 0xc4},
+	73:  {lang: 0x200, region: 0xa2},
+	74:  {lang: 0x3bb, region: 0xe8},
+	75:  {lang: 0x24a, region: 0xa6},
+	76:  {lang: 0x3fa, region: 0x99},
+	79:  {lang: 0x251, region: 0x99},
+	80:  {lang: 0x254, region: 0xab},
+	82:  {lang: 0x88, region: 0x99},
+	83:  {lang: 0x370, region: 0x123},
+	84:  {lang: 0x2b8, region: 0xaf},
+	89:  {lang: 0x29f, region: 0x99},
+	90:  {lang: 0x2a8, region: 0x99},
+	91:  {lang: 0x28f, region: 0x87},
+	92:  {lang: 0x1a0, region: 0x87},
+	93:  {lang: 0x2ac, region: 0x53},
+	95:  {lang: 0x4f4, region: 0x12b},
+	96:  {lang: 0x4f5, region: 0x12b},
+	97:  {lang: 0x1be, region: 0x99},
+	99:  {lang: 0x337, region: 0x9c},
+	100: {lang: 0x4f7, region: 0x53},
+	101: {lang: 0xa9, region: 0x53},
+	104: {lang: 0x2e8, region: 0x112},
+	105: {lang: 0x4f8, region: 0x10b},
+	106: {lang: 0x4f8, region: 0x10b},
+	107: {lang: 0x304, region: 0x99},
+	108: {lang: 0x31b, region: 0x99},
+	109: {lang: 0x30b, region: 0x53},
+	111: {lang: 0x31e, region: 0x35},
+	112: {lang: 0x30e, region: 0x99},
+	113: {lang: 0x414, region: 0xe8},
+	114: {lang: 0x331, region: 0xc4},
+	115: {lang: 0x4f9, region: 0x108},
+	116: {lang: 0x3b, region: 0xa1},
+	117: {lang: 0x353, region: 0xdb},
+	120: {lang: 0x2d0, region: 0x84},
+	121: {lang: 0x52a, region: 0x53},
+	122: {lang: 0x403, region: 0x96},
+	123: {lang: 0x3ee, region: 0x99},
+	124: {lang: 0x39b, region: 0xc5},
+	125: {lang: 0x395, region: 0x99},
+	126: {lang: 0x399, region: 0x135},
+	127: {lang: 0x429, region: 0x115},
+	128: {lang: 0x3b, region: 0x11c},
+	129: {lang: 0xfd, region: 0xc4},
+	130: {lang: 0x27d, region: 0x106},
+	131: {lang: 0x2c9, region: 0x53},
+	132: {lang: 0x39f, region: 0x9c},
+	133: {lang: 0x39f, region: 0x53},
+	135: {lang: 0x3ad, region: 0xb0},
+	137: {lang: 0x1c6, region: 0x53},
+	138: {lang: 0x4fd, region: 0x9c},
+	189: {lang: 0x3cb, region: 0x95},
+	191: {lang: 0x372, region: 0x10c},
+	192: {lang: 0x420, region: 0x97},
+	194: {lang: 0x4ff, region: 0x15e},
+	195: {lang: 0x3f0, region: 0x99},
+	196: {lang: 0x45, region: 0x135},
+	197: {lang: 0x139, region: 0x7b},
+	198: {lang: 0x3e9, region: 0x99},
+	200: {lang: 0x3e9, region: 0x99},
+	201: {lang: 0x3fa, region: 0x99},
+	202: {lang: 0x40c, region: 0xb3},
+	203: {lang: 0x433, region: 0x99},
+	204: {lang: 0xef, region: 0xc5},
+	205: {lang: 0x43e, region: 0x95},
+	206: {lang: 0x44d, region: 0x35},
+	207: {lang: 0x44e, region: 0x9b},
+	211: {lang: 0x45a, region: 0xe7},
+	212: {lang: 0x11a, region: 0x99},
+	213: {lang: 0x45e, region: 0x53},
+	214: {lang: 0x232, region: 0x53},
+	215: {lang: 0x450, region: 0x99},
+	216: {lang: 0x4a5, region: 0x53},
+	217: {lang: 0x9f, region: 0x13e},
+	218: {lang: 0x461, region: 0x99},
+	220: {lang: 0x528, region: 0xba},
+	221: {lang: 0x153, region: 0xe7},
+	222: {lang: 0x128, region: 0xcd},
+	223: {lang: 0x46b, region: 0x123},
+	224: {lang: 0xa9, region: 0x53},
+	225: {lang: 0x2ce, region: 0x99},
+	226: {lang: 0x4ad, region: 0x11c},
+	227: {lang: 0x4be, region: 0xb4},
+	229: {lang: 0x1ce, region: 0x99},
+	232: {lang: 0x3a9, region: 0x9c},
+	233: {lang: 0x22, region: 0x9b},
+	234: {lang: 0x1ea, region: 0x53},
+	235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+	region uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+	0:    {region: 0x135, script: 0x57, flags: 0x0},
+	1:    {region: 0x6f, script: 0x57, flags: 0x0},
+	2:    {region: 0x165, script: 0x57, flags: 0x0},
+	3:    {region: 0x165, script: 0x57, flags: 0x0},
+	4:    {region: 0x165, script: 0x57, flags: 0x0},
+	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
+	6:    {region: 0x165, script: 0x57, flags: 0x0},
+	7:    {region: 0x165, script: 0x1f, flags: 0x0},
+	8:    {region: 0x80, script: 0x57, flags: 0x0},
+	9:    {region: 0x165, script: 0x57, flags: 0x0},
+	10:   {region: 0x165, script: 0x57, flags: 0x0},
+	11:   {region: 0x165, script: 0x57, flags: 0x0},
+	12:   {region: 0x95, script: 0x57, flags: 0x0},
+	13:   {region: 0x131, script: 0x57, flags: 0x0},
+	14:   {region: 0x80, script: 0x57, flags: 0x0},
+	15:   {region: 0x165, script: 0x57, flags: 0x0},
+	16:   {region: 0x165, script: 0x57, flags: 0x0},
+	17:   {region: 0x106, script: 0x1f, flags: 0x0},
+	18:   {region: 0x165, script: 0x57, flags: 0x0},
+	19:   {region: 0x9c, script: 0x9, flags: 0x0},
+	20:   {region: 0x128, script: 0x5, flags: 0x0},
+	21:   {region: 0x165, script: 0x57, flags: 0x0},
+	22:   {region: 0x161, script: 0x57, flags: 0x0},
+	23:   {region: 0x165, script: 0x57, flags: 0x0},
+	24:   {region: 0x165, script: 0x57, flags: 0x0},
+	25:   {region: 0x165, script: 0x57, flags: 0x0},
+	26:   {region: 0x165, script: 0x57, flags: 0x0},
+	27:   {region: 0x165, script: 0x57, flags: 0x0},
+	28:   {region: 0x52, script: 0x57, flags: 0x0},
+	29:   {region: 0x165, script: 0x57, flags: 0x0},
+	30:   {region: 0x165, script: 0x57, flags: 0x0},
+	31:   {region: 0x99, script: 0x4, flags: 0x0},
+	32:   {region: 0x165, script: 0x57, flags: 0x0},
+	33:   {region: 0x80, script: 0x57, flags: 0x0},
+	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
+	35:   {region: 0x165, script: 0x57, flags: 0x0},
+	36:   {region: 0x165, script: 0x57, flags: 0x0},
+	37:   {region: 0x14d, script: 0x57, flags: 0x0},
+	38:   {region: 0x106, script: 0x1f, flags: 0x0},
+	39:   {region: 0x6f, script: 0x29, flags: 0x0},
+	40:   {region: 0x165, script: 0x57, flags: 0x0},
+	41:   {region: 0x165, script: 0x57, flags: 0x0},
+	42:   {region: 0xd6, script: 0x57, flags: 0x0},
+	43:   {region: 0x165, script: 0x57, flags: 0x0},
+	45:   {region: 0x165, script: 0x57, flags: 0x0},
+	46:   {region: 0x165, script: 0x57, flags: 0x0},
+	47:   {region: 0x165, script: 0x57, flags: 0x0},
+	48:   {region: 0x165, script: 0x57, flags: 0x0},
+	49:   {region: 0x165, script: 0x57, flags: 0x0},
+	50:   {region: 0x165, script: 0x57, flags: 0x0},
+	51:   {region: 0x95, script: 0x57, flags: 0x0},
+	52:   {region: 0x165, script: 0x5, flags: 0x0},
+	53:   {region: 0x122, script: 0x5, flags: 0x0},
+	54:   {region: 0x165, script: 0x57, flags: 0x0},
+	55:   {region: 0x165, script: 0x57, flags: 0x0},
+	56:   {region: 0x165, script: 0x57, flags: 0x0},
+	57:   {region: 0x165, script: 0x57, flags: 0x0},
+	58:   {region: 0x6b, script: 0x5, flags: 0x0},
+	59:   {region: 0x0, script: 0x3, flags: 0x1},
+	60:   {region: 0x165, script: 0x57, flags: 0x0},
+	61:   {region: 0x51, script: 0x57, flags: 0x0},
+	62:   {region: 0x3f, script: 0x57, flags: 0x0},
+	63:   {region: 0x67, script: 0x5, flags: 0x0},
+	65:   {region: 0xba, script: 0x5, flags: 0x0},
+	66:   {region: 0x6b, script: 0x5, flags: 0x0},
+	67:   {region: 0x99, script: 0xe, flags: 0x0},
+	68:   {region: 0x12f, script: 0x57, flags: 0x0},
+	69:   {region: 0x135, script: 0xc4, flags: 0x0},
+	70:   {region: 0x165, script: 0x57, flags: 0x0},
+	71:   {region: 0x165, script: 0x57, flags: 0x0},
+	72:   {region: 0x6e, script: 0x57, flags: 0x0},
+	73:   {region: 0x165, script: 0x57, flags: 0x0},
+	74:   {region: 0x165, script: 0x57, flags: 0x0},
+	75:   {region: 0x49, script: 0x57, flags: 0x0},
+	76:   {region: 0x165, script: 0x57, flags: 0x0},
+	77:   {region: 0x106, script: 0x1f, flags: 0x0},
+	78:   {region: 0x165, script: 0x5, flags: 0x0},
+	79:   {region: 0x165, script: 0x57, flags: 0x0},
+	80:   {region: 0x165, script: 0x57, flags: 0x0},
+	81:   {region: 0x165, script: 0x57, flags: 0x0},
+	82:   {region: 0x99, script: 0x21, flags: 0x0},
+	83:   {region: 0x165, script: 0x57, flags: 0x0},
+	84:   {region: 0x165, script: 0x57, flags: 0x0},
+	85:   {region: 0x165, script: 0x57, flags: 0x0},
+	86:   {region: 0x3f, script: 0x57, flags: 0x0},
+	87:   {region: 0x165, script: 0x57, flags: 0x0},
+	88:   {region: 0x3, script: 0x5, flags: 0x1},
+	89:   {region: 0x106, script: 0x1f, flags: 0x0},
+	90:   {region: 0xe8, script: 0x5, flags: 0x0},
+	91:   {region: 0x95, script: 0x57, flags: 0x0},
+	92:   {region: 0xdb, script: 0x21, flags: 0x0},
+	93:   {region: 0x2e, script: 0x57, flags: 0x0},
+	94:   {region: 0x52, script: 0x57, flags: 0x0},
+	95:   {region: 0x165, script: 0x57, flags: 0x0},
+	96:   {region: 0x52, script: 0xb, flags: 0x0},
+	97:   {region: 0x165, script: 0x57, flags: 0x0},
+	98:   {region: 0x165, script: 0x57, flags: 0x0},
+	99:   {region: 0x95, script: 0x57, flags: 0x0},
+	100:  {region: 0x165, script: 0x57, flags: 0x0},
+	101:  {region: 0x52, script: 0x57, flags: 0x0},
+	102:  {region: 0x165, script: 0x57, flags: 0x0},
+	103:  {region: 0x165, script: 0x57, flags: 0x0},
+	104:  {region: 0x165, script: 0x57, flags: 0x0},
+	105:  {region: 0x165, script: 0x57, flags: 0x0},
+	106:  {region: 0x4f, script: 0x57, flags: 0x0},
+	107:  {region: 0x165, script: 0x57, flags: 0x0},
+	108:  {region: 0x165, script: 0x57, flags: 0x0},
+	109:  {region: 0x165, script: 0x57, flags: 0x0},
+	110:  {region: 0x165, script: 0x29, flags: 0x0},
+	111:  {region: 0x165, script: 0x57, flags: 0x0},
+	112:  {region: 0x165, script: 0x57, flags: 0x0},
+	113:  {region: 0x47, script: 0x1f, flags: 0x0},
+	114:  {region: 0x165, script: 0x57, flags: 0x0},
+	115:  {region: 0x165, script: 0x57, flags: 0x0},
+	116:  {region: 0x10b, script: 0x5, flags: 0x0},
+	117:  {region: 0x162, script: 0x57, flags: 0x0},
+	118:  {region: 0x165, script: 0x57, flags: 0x0},
+	119:  {region: 0x95, script: 0x57, flags: 0x0},
+	120:  {region: 0x165, script: 0x57, flags: 0x0},
+	121:  {region: 0x12f, script: 0x57, flags: 0x0},
+	122:  {region: 0x52, script: 0x57, flags: 0x0},
+	123:  {region: 0x99, script: 0xd7, flags: 0x0},
+	124:  {region: 0xe8, script: 0x5, flags: 0x0},
+	125:  {region: 0x99, script: 0x21, flags: 0x0},
+	126:  {region: 0x38, script: 0x1f, flags: 0x0},
+	127:  {region: 0x99, script: 0x21, flags: 0x0},
+	128:  {region: 0xe8, script: 0x5, flags: 0x0},
+	129:  {region: 0x12b, script: 0x31, flags: 0x0},
+	131:  {region: 0x99, script: 0x21, flags: 0x0},
+	132:  {region: 0x165, script: 0x57, flags: 0x0},
+	133:  {region: 0x99, script: 0x21, flags: 0x0},
+	134:  {region: 0xe7, script: 0x57, flags: 0x0},
+	135:  {region: 0x165, script: 0x57, flags: 0x0},
+	136:  {region: 0x99, script: 0x21, flags: 0x0},
+	137:  {region: 0x165, script: 0x57, flags: 0x0},
+	138:  {region: 0x13f, script: 0x57, flags: 0x0},
+	139:  {region: 0x165, script: 0x57, flags: 0x0},
+	140:  {region: 0x165, script: 0x57, flags: 0x0},
+	141:  {region: 0xe7, script: 0x57, flags: 0x0},
+	142:  {region: 0x165, script: 0x57, flags: 0x0},
+	143:  {region: 0xd6, script: 0x57, flags: 0x0},
+	144:  {region: 0x165, script: 0x57, flags: 0x0},
+	145:  {region: 0x165, script: 0x57, flags: 0x0},
+	146:  {region: 0x165, script: 0x57, flags: 0x0},
+	147:  {region: 0x165, script: 0x29, flags: 0x0},
+	148:  {region: 0x99, script: 0x21, flags: 0x0},
+	149:  {region: 0x95, script: 0x57, flags: 0x0},
+	150:  {region: 0x165, script: 0x57, flags: 0x0},
+	151:  {region: 0x165, script: 0x57, flags: 0x0},
+	152:  {region: 0x114, script: 0x57, flags: 0x0},
+	153:  {region: 0x165, script: 0x57, flags: 0x0},
+	154:  {region: 0x165, script: 0x57, flags: 0x0},
+	155:  {region: 0x52, script: 0x57, flags: 0x0},
+	156:  {region: 0x165, script: 0x57, flags: 0x0},
+	157:  {region: 0xe7, script: 0x57, flags: 0x0},
+	158:  {region: 0x165, script: 0x57, flags: 0x0},
+	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
+	160:  {region: 0xc3, script: 0x57, flags: 0x0},
+	161:  {region: 0x165, script: 0x57, flags: 0x0},
+	162:  {region: 0x165, script: 0x57, flags: 0x0},
+	163:  {region: 0xc3, script: 0x57, flags: 0x0},
+	164:  {region: 0x165, script: 0x57, flags: 0x0},
+	165:  {region: 0x35, script: 0xe, flags: 0x0},
+	166:  {region: 0x165, script: 0x57, flags: 0x0},
+	167:  {region: 0x165, script: 0x57, flags: 0x0},
+	168:  {region: 0x165, script: 0x57, flags: 0x0},
+	169:  {region: 0x53, script: 0xe0, flags: 0x0},
+	170:  {region: 0x165, script: 0x57, flags: 0x0},
+	171:  {region: 0x165, script: 0x57, flags: 0x0},
+	172:  {region: 0x165, script: 0x57, flags: 0x0},
+	173:  {region: 0x99, script: 0xe, flags: 0x0},
+	174:  {region: 0x165, script: 0x57, flags: 0x0},
+	175:  {region: 0x9c, script: 0x5, flags: 0x0},
+	176:  {region: 0x165, script: 0x57, flags: 0x0},
+	177:  {region: 0x4f, script: 0x57, flags: 0x0},
+	178:  {region: 0x78, script: 0x57, flags: 0x0},
+	179:  {region: 0x99, script: 0x21, flags: 0x0},
+	180:  {region: 0xe8, script: 0x5, flags: 0x0},
+	181:  {region: 0x99, script: 0x21, flags: 0x0},
+	182:  {region: 0x165, script: 0x57, flags: 0x0},
+	183:  {region: 0x33, script: 0x57, flags: 0x0},
+	184:  {region: 0x165, script: 0x57, flags: 0x0},
+	185:  {region: 0xb4, script: 0xc, flags: 0x0},
+	186:  {region: 0x52, script: 0x57, flags: 0x0},
+	187:  {region: 0x165, script: 0x29, flags: 0x0},
+	188:  {region: 0xe7, script: 0x57, flags: 0x0},
+	189:  {region: 0x165, script: 0x57, flags: 0x0},
+	190:  {region: 0xe8, script: 0x21, flags: 0x0},
+	191:  {region: 0x106, script: 0x1f, flags: 0x0},
+	192:  {region: 0x15f, script: 0x57, flags: 0x0},
+	193:  {region: 0x165, script: 0x57, flags: 0x0},
+	194:  {region: 0x95, script: 0x57, flags: 0x0},
+	195:  {region: 0x165, script: 0x57, flags: 0x0},
+	196:  {region: 0x52, script: 0x57, flags: 0x0},
+	197:  {region: 0x165, script: 0x57, flags: 0x0},
+	198:  {region: 0x165, script: 0x57, flags: 0x0},
+	199:  {region: 0x165, script: 0x57, flags: 0x0},
+	200:  {region: 0x86, script: 0x57, flags: 0x0},
+	201:  {region: 0x165, script: 0x57, flags: 0x0},
+	202:  {region: 0x165, script: 0x57, flags: 0x0},
+	203:  {region: 0x165, script: 0x57, flags: 0x0},
+	204:  {region: 0x165, script: 0x57, flags: 0x0},
+	205:  {region: 0x6d, script: 0x29, flags: 0x0},
+	206:  {region: 0x165, script: 0x57, flags: 0x0},
+	207:  {region: 0x165, script: 0x57, flags: 0x0},
+	208:  {region: 0x52, script: 0x57, flags: 0x0},
+	209:  {region: 0x165, script: 0x57, flags: 0x0},
+	210:  {region: 0x165, script: 0x57, flags: 0x0},
+	211:  {region: 0xc3, script: 0x57, flags: 0x0},
+	212:  {region: 0x165, script: 0x57, flags: 0x0},
+	213:  {region: 0x165, script: 0x57, flags: 0x0},
+	214:  {region: 0x165, script: 0x57, flags: 0x0},
+	215:  {region: 0x6e, script: 0x57, flags: 0x0},
+	216:  {region: 0x165, script: 0x57, flags: 0x0},
+	217:  {region: 0x165, script: 0x57, flags: 0x0},
+	218:  {region: 0xd6, script: 0x57, flags: 0x0},
+	219:  {region: 0x35, script: 0x16, flags: 0x0},
+	220:  {region: 0x106, script: 0x1f, flags: 0x0},
+	221:  {region: 0xe7, script: 0x57, flags: 0x0},
+	222:  {region: 0x165, script: 0x57, flags: 0x0},
+	223:  {region: 0x131, script: 0x57, flags: 0x0},
+	224:  {region: 0x8a, script: 0x57, flags: 0x0},
+	225:  {region: 0x75, script: 0x57, flags: 0x0},
+	226:  {region: 0x106, script: 0x1f, flags: 0x0},
+	227:  {region: 0x135, script: 0x57, flags: 0x0},
+	228:  {region: 0x49, script: 0x57, flags: 0x0},
+	229:  {region: 0x135, script: 0x1a, flags: 0x0},
+	230:  {region: 0xa6, script: 0x5, flags: 0x0},
+	231:  {region: 0x13e, script: 0x19, flags: 0x0},
+	232:  {region: 0x165, script: 0x57, flags: 0x0},
+	233:  {region: 0x9b, script: 0x5, flags: 0x0},
+	234:  {region: 0x165, script: 0x57, flags: 0x0},
+	235:  {region: 0x165, script: 0x57, flags: 0x0},
+	236:  {region: 0x165, script: 0x57, flags: 0x0},
+	237:  {region: 0x165, script: 0x57, flags: 0x0},
+	238:  {region: 0x165, script: 0x57, flags: 0x0},
+	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
+	240:  {region: 0x78, script: 0x57, flags: 0x0},
+	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
+	242:  {region: 0xe7, script: 0x57, flags: 0x0},
+	243:  {region: 0x49, script: 0x17, flags: 0x0},
+	244:  {region: 0x130, script: 0x1f, flags: 0x0},
+	245:  {region: 0x49, script: 0x17, flags: 0x0},
+	246:  {region: 0x49, script: 0x17, flags: 0x0},
+	247:  {region: 0x49, script: 0x17, flags: 0x0},
+	248:  {region: 0x49, script: 0x17, flags: 0x0},
+	249:  {region: 0x10a, script: 0x57, flags: 0x0},
+	250:  {region: 0x5e, script: 0x57, flags: 0x0},
+	251:  {region: 0xe9, script: 0x57, flags: 0x0},
+	252:  {region: 0x49, script: 0x17, flags: 0x0},
+	253:  {region: 0xc4, script: 0x81, flags: 0x0},
+	254:  {region: 0x8, script: 0x2, flags: 0x1},
+	255:  {region: 0x106, script: 0x1f, flags: 0x0},
+	256:  {region: 0x7b, script: 0x57, flags: 0x0},
+	257:  {region: 0x63, script: 0x57, flags: 0x0},
+	258:  {region: 0x165, script: 0x57, flags: 0x0},
+	259:  {region: 0x165, script: 0x57, flags: 0x0},
+	260:  {region: 0x165, script: 0x57, flags: 0x0},
+	261:  {region: 0x165, script: 0x57, flags: 0x0},
+	262:  {region: 0x135, script: 0x57, flags: 0x0},
+	263:  {region: 0x106, script: 0x1f, flags: 0x0},
+	264:  {region: 0xa4, script: 0x57, flags: 0x0},
+	265:  {region: 0x165, script: 0x57, flags: 0x0},
+	266:  {region: 0x165, script: 0x57, flags: 0x0},
+	267:  {region: 0x99, script: 0x5, flags: 0x0},
+	268:  {region: 0x165, script: 0x57, flags: 0x0},
+	269:  {region: 0x60, script: 0x57, flags: 0x0},
+	270:  {region: 0x165, script: 0x57, flags: 0x0},
+	271:  {region: 0x49, script: 0x57, flags: 0x0},
+	272:  {region: 0x165, script: 0x57, flags: 0x0},
+	273:  {region: 0x165, script: 0x57, flags: 0x0},
+	274:  {region: 0x165, script: 0x57, flags: 0x0},
+	275:  {region: 0x165, script: 0x5, flags: 0x0},
+	276:  {region: 0x49, script: 0x57, flags: 0x0},
+	277:  {region: 0x165, script: 0x57, flags: 0x0},
+	278:  {region: 0x165, script: 0x57, flags: 0x0},
+	279:  {region: 0xd4, script: 0x57, flags: 0x0},
+	280:  {region: 0x4f, script: 0x57, flags: 0x0},
+	281:  {region: 0x165, script: 0x57, flags: 0x0},
+	282:  {region: 0x99, script: 0x5, flags: 0x0},
+	283:  {region: 0x165, script: 0x57, flags: 0x0},
+	284:  {region: 0x165, script: 0x57, flags: 0x0},
+	285:  {region: 0x165, script: 0x57, flags: 0x0},
+	286:  {region: 0x165, script: 0x29, flags: 0x0},
+	287:  {region: 0x60, script: 0x57, flags: 0x0},
+	288:  {region: 0xc3, script: 0x57, flags: 0x0},
+	289:  {region: 0xd0, script: 0x57, flags: 0x0},
+	290:  {region: 0x165, script: 0x57, flags: 0x0},
+	291:  {region: 0xdb, script: 0x21, flags: 0x0},
+	292:  {region: 0x52, script: 0x57, flags: 0x0},
+	293:  {region: 0x165, script: 0x57, flags: 0x0},
+	294:  {region: 0x165, script: 0x57, flags: 0x0},
+	295:  {region: 0x165, script: 0x57, flags: 0x0},
+	296:  {region: 0xcd, script: 0xde, flags: 0x0},
+	297:  {region: 0x165, script: 0x57, flags: 0x0},
+	298:  {region: 0x165, script: 0x57, flags: 0x0},
+	299:  {region: 0x114, script: 0x57, flags: 0x0},
+	300:  {region: 0x37, script: 0x57, flags: 0x0},
+	301:  {region: 0x43, script: 0xe0, flags: 0x0},
+	302:  {region: 0x165, script: 0x57, flags: 0x0},
+	303:  {region: 0xa4, script: 0x57, flags: 0x0},
+	304:  {region: 0x80, script: 0x57, flags: 0x0},
+	305:  {region: 0xd6, script: 0x57, flags: 0x0},
+	306:  {region: 0x9e, script: 0x57, flags: 0x0},
+	307:  {region: 0x6b, script: 0x27, flags: 0x0},
+	308:  {region: 0x165, script: 0x57, flags: 0x0},
+	309:  {region: 0xc4, script: 0x48, flags: 0x0},
+	310:  {region: 0x87, script: 0x31, flags: 0x0},
+	311:  {region: 0x165, script: 0x57, flags: 0x0},
+	312:  {region: 0x165, script: 0x57, flags: 0x0},
+	313:  {region: 0xa, script: 0x2, flags: 0x1},
+	314:  {region: 0x165, script: 0x57, flags: 0x0},
+	315:  {region: 0x165, script: 0x57, flags: 0x0},
+	316:  {region: 0x1, script: 0x57, flags: 0x0},
+	317:  {region: 0x165, script: 0x57, flags: 0x0},
+	318:  {region: 0x6e, script: 0x57, flags: 0x0},
+	319:  {region: 0x135, script: 0x57, flags: 0x0},
+	320:  {region: 0x6a, script: 0x57, flags: 0x0},
+	321:  {region: 0x165, script: 0x57, flags: 0x0},
+	322:  {region: 0x9e, script: 0x43, flags: 0x0},
+	323:  {region: 0x165, script: 0x57, flags: 0x0},
+	324:  {region: 0x165, script: 0x57, flags: 0x0},
+	325:  {region: 0x6e, script: 0x57, flags: 0x0},
+	326:  {region: 0x52, script: 0x57, flags: 0x0},
+	327:  {region: 0x6e, script: 0x57, flags: 0x0},
+	328:  {region: 0x9c, script: 0x5, flags: 0x0},
+	329:  {region: 0x165, script: 0x57, flags: 0x0},
+	330:  {region: 0x165, script: 0x57, flags: 0x0},
+	331:  {region: 0x165, script: 0x57, flags: 0x0},
+	332:  {region: 0x165, script: 0x57, flags: 0x0},
+	333:  {region: 0x86, script: 0x57, flags: 0x0},
+	334:  {region: 0xc, script: 0x2, flags: 0x1},
+	335:  {region: 0x165, script: 0x57, flags: 0x0},
+	336:  {region: 0xc3, script: 0x57, flags: 0x0},
+	337:  {region: 0x72, script: 0x57, flags: 0x0},
+	338:  {region: 0x10b, script: 0x5, flags: 0x0},
+	339:  {region: 0xe7, script: 0x57, flags: 0x0},
+	340:  {region: 0x10c, script: 0x57, flags: 0x0},
+	341:  {region: 0x73, script: 0x57, flags: 0x0},
+	342:  {region: 0x165, script: 0x57, flags: 0x0},
+	343:  {region: 0x165, script: 0x57, flags: 0x0},
+	344:  {region: 0x76, script: 0x57, flags: 0x0},
+	345:  {region: 0x165, script: 0x57, flags: 0x0},
+	346:  {region: 0x3b, script: 0x57, flags: 0x0},
+	347:  {region: 0x165, script: 0x57, flags: 0x0},
+	348:  {region: 0x165, script: 0x57, flags: 0x0},
+	349:  {region: 0x165, script: 0x57, flags: 0x0},
+	350:  {region: 0x78, script: 0x57, flags: 0x0},
+	351:  {region: 0x135, script: 0x57, flags: 0x0},
+	352:  {region: 0x78, script: 0x57, flags: 0x0},
+	353:  {region: 0x60, script: 0x57, flags: 0x0},
+	354:  {region: 0x60, script: 0x57, flags: 0x0},
+	355:  {region: 0x52, script: 0x5, flags: 0x0},
+	356:  {region: 0x140, script: 0x57, flags: 0x0},
+	357:  {region: 0x165, script: 0x57, flags: 0x0},
+	358:  {region: 0x84, script: 0x57, flags: 0x0},
+	359:  {region: 0x165, script: 0x57, flags: 0x0},
+	360:  {region: 0xd4, script: 0x57, flags: 0x0},
+	361:  {region: 0x9e, script: 0x57, flags: 0x0},
+	362:  {region: 0xd6, script: 0x57, flags: 0x0},
+	363:  {region: 0x165, script: 0x57, flags: 0x0},
+	364:  {region: 0x10b, script: 0x57, flags: 0x0},
+	365:  {region: 0xd9, script: 0x57, flags: 0x0},
+	366:  {region: 0x96, script: 0x57, flags: 0x0},
+	367:  {region: 0x80, script: 0x57, flags: 0x0},
+	368:  {region: 0x165, script: 0x57, flags: 0x0},
+	369:  {region: 0xbc, script: 0x57, flags: 0x0},
+	370:  {region: 0x165, script: 0x57, flags: 0x0},
+	371:  {region: 0x165, script: 0x57, flags: 0x0},
+	372:  {region: 0x165, script: 0x57, flags: 0x0},
+	373:  {region: 0x53, script: 0x38, flags: 0x0},
+	374:  {region: 0x165, script: 0x57, flags: 0x0},
+	375:  {region: 0x95, script: 0x57, flags: 0x0},
+	376:  {region: 0x165, script: 0x57, flags: 0x0},
+	377:  {region: 0x165, script: 0x57, flags: 0x0},
+	378:  {region: 0x99, script: 0x21, flags: 0x0},
+	379:  {region: 0x165, script: 0x57, flags: 0x0},
+	380:  {region: 0x9c, script: 0x5, flags: 0x0},
+	381:  {region: 0x7e, script: 0x57, flags: 0x0},
+	382:  {region: 0x7b, script: 0x57, flags: 0x0},
+	383:  {region: 0x165, script: 0x57, flags: 0x0},
+	384:  {region: 0x165, script: 0x57, flags: 0x0},
+	385:  {region: 0x165, script: 0x57, flags: 0x0},
+	386:  {region: 0x165, script: 0x57, flags: 0x0},
+	387:  {region: 0x165, script: 0x57, flags: 0x0},
+	388:  {region: 0x165, script: 0x57, flags: 0x0},
+	389:  {region: 0x6f, script: 0x29, flags: 0x0},
+	390:  {region: 0x165, script: 0x57, flags: 0x0},
+	391:  {region: 0xdb, script: 0x21, flags: 0x0},
+	392:  {region: 0x165, script: 0x57, flags: 0x0},
+	393:  {region: 0xa7, script: 0x57, flags: 0x0},
+	394:  {region: 0x165, script: 0x57, flags: 0x0},
+	395:  {region: 0xe8, script: 0x5, flags: 0x0},
+	396:  {region: 0x165, script: 0x57, flags: 0x0},
+	397:  {region: 0xe8, script: 0x5, flags: 0x0},
+	398:  {region: 0x165, script: 0x57, flags: 0x0},
+	399:  {region: 0x165, script: 0x57, flags: 0x0},
+	400:  {region: 0x6e, script: 0x57, flags: 0x0},
+	401:  {region: 0x9c, script: 0x5, flags: 0x0},
+	402:  {region: 0x165, script: 0x57, flags: 0x0},
+	403:  {region: 0x165, script: 0x29, flags: 0x0},
+	404:  {region: 0xf1, script: 0x57, flags: 0x0},
+	405:  {region: 0x165, script: 0x57, flags: 0x0},
+	406:  {region: 0x165, script: 0x57, flags: 0x0},
+	407:  {region: 0x165, script: 0x57, flags: 0x0},
+	408:  {region: 0x165, script: 0x29, flags: 0x0},
+	409:  {region: 0x165, script: 0x57, flags: 0x0},
+	410:  {region: 0x99, script: 0x21, flags: 0x0},
+	411:  {region: 0x99, script: 0xda, flags: 0x0},
+	412:  {region: 0x95, script: 0x57, flags: 0x0},
+	413:  {region: 0xd9, script: 0x57, flags: 0x0},
+	414:  {region: 0x130, script: 0x2f, flags: 0x0},
+	415:  {region: 0x165, script: 0x57, flags: 0x0},
+	416:  {region: 0xe, script: 0x2, flags: 0x1},
+	417:  {region: 0x99, script: 0xe, flags: 0x0},
+	418:  {region: 0x165, script: 0x57, flags: 0x0},
+	419:  {region: 0x4e, script: 0x57, flags: 0x0},
+	420:  {region: 0x99, script: 0x32, flags: 0x0},
+	421:  {region: 0x41, script: 0x57, flags: 0x0},
+	422:  {region: 0x54, script: 0x57, flags: 0x0},
+	423:  {region: 0x165, script: 0x57, flags: 0x0},
+	424:  {region: 0x80, script: 0x57, flags: 0x0},
+	425:  {region: 0x165, script: 0x57, flags: 0x0},
+	426:  {region: 0x165, script: 0x57, flags: 0x0},
+	427:  {region: 0xa4, script: 0x57, flags: 0x0},
+	428:  {region: 0x98, script: 0x57, flags: 0x0},
+	429:  {region: 0x165, script: 0x57, flags: 0x0},
+	430:  {region: 0xdb, script: 0x21, flags: 0x0},
+	431:  {region: 0x165, script: 0x57, flags: 0x0},
+	432:  {region: 0x165, script: 0x5, flags: 0x0},
+	433:  {region: 0x49, script: 0x57, flags: 0x0},
+	434:  {region: 0x165, script: 0x5, flags: 0x0},
+	435:  {region: 0x165, script: 0x57, flags: 0x0},
+	436:  {region: 0x10, script: 0x3, flags: 0x1},
+	437:  {region: 0x165, script: 0x57, flags: 0x0},
+	438:  {region: 0x53, script: 0x38, flags: 0x0},
+	439:  {region: 0x165, script: 0x57, flags: 0x0},
+	440:  {region: 0x135, script: 0x57, flags: 0x0},
+	441:  {region: 0x24, script: 0x5, flags: 0x0},
+	442:  {region: 0x165, script: 0x57, flags: 0x0},
+	443:  {region: 0x165, script: 0x29, flags: 0x0},
+	444:  {region: 0x97, script: 0x3b, flags: 0x0},
+	445:  {region: 0x165, script: 0x57, flags: 0x0},
+	446:  {region: 0x99, script: 0x21, flags: 0x0},
+	447:  {region: 0x165, script: 0x57, flags: 0x0},
+	448:  {region: 0x73, script: 0x57, flags: 0x0},
+	449:  {region: 0x165, script: 0x57, flags: 0x0},
+	450:  {region: 0x165, script: 0x57, flags: 0x0},
+	451:  {region: 0xe7, script: 0x57, flags: 0x0},
+	452:  {region: 0x165, script: 0x57, flags: 0x0},
+	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
+	454:  {region: 0x53, script: 0x89, flags: 0x0},
+	455:  {region: 0x165, script: 0x57, flags: 0x0},
+	456:  {region: 0xe8, script: 0x5, flags: 0x0},
+	457:  {region: 0x99, script: 0x21, flags: 0x0},
+	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
+	459:  {region: 0xe7, script: 0x57, flags: 0x0},
+	460:  {region: 0xe8, script: 0x5, flags: 0x0},
+	461:  {region: 0xe6, script: 0x57, flags: 0x0},
+	462:  {region: 0x99, script: 0x21, flags: 0x0},
+	463:  {region: 0x99, script: 0x21, flags: 0x0},
+	464:  {region: 0x165, script: 0x57, flags: 0x0},
+	465:  {region: 0x90, script: 0x57, flags: 0x0},
+	466:  {region: 0x60, script: 0x57, flags: 0x0},
+	467:  {region: 0x53, script: 0x38, flags: 0x0},
+	468:  {region: 0x91, script: 0x57, flags: 0x0},
+	469:  {region: 0x92, script: 0x57, flags: 0x0},
+	470:  {region: 0x165, script: 0x57, flags: 0x0},
+	471:  {region: 0x28, script: 0x8, flags: 0x0},
+	472:  {region: 0xd2, script: 0x57, flags: 0x0},
+	473:  {region: 0x78, script: 0x57, flags: 0x0},
+	474:  {region: 0x165, script: 0x57, flags: 0x0},
+	475:  {region: 0x165, script: 0x57, flags: 0x0},
+	476:  {region: 0xd0, script: 0x57, flags: 0x0},
+	477:  {region: 0xd6, script: 0x57, flags: 0x0},
+	478:  {region: 0x165, script: 0x57, flags: 0x0},
+	479:  {region: 0x165, script: 0x57, flags: 0x0},
+	480:  {region: 0x165, script: 0x57, flags: 0x0},
+	481:  {region: 0x95, script: 0x57, flags: 0x0},
+	482:  {region: 0x165, script: 0x57, flags: 0x0},
+	483:  {region: 0x165, script: 0x57, flags: 0x0},
+	484:  {region: 0x165, script: 0x57, flags: 0x0},
+	486:  {region: 0x122, script: 0x57, flags: 0x0},
+	487:  {region: 0xd6, script: 0x57, flags: 0x0},
+	488:  {region: 0x165, script: 0x57, flags: 0x0},
+	489:  {region: 0x165, script: 0x57, flags: 0x0},
+	490:  {region: 0x53, script: 0xea, flags: 0x0},
+	491:  {region: 0x165, script: 0x57, flags: 0x0},
+	492:  {region: 0x135, script: 0x57, flags: 0x0},
+	493:  {region: 0x165, script: 0x57, flags: 0x0},
+	494:  {region: 0x49, script: 0x57, flags: 0x0},
+	495:  {region: 0x165, script: 0x57, flags: 0x0},
+	496:  {region: 0x165, script: 0x57, flags: 0x0},
+	497:  {region: 0xe7, script: 0x57, flags: 0x0},
+	498:  {region: 0x165, script: 0x57, flags: 0x0},
+	499:  {region: 0x95, script: 0x57, flags: 0x0},
+	500:  {region: 0x106, script: 0x1f, flags: 0x0},
+	501:  {region: 0x1, script: 0x57, flags: 0x0},
+	502:  {region: 0x165, script: 0x57, flags: 0x0},
+	503:  {region: 0x165, script: 0x57, flags: 0x0},
+	504:  {region: 0x9d, script: 0x57, flags: 0x0},
+	505:  {region: 0x9e, script: 0x57, flags: 0x0},
+	506:  {region: 0x49, script: 0x17, flags: 0x0},
+	507:  {region: 0x97, script: 0x3b, flags: 0x0},
+	508:  {region: 0x165, script: 0x57, flags: 0x0},
+	509:  {region: 0x165, script: 0x57, flags: 0x0},
+	510:  {region: 0x106, script: 0x57, flags: 0x0},
+	511:  {region: 0x165, script: 0x57, flags: 0x0},
+	512:  {region: 0xa2, script: 0x46, flags: 0x0},
+	513:  {region: 0x165, script: 0x57, flags: 0x0},
+	514:  {region: 0xa0, script: 0x57, flags: 0x0},
+	515:  {region: 0x1, script: 0x57, flags: 0x0},
+	516:  {region: 0x165, script: 0x57, flags: 0x0},
+	517:  {region: 0x165, script: 0x57, flags: 0x0},
+	518:  {region: 0x165, script: 0x57, flags: 0x0},
+	519:  {region: 0x52, script: 0x57, flags: 0x0},
+	520:  {region: 0x130, script: 0x3b, flags: 0x0},
+	521:  {region: 0x165, script: 0x57, flags: 0x0},
+	522:  {region: 0x12f, script: 0x57, flags: 0x0},
+	523:  {region: 0xdb, script: 0x21, flags: 0x0},
+	524:  {region: 0x165, script: 0x57, flags: 0x0},
+	525:  {region: 0x63, script: 0x57, flags: 0x0},
+	526:  {region: 0x95, script: 0x57, flags: 0x0},
+	527:  {region: 0x95, script: 0x57, flags: 0x0},
+	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
+	529:  {region: 0x137, script: 0x1f, flags: 0x0},
+	530:  {region: 0x67, script: 0x57, flags: 0x0},
+	531:  {region: 0xc4, script: 0x57, flags: 0x0},
+	532:  {region: 0x165, script: 0x57, flags: 0x0},
+	533:  {region: 0x165, script: 0x57, flags: 0x0},
+	534:  {region: 0xd6, script: 0x57, flags: 0x0},
+	535:  {region: 0xa4, script: 0x57, flags: 0x0},
+	536:  {region: 0xc3, script: 0x57, flags: 0x0},
+	537:  {region: 0x106, script: 0x1f, flags: 0x0},
+	538:  {region: 0x165, script: 0x57, flags: 0x0},
+	539:  {region: 0x165, script: 0x57, flags: 0x0},
+	540:  {region: 0x165, script: 0x57, flags: 0x0},
+	541:  {region: 0x165, script: 0x57, flags: 0x0},
+	542:  {region: 0xd4, script: 0x5, flags: 0x0},
+	543:  {region: 0xd6, script: 0x57, flags: 0x0},
+	544:  {region: 0x164, script: 0x57, flags: 0x0},
+	545:  {region: 0x165, script: 0x57, flags: 0x0},
+	546:  {region: 0x165, script: 0x57, flags: 0x0},
+	547:  {region: 0x12f, script: 0x57, flags: 0x0},
+	548:  {region: 0x122, script: 0x5, flags: 0x0},
+	549:  {region: 0x165, script: 0x57, flags: 0x0},
+	550:  {region: 0x123, script: 0xdf, flags: 0x0},
+	551:  {region: 0x5a, script: 0x57, flags: 0x0},
+	552:  {region: 0x52, script: 0x57, flags: 0x0},
+	553:  {region: 0x165, script: 0x57, flags: 0x0},
+	554:  {region: 0x4f, script: 0x57, flags: 0x0},
+	555:  {region: 0x99, script: 0x21, flags: 0x0},
+	556:  {region: 0x99, script: 0x21, flags: 0x0},
+	557:  {region: 0x4b, script: 0x57, flags: 0x0},
+	558:  {region: 0x95, script: 0x57, flags: 0x0},
+	559:  {region: 0x165, script: 0x57, flags: 0x0},
+	560:  {region: 0x41, script: 0x57, flags: 0x0},
+	561:  {region: 0x99, script: 0x57, flags: 0x0},
+	562:  {region: 0x53, script: 0xd6, flags: 0x0},
+	563:  {region: 0x99, script: 0x21, flags: 0x0},
+	564:  {region: 0xc3, script: 0x57, flags: 0x0},
+	565:  {region: 0x165, script: 0x57, flags: 0x0},
+	566:  {region: 0x99, script: 0x72, flags: 0x0},
+	567:  {region: 0xe8, script: 0x5, flags: 0x0},
+	568:  {region: 0x165, script: 0x57, flags: 0x0},
+	569:  {region: 0xa4, script: 0x57, flags: 0x0},
+	570:  {region: 0x165, script: 0x57, flags: 0x0},
+	571:  {region: 0x12b, script: 0x57, flags: 0x0},
+	572:  {region: 0x165, script: 0x57, flags: 0x0},
+	573:  {region: 0xd2, script: 0x57, flags: 0x0},
+	574:  {region: 0x165, script: 0x57, flags: 0x0},
+	575:  {region: 0xaf, script: 0x54, flags: 0x0},
+	576:  {region: 0x165, script: 0x57, flags: 0x0},
+	577:  {region: 0x165, script: 0x57, flags: 0x0},
+	578:  {region: 0x13, script: 0x6, flags: 0x1},
+	579:  {region: 0x165, script: 0x57, flags: 0x0},
+	580:  {region: 0x52, script: 0x57, flags: 0x0},
+	581:  {region: 0x82, script: 0x57, flags: 0x0},
+	582:  {region: 0xa4, script: 0x57, flags: 0x0},
+	583:  {region: 0x165, script: 0x57, flags: 0x0},
+	584:  {region: 0x165, script: 0x57, flags: 0x0},
+	585:  {region: 0x165, script: 0x57, flags: 0x0},
+	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
+	587:  {region: 0x2a, script: 0x57, flags: 0x0},
+	588:  {region: 0x165, script: 0x57, flags: 0x0},
+	589:  {region: 0x165, script: 0x57, flags: 0x0},
+	590:  {region: 0x165, script: 0x57, flags: 0x0},
+	591:  {region: 0x165, script: 0x57, flags: 0x0},
+	592:  {region: 0x165, script: 0x57, flags: 0x0},
+	593:  {region: 0x99, script: 0x4f, flags: 0x0},
+	594:  {region: 0x8b, script: 0x57, flags: 0x0},
+	595:  {region: 0x165, script: 0x57, flags: 0x0},
+	596:  {region: 0xab, script: 0x50, flags: 0x0},
+	597:  {region: 0x106, script: 0x1f, flags: 0x0},
+	598:  {region: 0x99, script: 0x21, flags: 0x0},
+	599:  {region: 0x165, script: 0x57, flags: 0x0},
+	600:  {region: 0x75, script: 0x57, flags: 0x0},
+	601:  {region: 0x165, script: 0x57, flags: 0x0},
+	602:  {region: 0xb4, script: 0x57, flags: 0x0},
+	603:  {region: 0x165, script: 0x57, flags: 0x0},
+	604:  {region: 0x165, script: 0x57, flags: 0x0},
+	605:  {region: 0x165, script: 0x57, flags: 0x0},
+	606:  {region: 0x165, script: 0x57, flags: 0x0},
+	607:  {region: 0x165, script: 0x57, flags: 0x0},
+	608:  {region: 0x165, script: 0x57, flags: 0x0},
+	609:  {region: 0x165, script: 0x57, flags: 0x0},
+	610:  {region: 0x165, script: 0x29, flags: 0x0},
+	611:  {region: 0x165, script: 0x57, flags: 0x0},
+	612:  {region: 0x106, script: 0x1f, flags: 0x0},
+	613:  {region: 0x112, script: 0x57, flags: 0x0},
+	614:  {region: 0xe7, script: 0x57, flags: 0x0},
+	615:  {region: 0x106, script: 0x57, flags: 0x0},
+	616:  {region: 0x165, script: 0x57, flags: 0x0},
+	617:  {region: 0x99, script: 0x21, flags: 0x0},
+	618:  {region: 0x99, script: 0x5, flags: 0x0},
+	619:  {region: 0x12f, script: 0x57, flags: 0x0},
+	620:  {region: 0x165, script: 0x57, flags: 0x0},
+	621:  {region: 0x52, script: 0x57, flags: 0x0},
+	622:  {region: 0x60, script: 0x57, flags: 0x0},
+	623:  {region: 0x165, script: 0x57, flags: 0x0},
+	624:  {region: 0x165, script: 0x57, flags: 0x0},
+	625:  {region: 0x165, script: 0x29, flags: 0x0},
+	626:  {region: 0x165, script: 0x57, flags: 0x0},
+	627:  {region: 0x165, script: 0x57, flags: 0x0},
+	628:  {region: 0x19, script: 0x3, flags: 0x1},
+	629:  {region: 0x165, script: 0x57, flags: 0x0},
+	630:  {region: 0x165, script: 0x57, flags: 0x0},
+	631:  {region: 0x165, script: 0x57, flags: 0x0},
+	632:  {region: 0x165, script: 0x57, flags: 0x0},
+	633:  {region: 0x106, script: 0x1f, flags: 0x0},
+	634:  {region: 0x165, script: 0x57, flags: 0x0},
+	635:  {region: 0x165, script: 0x57, flags: 0x0},
+	636:  {region: 0x165, script: 0x57, flags: 0x0},
+	637:  {region: 0x106, script: 0x1f, flags: 0x0},
+	638:  {region: 0x165, script: 0x57, flags: 0x0},
+	639:  {region: 0x95, script: 0x57, flags: 0x0},
+	640:  {region: 0xe8, script: 0x5, flags: 0x0},
+	641:  {region: 0x7b, script: 0x57, flags: 0x0},
+	642:  {region: 0x165, script: 0x57, flags: 0x0},
+	643:  {region: 0x165, script: 0x57, flags: 0x0},
+	644:  {region: 0x165, script: 0x57, flags: 0x0},
+	645:  {region: 0x165, script: 0x29, flags: 0x0},
+	646:  {region: 0x123, script: 0xdf, flags: 0x0},
+	647:  {region: 0xe8, script: 0x5, flags: 0x0},
+	648:  {region: 0x165, script: 0x57, flags: 0x0},
+	649:  {region: 0x165, script: 0x57, flags: 0x0},
+	650:  {region: 0x1c, script: 0x5, flags: 0x1},
+	651:  {region: 0x165, script: 0x57, flags: 0x0},
+	652:  {region: 0x165, script: 0x57, flags: 0x0},
+	653:  {region: 0x165, script: 0x57, flags: 0x0},
+	654:  {region: 0x138, script: 0x57, flags: 0x0},
+	655:  {region: 0x87, script: 0x5b, flags: 0x0},
+	656:  {region: 0x97, script: 0x3b, flags: 0x0},
+	657:  {region: 0x12f, script: 0x57, flags: 0x0},
+	658:  {region: 0xe8, script: 0x5, flags: 0x0},
+	659:  {region: 0x131, script: 0x57, flags: 0x0},
+	660:  {region: 0x165, script: 0x57, flags: 0x0},
+	661:  {region: 0xb7, script: 0x57, flags: 0x0},
+	662:  {region: 0x106, script: 0x1f, flags: 0x0},
+	663:  {region: 0x165, script: 0x57, flags: 0x0},
+	664:  {region: 0x95, script: 0x57, flags: 0x0},
+	665:  {region: 0x165, script: 0x57, flags: 0x0},
+	666:  {region: 0x53, script: 0xdf, flags: 0x0},
+	667:  {region: 0x165, script: 0x57, flags: 0x0},
+	668:  {region: 0x165, script: 0x57, flags: 0x0},
+	669:  {region: 0x165, script: 0x57, flags: 0x0},
+	670:  {region: 0x165, script: 0x57, flags: 0x0},
+	671:  {region: 0x99, script: 0x59, flags: 0x0},
+	672:  {region: 0x165, script: 0x57, flags: 0x0},
+	673:  {region: 0x165, script: 0x57, flags: 0x0},
+	674:  {region: 0x106, script: 0x1f, flags: 0x0},
+	675:  {region: 0x131, script: 0x57, flags: 0x0},
+	676:  {region: 0x165, script: 0x57, flags: 0x0},
+	677:  {region: 0xd9, script: 0x57, flags: 0x0},
+	678:  {region: 0x165, script: 0x57, flags: 0x0},
+	679:  {region: 0x165, script: 0x57, flags: 0x0},
+	680:  {region: 0x21, script: 0x2, flags: 0x1},
+	681:  {region: 0x165, script: 0x57, flags: 0x0},
+	682:  {region: 0x165, script: 0x57, flags: 0x0},
+	683:  {region: 0x9e, script: 0x57, flags: 0x0},
+	684:  {region: 0x53, script: 0x5d, flags: 0x0},
+	685:  {region: 0x95, script: 0x57, flags: 0x0},
+	686:  {region: 0x9c, script: 0x5, flags: 0x0},
+	687:  {region: 0x135, script: 0x57, flags: 0x0},
+	688:  {region: 0x165, script: 0x57, flags: 0x0},
+	689:  {region: 0x165, script: 0x57, flags: 0x0},
+	690:  {region: 0x99, script: 0xda, flags: 0x0},
+	691:  {region: 0x9e, script: 0x57, flags: 0x0},
+	692:  {region: 0x165, script: 0x57, flags: 0x0},
+	693:  {region: 0x4b, script: 0x57, flags: 0x0},
+	694:  {region: 0x165, script: 0x57, flags: 0x0},
+	695:  {region: 0x165, script: 0x57, flags: 0x0},
+	696:  {region: 0xaf, script: 0x54, flags: 0x0},
+	697:  {region: 0x165, script: 0x57, flags: 0x0},
+	698:  {region: 0x165, script: 0x57, flags: 0x0},
+	699:  {region: 0x4b, script: 0x57, flags: 0x0},
+	700:  {region: 0x165, script: 0x57, flags: 0x0},
+	701:  {region: 0x165, script: 0x57, flags: 0x0},
+	702:  {region: 0x162, script: 0x57, flags: 0x0},
+	703:  {region: 0x9c, script: 0x5, flags: 0x0},
+	704:  {region: 0xb6, script: 0x57, flags: 0x0},
+	705:  {region: 0xb8, script: 0x57, flags: 0x0},
+	706:  {region: 0x4b, script: 0x57, flags: 0x0},
+	707:  {region: 0x4b, script: 0x57, flags: 0x0},
+	708:  {region: 0xa4, script: 0x57, flags: 0x0},
+	709:  {region: 0xa4, script: 0x57, flags: 0x0},
+	710:  {region: 0x9c, script: 0x5, flags: 0x0},
+	711:  {region: 0xb8, script: 0x57, flags: 0x0},
+	712:  {region: 0x123, script: 0xdf, flags: 0x0},
+	713:  {region: 0x53, script: 0x38, flags: 0x0},
+	714:  {region: 0x12b, script: 0x57, flags: 0x0},
+	715:  {region: 0x95, script: 0x57, flags: 0x0},
+	716:  {region: 0x52, script: 0x57, flags: 0x0},
+	717:  {region: 0x99, script: 0x21, flags: 0x0},
+	718:  {region: 0x99, script: 0x21, flags: 0x0},
+	719:  {region: 0x95, script: 0x57, flags: 0x0},
+	720:  {region: 0x23, script: 0x3, flags: 0x1},
+	721:  {region: 0xa4, script: 0x57, flags: 0x0},
+	722:  {region: 0x165, script: 0x57, flags: 0x0},
+	723:  {region: 0xcf, script: 0x57, flags: 0x0},
+	724:  {region: 0x165, script: 0x57, flags: 0x0},
+	725:  {region: 0x165, script: 0x57, flags: 0x0},
+	726:  {region: 0x165, script: 0x57, flags: 0x0},
+	727:  {region: 0x165, script: 0x57, flags: 0x0},
+	728:  {region: 0x165, script: 0x57, flags: 0x0},
+	729:  {region: 0x165, script: 0x57, flags: 0x0},
+	730:  {region: 0x165, script: 0x57, flags: 0x0},
+	731:  {region: 0x165, script: 0x57, flags: 0x0},
+	732:  {region: 0x165, script: 0x57, flags: 0x0},
+	733:  {region: 0x165, script: 0x57, flags: 0x0},
+	734:  {region: 0x165, script: 0x57, flags: 0x0},
+	735:  {region: 0x165, script: 0x5, flags: 0x0},
+	736:  {region: 0x106, script: 0x1f, flags: 0x0},
+	737:  {region: 0xe7, script: 0x57, flags: 0x0},
+	738:  {region: 0x165, script: 0x57, flags: 0x0},
+	739:  {region: 0x95, script: 0x57, flags: 0x0},
+	740:  {region: 0x165, script: 0x29, flags: 0x0},
+	741:  {region: 0x165, script: 0x57, flags: 0x0},
+	742:  {region: 0x165, script: 0x57, flags: 0x0},
+	743:  {region: 0x165, script: 0x57, flags: 0x0},
+	744:  {region: 0x112, script: 0x57, flags: 0x0},
+	745:  {region: 0xa4, script: 0x57, flags: 0x0},
+	746:  {region: 0x165, script: 0x57, flags: 0x0},
+	747:  {region: 0x165, script: 0x57, flags: 0x0},
+	748:  {region: 0x123, script: 0x5, flags: 0x0},
+	749:  {region: 0xcc, script: 0x57, flags: 0x0},
+	750:  {region: 0x165, script: 0x57, flags: 0x0},
+	751:  {region: 0x165, script: 0x57, flags: 0x0},
+	752:  {region: 0x165, script: 0x57, flags: 0x0},
+	753:  {region: 0xbf, script: 0x57, flags: 0x0},
+	754:  {region: 0xd1, script: 0x57, flags: 0x0},
+	755:  {region: 0x165, script: 0x57, flags: 0x0},
+	756:  {region: 0x52, script: 0x57, flags: 0x0},
+	757:  {region: 0xdb, script: 0x21, flags: 0x0},
+	758:  {region: 0x12f, script: 0x57, flags: 0x0},
+	759:  {region: 0xc0, script: 0x57, flags: 0x0},
+	760:  {region: 0x165, script: 0x57, flags: 0x0},
+	761:  {region: 0x165, script: 0x57, flags: 0x0},
+	762:  {region: 0xe0, script: 0x57, flags: 0x0},
+	763:  {region: 0x165, script: 0x57, flags: 0x0},
+	764:  {region: 0x95, script: 0x57, flags: 0x0},
+	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
+	766:  {region: 0x165, script: 0x57, flags: 0x0},
+	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
+	768:  {region: 0x165, script: 0x5, flags: 0x0},
+	769:  {region: 0x165, script: 0x57, flags: 0x0},
+	770:  {region: 0x165, script: 0x57, flags: 0x0},
+	771:  {region: 0x165, script: 0x57, flags: 0x0},
+	772:  {region: 0x99, script: 0x6b, flags: 0x0},
+	773:  {region: 0x165, script: 0x57, flags: 0x0},
+	774:  {region: 0x165, script: 0x57, flags: 0x0},
+	775:  {region: 0x10b, script: 0x57, flags: 0x0},
+	776:  {region: 0x165, script: 0x57, flags: 0x0},
+	777:  {region: 0x165, script: 0x57, flags: 0x0},
+	778:  {region: 0x165, script: 0x57, flags: 0x0},
+	779:  {region: 0x26, script: 0x3, flags: 0x1},
+	780:  {region: 0x165, script: 0x57, flags: 0x0},
+	781:  {region: 0x165, script: 0x57, flags: 0x0},
+	782:  {region: 0x99, script: 0xe, flags: 0x0},
+	783:  {region: 0xc4, script: 0x72, flags: 0x0},
+	785:  {region: 0x165, script: 0x57, flags: 0x0},
+	786:  {region: 0x49, script: 0x57, flags: 0x0},
+	787:  {region: 0x49, script: 0x57, flags: 0x0},
+	788:  {region: 0x37, script: 0x57, flags: 0x0},
+	789:  {region: 0x165, script: 0x57, flags: 0x0},
+	790:  {region: 0x165, script: 0x57, flags: 0x0},
+	791:  {region: 0x165, script: 0x57, flags: 0x0},
+	792:  {region: 0x165, script: 0x57, flags: 0x0},
+	793:  {region: 0x165, script: 0x57, flags: 0x0},
+	794:  {region: 0x165, script: 0x57, flags: 0x0},
+	795:  {region: 0x99, script: 0x21, flags: 0x0},
+	796:  {region: 0xdb, script: 0x21, flags: 0x0},
+	797:  {region: 0x106, script: 0x1f, flags: 0x0},
+	798:  {region: 0x35, script: 0x6f, flags: 0x0},
+	799:  {region: 0x29, script: 0x3, flags: 0x1},
+	800:  {region: 0xcb, script: 0x57, flags: 0x0},
+	801:  {region: 0x165, script: 0x57, flags: 0x0},
+	802:  {region: 0x165, script: 0x57, flags: 0x0},
+	803:  {region: 0x165, script: 0x57, flags: 0x0},
+	804:  {region: 0x99, script: 0x21, flags: 0x0},
+	805:  {region: 0x52, script: 0x57, flags: 0x0},
+	807:  {region: 0x165, script: 0x57, flags: 0x0},
+	808:  {region: 0x135, script: 0x57, flags: 0x0},
+	809:  {region: 0x165, script: 0x57, flags: 0x0},
+	810:  {region: 0x165, script: 0x57, flags: 0x0},
+	811:  {region: 0xe8, script: 0x5, flags: 0x0},
+	812:  {region: 0xc3, script: 0x57, flags: 0x0},
+	813:  {region: 0x99, script: 0x21, flags: 0x0},
+	814:  {region: 0x95, script: 0x57, flags: 0x0},
+	815:  {region: 0x164, script: 0x57, flags: 0x0},
+	816:  {region: 0x165, script: 0x57, flags: 0x0},
+	817:  {region: 0xc4, script: 0x72, flags: 0x0},
+	818:  {region: 0x165, script: 0x57, flags: 0x0},
+	819:  {region: 0x165, script: 0x29, flags: 0x0},
+	820:  {region: 0x106, script: 0x1f, flags: 0x0},
+	821:  {region: 0x165, script: 0x57, flags: 0x0},
+	822:  {region: 0x131, script: 0x57, flags: 0x0},
+	823:  {region: 0x9c, script: 0x63, flags: 0x0},
+	824:  {region: 0x165, script: 0x57, flags: 0x0},
+	825:  {region: 0x165, script: 0x57, flags: 0x0},
+	826:  {region: 0x9c, script: 0x5, flags: 0x0},
+	827:  {region: 0x165, script: 0x57, flags: 0x0},
+	828:  {region: 0x165, script: 0x57, flags: 0x0},
+	829:  {region: 0x165, script: 0x57, flags: 0x0},
+	830:  {region: 0xdd, script: 0x57, flags: 0x0},
+	831:  {region: 0x165, script: 0x57, flags: 0x0},
+	832:  {region: 0x165, script: 0x57, flags: 0x0},
+	834:  {region: 0x165, script: 0x57, flags: 0x0},
+	835:  {region: 0x53, script: 0x38, flags: 0x0},
+	836:  {region: 0x9e, script: 0x57, flags: 0x0},
+	837:  {region: 0xd2, script: 0x57, flags: 0x0},
+	838:  {region: 0x165, script: 0x57, flags: 0x0},
+	839:  {region: 0xda, script: 0x57, flags: 0x0},
+	840:  {region: 0x165, script: 0x57, flags: 0x0},
+	841:  {region: 0x165, script: 0x57, flags: 0x0},
+	842:  {region: 0x165, script: 0x57, flags: 0x0},
+	843:  {region: 0xcf, script: 0x57, flags: 0x0},
+	844:  {region: 0x165, script: 0x57, flags: 0x0},
+	845:  {region: 0x165, script: 0x57, flags: 0x0},
+	846:  {region: 0x164, script: 0x57, flags: 0x0},
+	847:  {region: 0xd1, script: 0x57, flags: 0x0},
+	848:  {region: 0x60, script: 0x57, flags: 0x0},
+	849:  {region: 0xdb, script: 0x21, flags: 0x0},
+	850:  {region: 0x165, script: 0x57, flags: 0x0},
+	851:  {region: 0xdb, script: 0x21, flags: 0x0},
+	852:  {region: 0x165, script: 0x57, flags: 0x0},
+	853:  {region: 0x165, script: 0x57, flags: 0x0},
+	854:  {region: 0xd2, script: 0x57, flags: 0x0},
+	855:  {region: 0x165, script: 0x57, flags: 0x0},
+	856:  {region: 0x165, script: 0x57, flags: 0x0},
+	857:  {region: 0xd1, script: 0x57, flags: 0x0},
+	858:  {region: 0x165, script: 0x57, flags: 0x0},
+	859:  {region: 0xcf, script: 0x57, flags: 0x0},
+	860:  {region: 0xcf, script: 0x57, flags: 0x0},
+	861:  {region: 0x165, script: 0x57, flags: 0x0},
+	862:  {region: 0x165, script: 0x57, flags: 0x0},
+	863:  {region: 0x95, script: 0x57, flags: 0x0},
+	864:  {region: 0x165, script: 0x57, flags: 0x0},
+	865:  {region: 0xdf, script: 0x57, flags: 0x0},
+	866:  {region: 0x165, script: 0x57, flags: 0x0},
+	867:  {region: 0x165, script: 0x57, flags: 0x0},
+	868:  {region: 0x99, script: 0x57, flags: 0x0},
+	869:  {region: 0x165, script: 0x57, flags: 0x0},
+	870:  {region: 0x165, script: 0x57, flags: 0x0},
+	871:  {region: 0xd9, script: 0x57, flags: 0x0},
+	872:  {region: 0x52, script: 0x57, flags: 0x0},
+	873:  {region: 0x165, script: 0x57, flags: 0x0},
+	874:  {region: 0xda, script: 0x57, flags: 0x0},
+	875:  {region: 0x165, script: 0x57, flags: 0x0},
+	876:  {region: 0x52, script: 0x57, flags: 0x0},
+	877:  {region: 0x165, script: 0x57, flags: 0x0},
+	878:  {region: 0x165, script: 0x57, flags: 0x0},
+	879:  {region: 0xda, script: 0x57, flags: 0x0},
+	880:  {region: 0x123, script: 0x53, flags: 0x0},
+	881:  {region: 0x99, script: 0x21, flags: 0x0},
+	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
+	883:  {region: 0x165, script: 0x57, flags: 0x0},
+	884:  {region: 0x165, script: 0x57, flags: 0x0},
+	885:  {region: 0x84, script: 0x78, flags: 0x0},
+	886:  {region: 0x161, script: 0x57, flags: 0x0},
+	887:  {region: 0x165, script: 0x57, flags: 0x0},
+	888:  {region: 0x49, script: 0x17, flags: 0x0},
+	889:  {region: 0x165, script: 0x57, flags: 0x0},
+	890:  {region: 0x161, script: 0x57, flags: 0x0},
+	891:  {region: 0x165, script: 0x57, flags: 0x0},
+	892:  {region: 0x165, script: 0x57, flags: 0x0},
+	893:  {region: 0x165, script: 0x57, flags: 0x0},
+	894:  {region: 0x165, script: 0x57, flags: 0x0},
+	895:  {region: 0x165, script: 0x57, flags: 0x0},
+	896:  {region: 0x117, script: 0x57, flags: 0x0},
+	897:  {region: 0x165, script: 0x57, flags: 0x0},
+	898:  {region: 0x165, script: 0x57, flags: 0x0},
+	899:  {region: 0x135, script: 0x57, flags: 0x0},
+	900:  {region: 0x165, script: 0x57, flags: 0x0},
+	901:  {region: 0x53, script: 0x57, flags: 0x0},
+	902:  {region: 0x165, script: 0x57, flags: 0x0},
+	903:  {region: 0xce, script: 0x57, flags: 0x0},
+	904:  {region: 0x12f, script: 0x57, flags: 0x0},
+	905:  {region: 0x131, script: 0x57, flags: 0x0},
+	906:  {region: 0x80, script: 0x57, flags: 0x0},
+	907:  {region: 0x78, script: 0x57, flags: 0x0},
+	908:  {region: 0x165, script: 0x57, flags: 0x0},
+	910:  {region: 0x165, script: 0x57, flags: 0x0},
+	911:  {region: 0x165, script: 0x57, flags: 0x0},
+	912:  {region: 0x6f, script: 0x57, flags: 0x0},
+	913:  {region: 0x165, script: 0x57, flags: 0x0},
+	914:  {region: 0x165, script: 0x57, flags: 0x0},
+	915:  {region: 0x165, script: 0x57, flags: 0x0},
+	916:  {region: 0x165, script: 0x57, flags: 0x0},
+	917:  {region: 0x99, script: 0x7d, flags: 0x0},
+	918:  {region: 0x165, script: 0x57, flags: 0x0},
+	919:  {region: 0x165, script: 0x5, flags: 0x0},
+	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
+	921:  {region: 0x135, script: 0x7e, flags: 0x0},
+	922:  {region: 0x165, script: 0x5, flags: 0x0},
+	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
+	924:  {region: 0x165, script: 0x57, flags: 0x0},
+	925:  {region: 0x2c, script: 0x3, flags: 0x1},
+	926:  {region: 0xe7, script: 0x57, flags: 0x0},
+	927:  {region: 0x2f, script: 0x2, flags: 0x1},
+	928:  {region: 0xe7, script: 0x57, flags: 0x0},
+	929:  {region: 0x30, script: 0x57, flags: 0x0},
+	930:  {region: 0xf0, script: 0x57, flags: 0x0},
+	931:  {region: 0x165, script: 0x57, flags: 0x0},
+	932:  {region: 0x78, script: 0x57, flags: 0x0},
+	933:  {region: 0xd6, script: 0x57, flags: 0x0},
+	934:  {region: 0x135, script: 0x57, flags: 0x0},
+	935:  {region: 0x49, script: 0x57, flags: 0x0},
+	936:  {region: 0x165, script: 0x57, flags: 0x0},
+	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
+	938:  {region: 0x165, script: 0x57, flags: 0x0},
+	939:  {region: 0x60, script: 0x57, flags: 0x0},
+	940:  {region: 0x165, script: 0x5, flags: 0x0},
+	941:  {region: 0xb0, script: 0x87, flags: 0x0},
+	943:  {region: 0x165, script: 0x57, flags: 0x0},
+	944:  {region: 0x165, script: 0x57, flags: 0x0},
+	945:  {region: 0x99, script: 0x12, flags: 0x0},
+	946:  {region: 0xa4, script: 0x57, flags: 0x0},
+	947:  {region: 0xe9, script: 0x57, flags: 0x0},
+	948:  {region: 0x165, script: 0x57, flags: 0x0},
+	949:  {region: 0x9e, script: 0x57, flags: 0x0},
+	950:  {region: 0x165, script: 0x57, flags: 0x0},
+	951:  {region: 0x165, script: 0x57, flags: 0x0},
+	952:  {region: 0x87, script: 0x31, flags: 0x0},
+	953:  {region: 0x75, script: 0x57, flags: 0x0},
+	954:  {region: 0x165, script: 0x57, flags: 0x0},
+	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
+	956:  {region: 0x9c, script: 0x5, flags: 0x0},
+	957:  {region: 0x1, script: 0x57, flags: 0x0},
+	958:  {region: 0x24, script: 0x5, flags: 0x0},
+	959:  {region: 0x165, script: 0x57, flags: 0x0},
+	960:  {region: 0x41, script: 0x57, flags: 0x0},
+	961:  {region: 0x165, script: 0x57, flags: 0x0},
+	962:  {region: 0x7a, script: 0x57, flags: 0x0},
+	963:  {region: 0x165, script: 0x57, flags: 0x0},
+	964:  {region: 0xe4, script: 0x57, flags: 0x0},
+	965:  {region: 0x89, script: 0x57, flags: 0x0},
+	966:  {region: 0x69, script: 0x57, flags: 0x0},
+	967:  {region: 0x165, script: 0x57, flags: 0x0},
+	968:  {region: 0x99, script: 0x21, flags: 0x0},
+	969:  {region: 0x165, script: 0x57, flags: 0x0},
+	970:  {region: 0x102, script: 0x57, flags: 0x0},
+	971:  {region: 0x95, script: 0x57, flags: 0x0},
+	972:  {region: 0x165, script: 0x57, flags: 0x0},
+	973:  {region: 0x165, script: 0x57, flags: 0x0},
+	974:  {region: 0x9e, script: 0x57, flags: 0x0},
+	975:  {region: 0x165, script: 0x5, flags: 0x0},
+	976:  {region: 0x99, script: 0x57, flags: 0x0},
+	977:  {region: 0x31, script: 0x2, flags: 0x1},
+	978:  {region: 0xdb, script: 0x21, flags: 0x0},
+	979:  {region: 0x35, script: 0xe, flags: 0x0},
+	980:  {region: 0x4e, script: 0x57, flags: 0x0},
+	981:  {region: 0x72, script: 0x57, flags: 0x0},
+	982:  {region: 0x4e, script: 0x57, flags: 0x0},
+	983:  {region: 0x9c, script: 0x5, flags: 0x0},
+	984:  {region: 0x10c, script: 0x57, flags: 0x0},
+	985:  {region: 0x3a, script: 0x57, flags: 0x0},
+	986:  {region: 0x165, script: 0x57, flags: 0x0},
+	987:  {region: 0xd1, script: 0x57, flags: 0x0},
+	988:  {region: 0x104, script: 0x57, flags: 0x0},
+	989:  {region: 0x95, script: 0x57, flags: 0x0},
+	990:  {region: 0x12f, script: 0x57, flags: 0x0},
+	991:  {region: 0x165, script: 0x57, flags: 0x0},
+	992:  {region: 0x165, script: 0x57, flags: 0x0},
+	993:  {region: 0x73, script: 0x57, flags: 0x0},
+	994:  {region: 0x106, script: 0x1f, flags: 0x0},
+	995:  {region: 0x130, script: 0x1f, flags: 0x0},
+	996:  {region: 0x109, script: 0x57, flags: 0x0},
+	997:  {region: 0x107, script: 0x57, flags: 0x0},
+	998:  {region: 0x12f, script: 0x57, flags: 0x0},
+	999:  {region: 0x165, script: 0x57, flags: 0x0},
+	1000: {region: 0xa2, script: 0x49, flags: 0x0},
+	1001: {region: 0x99, script: 0x21, flags: 0x0},
+	1002: {region: 0x80, script: 0x57, flags: 0x0},
+	1003: {region: 0x106, script: 0x1f, flags: 0x0},
+	1004: {region: 0xa4, script: 0x57, flags: 0x0},
+	1005: {region: 0x95, script: 0x57, flags: 0x0},
+	1006: {region: 0x99, script: 0x57, flags: 0x0},
+	1007: {region: 0x114, script: 0x57, flags: 0x0},
+	1008: {region: 0x99, script: 0xc3, flags: 0x0},
+	1009: {region: 0x165, script: 0x57, flags: 0x0},
+	1010: {region: 0x165, script: 0x57, flags: 0x0},
+	1011: {region: 0x12f, script: 0x57, flags: 0x0},
+	1012: {region: 0x9e, script: 0x57, flags: 0x0},
+	1013: {region: 0x99, script: 0x21, flags: 0x0},
+	1014: {region: 0x165, script: 0x5, flags: 0x0},
+	1015: {region: 0x9e, script: 0x57, flags: 0x0},
+	1016: {region: 0x7b, script: 0x57, flags: 0x0},
+	1017: {region: 0x49, script: 0x57, flags: 0x0},
+	1018: {region: 0x33, script: 0x4, flags: 0x1},
+	1019: {region: 0x9e, script: 0x57, flags: 0x0},
+	1020: {region: 0x9c, script: 0x5, flags: 0x0},
+	1021: {region: 0xda, script: 0x57, flags: 0x0},
+	1022: {region: 0x4f, script: 0x57, flags: 0x0},
+	1023: {region: 0xd1, script: 0x57, flags: 0x0},
+	1024: {region: 0xcf, script: 0x57, flags: 0x0},
+	1025: {region: 0xc3, script: 0x57, flags: 0x0},
+	1026: {region: 0x4c, script: 0x57, flags: 0x0},
+	1027: {region: 0x96, script: 0x7a, flags: 0x0},
+	1028: {region: 0xb6, script: 0x57, flags: 0x0},
+	1029: {region: 0x165, script: 0x29, flags: 0x0},
+	1030: {region: 0x165, script: 0x57, flags: 0x0},
+	1032: {region: 0xba, script: 0xdc, flags: 0x0},
+	1033: {region: 0x165, script: 0x57, flags: 0x0},
+	1034: {region: 0xc4, script: 0x72, flags: 0x0},
+	1035: {region: 0x165, script: 0x5, flags: 0x0},
+	1036: {region: 0xb3, script: 0xca, flags: 0x0},
+	1037: {region: 0x6f, script: 0x57, flags: 0x0},
+	1038: {region: 0x165, script: 0x57, flags: 0x0},
+	1039: {region: 0x165, script: 0x57, flags: 0x0},
+	1040: {region: 0x165, script: 0x57, flags: 0x0},
+	1041: {region: 0x165, script: 0x57, flags: 0x0},
+	1042: {region: 0x111, script: 0x57, flags: 0x0},
+	1043: {region: 0x165, script: 0x57, flags: 0x0},
+	1044: {region: 0xe8, script: 0x5, flags: 0x0},
+	1045: {region: 0x165, script: 0x57, flags: 0x0},
+	1046: {region: 0x10f, script: 0x57, flags: 0x0},
+	1047: {region: 0x165, script: 0x57, flags: 0x0},
+	1048: {region: 0xe9, script: 0x57, flags: 0x0},
+	1049: {region: 0x165, script: 0x57, flags: 0x0},
+	1050: {region: 0x95, script: 0x57, flags: 0x0},
+	1051: {region: 0x142, script: 0x57, flags: 0x0},
+	1052: {region: 0x10c, script: 0x57, flags: 0x0},
+	1054: {region: 0x10c, script: 0x57, flags: 0x0},
+	1055: {region: 0x72, script: 0x57, flags: 0x0},
+	1056: {region: 0x97, script: 0xc0, flags: 0x0},
+	1057: {region: 0x165, script: 0x57, flags: 0x0},
+	1058: {region: 0x72, script: 0x57, flags: 0x0},
+	1059: {region: 0x164, script: 0x57, flags: 0x0},
+	1060: {region: 0x165, script: 0x57, flags: 0x0},
+	1061: {region: 0xc3, script: 0x57, flags: 0x0},
+	1062: {region: 0x165, script: 0x57, flags: 0x0},
+	1063: {region: 0x165, script: 0x57, flags: 0x0},
+	1064: {region: 0x165, script: 0x57, flags: 0x0},
+	1065: {region: 0x115, script: 0x57, flags: 0x0},
+	1066: {region: 0x165, script: 0x57, flags: 0x0},
+	1067: {region: 0x165, script: 0x57, flags: 0x0},
+	1068: {region: 0x123, script: 0xdf, flags: 0x0},
+	1069: {region: 0x165, script: 0x57, flags: 0x0},
+	1070: {region: 0x165, script: 0x57, flags: 0x0},
+	1071: {region: 0x165, script: 0x57, flags: 0x0},
+	1072: {region: 0x165, script: 0x57, flags: 0x0},
+	1073: {region: 0x27, script: 0x57, flags: 0x0},
+	1074: {region: 0x37, script: 0x5, flags: 0x1},
+	1075: {region: 0x99, script: 0xcb, flags: 0x0},
+	1076: {region: 0x116, script: 0x57, flags: 0x0},
+	1077: {region: 0x114, script: 0x57, flags: 0x0},
+	1078: {region: 0x99, script: 0x21, flags: 0x0},
+	1079: {region: 0x161, script: 0x57, flags: 0x0},
+	1080: {region: 0x165, script: 0x57, flags: 0x0},
+	1081: {region: 0x165, script: 0x57, flags: 0x0},
+	1082: {region: 0x6d, script: 0x57, flags: 0x0},
+	1083: {region: 0x161, script: 0x57, flags: 0x0},
+	1084: {region: 0x165, script: 0x57, flags: 0x0},
+	1085: {region: 0x60, script: 0x57, flags: 0x0},
+	1086: {region: 0x95, script: 0x57, flags: 0x0},
+	1087: {region: 0x165, script: 0x57, flags: 0x0},
+	1088: {region: 0x165, script: 0x57, flags: 0x0},
+	1089: {region: 0x12f, script: 0x57, flags: 0x0},
+	1090: {region: 0x165, script: 0x57, flags: 0x0},
+	1091: {region: 0x84, script: 0x57, flags: 0x0},
+	1092: {region: 0x10c, script: 0x57, flags: 0x0},
+	1093: {region: 0x12f, script: 0x57, flags: 0x0},
+	1094: {region: 0x15f, script: 0x5, flags: 0x0},
+	1095: {region: 0x4b, script: 0x57, flags: 0x0},
+	1096: {region: 0x60, script: 0x57, flags: 0x0},
+	1097: {region: 0x165, script: 0x57, flags: 0x0},
+	1098: {region: 0x99, script: 0x21, flags: 0x0},
+	1099: {region: 0x95, script: 0x57, flags: 0x0},
+	1100: {region: 0x165, script: 0x57, flags: 0x0},
+	1101: {region: 0x35, script: 0xe, flags: 0x0},
+	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+	1103: {region: 0xe9, script: 0x57, flags: 0x0},
+	1104: {region: 0x99, script: 0xd7, flags: 0x0},
+	1105: {region: 0xdb, script: 0x21, flags: 0x0},
+	1106: {region: 0x165, script: 0x57, flags: 0x0},
+	1107: {region: 0x165, script: 0x57, flags: 0x0},
+	1108: {region: 0x165, script: 0x57, flags: 0x0},
+	1109: {region: 0x165, script: 0x57, flags: 0x0},
+	1110: {region: 0x165, script: 0x57, flags: 0x0},
+	1111: {region: 0x165, script: 0x57, flags: 0x0},
+	1112: {region: 0x165, script: 0x57, flags: 0x0},
+	1113: {region: 0x165, script: 0x57, flags: 0x0},
+	1114: {region: 0xe7, script: 0x57, flags: 0x0},
+	1115: {region: 0x165, script: 0x57, flags: 0x0},
+	1116: {region: 0x165, script: 0x57, flags: 0x0},
+	1117: {region: 0x99, script: 0x4f, flags: 0x0},
+	1118: {region: 0x53, script: 0xd5, flags: 0x0},
+	1119: {region: 0xdb, script: 0x21, flags: 0x0},
+	1120: {region: 0xdb, script: 0x21, flags: 0x0},
+	1121: {region: 0x99, script: 0xda, flags: 0x0},
+	1122: {region: 0x165, script: 0x57, flags: 0x0},
+	1123: {region: 0x112, script: 0x57, flags: 0x0},
+	1124: {region: 0x131, script: 0x57, flags: 0x0},
+	1125: {region: 0x126, script: 0x57, flags: 0x0},
+	1126: {region: 0x165, script: 0x57, flags: 0x0},
+	1127: {region: 0x3c, script: 0x3, flags: 0x1},
+	1128: {region: 0x165, script: 0x57, flags: 0x0},
+	1129: {region: 0x165, script: 0x57, flags: 0x0},
+	1130: {region: 0x165, script: 0x57, flags: 0x0},
+	1131: {region: 0x123, script: 0xdf, flags: 0x0},
+	1132: {region: 0xdb, script: 0x21, flags: 0x0},
+	1133: {region: 0xdb, script: 0x21, flags: 0x0},
+	1134: {region: 0xdb, script: 0x21, flags: 0x0},
+	1135: {region: 0x6f, script: 0x29, flags: 0x0},
+	1136: {region: 0x165, script: 0x57, flags: 0x0},
+	1137: {region: 0x6d, script: 0x29, flags: 0x0},
+	1138: {region: 0x165, script: 0x57, flags: 0x0},
+	1139: {region: 0x165, script: 0x57, flags: 0x0},
+	1140: {region: 0x165, script: 0x57, flags: 0x0},
+	1141: {region: 0xd6, script: 0x57, flags: 0x0},
+	1142: {region: 0x127, script: 0x57, flags: 0x0},
+	1143: {region: 0x125, script: 0x57, flags: 0x0},
+	1144: {region: 0x32, script: 0x57, flags: 0x0},
+	1145: {region: 0xdb, script: 0x21, flags: 0x0},
+	1146: {region: 0xe7, script: 0x57, flags: 0x0},
+	1147: {region: 0x165, script: 0x57, flags: 0x0},
+	1148: {region: 0x165, script: 0x57, flags: 0x0},
+	1149: {region: 0x32, script: 0x57, flags: 0x0},
+	1150: {region: 0xd4, script: 0x57, flags: 0x0},
+	1151: {region: 0x165, script: 0x57, flags: 0x0},
+	1152: {region: 0x161, script: 0x57, flags: 0x0},
+	1153: {region: 0x165, script: 0x57, flags: 0x0},
+	1154: {region: 0x129, script: 0x57, flags: 0x0},
+	1155: {region: 0x165, script: 0x57, flags: 0x0},
+	1156: {region: 0xce, script: 0x57, flags: 0x0},
+	1157: {region: 0x165, script: 0x57, flags: 0x0},
+	1158: {region: 0xe6, script: 0x57, flags: 0x0},
+	1159: {region: 0x165, script: 0x57, flags: 0x0},
+	1160: {region: 0x165, script: 0x57, flags: 0x0},
+	1161: {region: 0x165, script: 0x57, flags: 0x0},
+	1162: {region: 0x12b, script: 0x57, flags: 0x0},
+	1163: {region: 0x12b, script: 0x57, flags: 0x0},
+	1164: {region: 0x12e, script: 0x57, flags: 0x0},
+	1165: {region: 0x165, script: 0x5, flags: 0x0},
+	1166: {region: 0x161, script: 0x57, flags: 0x0},
+	1167: {region: 0x87, script: 0x31, flags: 0x0},
+	1168: {region: 0xdb, script: 0x21, flags: 0x0},
+	1169: {region: 0xe7, script: 0x57, flags: 0x0},
+	1170: {region: 0x43, script: 0xe0, flags: 0x0},
+	1171: {region: 0x165, script: 0x57, flags: 0x0},
+	1172: {region: 0x106, script: 0x1f, flags: 0x0},
+	1173: {region: 0x165, script: 0x57, flags: 0x0},
+	1174: {region: 0x165, script: 0x57, flags: 0x0},
+	1175: {region: 0x131, script: 0x57, flags: 0x0},
+	1176: {region: 0x165, script: 0x57, flags: 0x0},
+	1177: {region: 0x123, script: 0xdf, flags: 0x0},
+	1178: {region: 0x32, script: 0x57, flags: 0x0},
+	1179: {region: 0x165, script: 0x57, flags: 0x0},
+	1180: {region: 0x165, script: 0x57, flags: 0x0},
+	1181: {region: 0xce, script: 0x57, flags: 0x0},
+	1182: {region: 0x165, script: 0x57, flags: 0x0},
+	1183: {region: 0x165, script: 0x57, flags: 0x0},
+	1184: {region: 0x12d, script: 0x57, flags: 0x0},
+	1185: {region: 0x165, script: 0x57, flags: 0x0},
+	1187: {region: 0x165, script: 0x57, flags: 0x0},
+	1188: {region: 0xd4, script: 0x57, flags: 0x0},
+	1189: {region: 0x53, script: 0xd8, flags: 0x0},
+	1190: {region: 0xe5, script: 0x57, flags: 0x0},
+	1191: {region: 0x165, script: 0x57, flags: 0x0},
+	1192: {region: 0x106, script: 0x1f, flags: 0x0},
+	1193: {region: 0xba, script: 0x57, flags: 0x0},
+	1194: {region: 0x165, script: 0x57, flags: 0x0},
+	1195: {region: 0x106, script: 0x1f, flags: 0x0},
+	1196: {region: 0x3f, script: 0x4, flags: 0x1},
+	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+	1198: {region: 0x130, script: 0x1f, flags: 0x0},
+	1199: {region: 0x75, script: 0x57, flags: 0x0},
+	1200: {region: 0x2a, script: 0x57, flags: 0x0},
+	1202: {region: 0x43, script: 0x3, flags: 0x1},
+	1203: {region: 0x99, script: 0xe, flags: 0x0},
+	1204: {region: 0xe8, script: 0x5, flags: 0x0},
+	1205: {region: 0x165, script: 0x57, flags: 0x0},
+	1206: {region: 0x165, script: 0x57, flags: 0x0},
+	1207: {region: 0x165, script: 0x57, flags: 0x0},
+	1208: {region: 0x165, script: 0x57, flags: 0x0},
+	1209: {region: 0x165, script: 0x57, flags: 0x0},
+	1210: {region: 0x165, script: 0x57, flags: 0x0},
+	1211: {region: 0x165, script: 0x57, flags: 0x0},
+	1212: {region: 0x46, script: 0x4, flags: 0x1},
+	1213: {region: 0x165, script: 0x57, flags: 0x0},
+	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+	1215: {region: 0x165, script: 0x57, flags: 0x0},
+	1216: {region: 0x161, script: 0x57, flags: 0x0},
+	1217: {region: 0x9e, script: 0x57, flags: 0x0},
+	1218: {region: 0x106, script: 0x57, flags: 0x0},
+	1219: {region: 0x13e, script: 0x57, flags: 0x0},
+	1220: {region: 0x11b, script: 0x57, flags: 0x0},
+	1221: {region: 0x165, script: 0x57, flags: 0x0},
+	1222: {region: 0x36, script: 0x57, flags: 0x0},
+	1223: {region: 0x60, script: 0x57, flags: 0x0},
+	1224: {region: 0xd1, script: 0x57, flags: 0x0},
+	1225: {region: 0x1, script: 0x57, flags: 0x0},
+	1226: {region: 0x106, script: 0x57, flags: 0x0},
+	1227: {region: 0x6a, script: 0x57, flags: 0x0},
+	1228: {region: 0x12f, script: 0x57, flags: 0x0},
+	1229: {region: 0x165, script: 0x57, flags: 0x0},
+	1230: {region: 0x36, script: 0x57, flags: 0x0},
+	1231: {region: 0x4e, script: 0x57, flags: 0x0},
+	1232: {region: 0x165, script: 0x57, flags: 0x0},
+	1233: {region: 0x6f, script: 0x29, flags: 0x0},
+	1234: {region: 0x165, script: 0x57, flags: 0x0},
+	1235: {region: 0xe7, script: 0x57, flags: 0x0},
+	1236: {region: 0x2f, script: 0x57, flags: 0x0},
+	1237: {region: 0x99, script: 0xda, flags: 0x0},
+	1238: {region: 0x99, script: 0x21, flags: 0x0},
+	1239: {region: 0x165, script: 0x57, flags: 0x0},
+	1240: {region: 0x165, script: 0x57, flags: 0x0},
+	1241: {region: 0x165, script: 0x57, flags: 0x0},
+	1242: {region: 0x165, script: 0x57, flags: 0x0},
+	1243: {region: 0x165, script: 0x57, flags: 0x0},
+	1244: {region: 0x165, script: 0x57, flags: 0x0},
+	1245: {region: 0x165, script: 0x57, flags: 0x0},
+	1246: {region: 0x165, script: 0x57, flags: 0x0},
+	1247: {region: 0x165, script: 0x57, flags: 0x0},
+	1248: {region: 0x140, script: 0x57, flags: 0x0},
+	1249: {region: 0x165, script: 0x57, flags: 0x0},
+	1250: {region: 0x165, script: 0x57, flags: 0x0},
+	1251: {region: 0xa8, script: 0x5, flags: 0x0},
+	1252: {region: 0x165, script: 0x57, flags: 0x0},
+	1253: {region: 0x114, script: 0x57, flags: 0x0},
+	1254: {region: 0x165, script: 0x57, flags: 0x0},
+	1255: {region: 0x165, script: 0x57, flags: 0x0},
+	1256: {region: 0x165, script: 0x57, flags: 0x0},
+	1257: {region: 0x165, script: 0x57, flags: 0x0},
+	1258: {region: 0x99, script: 0x21, flags: 0x0},
+	1259: {region: 0x53, script: 0x38, flags: 0x0},
+	1260: {region: 0x165, script: 0x57, flags: 0x0},
+	1261: {region: 0x165, script: 0x57, flags: 0x0},
+	1262: {region: 0x41, script: 0x57, flags: 0x0},
+	1263: {region: 0x165, script: 0x57, flags: 0x0},
+	1264: {region: 0x12b, script: 0x18, flags: 0x0},
+	1265: {region: 0x165, script: 0x57, flags: 0x0},
+	1266: {region: 0x161, script: 0x57, flags: 0x0},
+	1267: {region: 0x165, script: 0x57, flags: 0x0},
+	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+	1269: {region: 0x12b, script: 0x60, flags: 0x0},
+	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+	1271: {region: 0x53, script: 0x64, flags: 0x0},
+	1272: {region: 0x10b, script: 0x69, flags: 0x0},
+	1273: {region: 0x108, script: 0x73, flags: 0x0},
+	1274: {region: 0x99, script: 0x21, flags: 0x0},
+	1275: {region: 0x131, script: 0x57, flags: 0x0},
+	1276: {region: 0x165, script: 0x57, flags: 0x0},
+	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+	1278: {region: 0x165, script: 0x57, flags: 0x0},
+	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+	1280: {region: 0x165, script: 0x57, flags: 0x0},
+	1281: {region: 0x165, script: 0x57, flags: 0x0},
+	1282: {region: 0xdb, script: 0x21, flags: 0x0},
+	1283: {region: 0x165, script: 0x57, flags: 0x0},
+	1284: {region: 0x165, script: 0x57, flags: 0x0},
+	1285: {region: 0xd1, script: 0x57, flags: 0x0},
+	1286: {region: 0x75, script: 0x57, flags: 0x0},
+	1287: {region: 0x165, script: 0x57, flags: 0x0},
+	1288: {region: 0x165, script: 0x57, flags: 0x0},
+	1289: {region: 0x52, script: 0x57, flags: 0x0},
+	1290: {region: 0x165, script: 0x57, flags: 0x0},
+	1291: {region: 0x165, script: 0x57, flags: 0x0},
+	1292: {region: 0x165, script: 0x57, flags: 0x0},
+	1293: {region: 0x52, script: 0x57, flags: 0x0},
+	1294: {region: 0x165, script: 0x57, flags: 0x0},
+	1295: {region: 0x165, script: 0x57, flags: 0x0},
+	1296: {region: 0x165, script: 0x57, flags: 0x0},
+	1297: {region: 0x165, script: 0x57, flags: 0x0},
+	1298: {region: 0x1, script: 0x3b, flags: 0x0},
+	1299: {region: 0x165, script: 0x57, flags: 0x0},
+	1300: {region: 0x165, script: 0x57, flags: 0x0},
+	1301: {region: 0x165, script: 0x57, flags: 0x0},
+	1302: {region: 0x165, script: 0x57, flags: 0x0},
+	1303: {region: 0x165, script: 0x57, flags: 0x0},
+	1304: {region: 0xd6, script: 0x57, flags: 0x0},
+	1305: {region: 0x165, script: 0x57, flags: 0x0},
+	1306: {region: 0x165, script: 0x57, flags: 0x0},
+	1307: {region: 0x165, script: 0x57, flags: 0x0},
+	1308: {region: 0x41, script: 0x57, flags: 0x0},
+	1309: {region: 0x165, script: 0x57, flags: 0x0},
+	1310: {region: 0xcf, script: 0x57, flags: 0x0},
+	1311: {region: 0x4a, script: 0x3, flags: 0x1},
+	1312: {region: 0x165, script: 0x57, flags: 0x0},
+	1313: {region: 0x165, script: 0x57, flags: 0x0},
+	1314: {region: 0x165, script: 0x57, flags: 0x0},
+	1315: {region: 0x53, script: 0x57, flags: 0x0},
+	1316: {region: 0x10b, script: 0x57, flags: 0x0},
+	1318: {region: 0xa8, script: 0x5, flags: 0x0},
+	1319: {region: 0xd9, script: 0x57, flags: 0x0},
+	1320: {region: 0xba, script: 0xdc, flags: 0x0},
+	1321: {region: 0x4d, script: 0x14, flags: 0x1},
+	1322: {region: 0x53, script: 0x79, flags: 0x0},
+	1323: {region: 0x165, script: 0x57, flags: 0x0},
+	1324: {region: 0x122, script: 0x57, flags: 0x0},
+	1325: {region: 0xd0, script: 0x57, flags: 0x0},
+	1326: {region: 0x165, script: 0x57, flags: 0x0},
+	1327: {region: 0x161, script: 0x57, flags: 0x0},
+	1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+	0:  {region: 0x9c, script: 0x7, flags: 0x0},
+	1:  {region: 0xa1, script: 0x74, flags: 0x2},
+	2:  {region: 0x11c, script: 0x80, flags: 0x2},
+	3:  {region: 0x32, script: 0x57, flags: 0x0},
+	4:  {region: 0x9b, script: 0x5, flags: 0x4},
+	5:  {region: 0x9c, script: 0x5, flags: 0x4},
+	6:  {region: 0x106, script: 0x1f, flags: 0x4},
+	7:  {region: 0x9c, script: 0x5, flags: 0x2},
+	8:  {region: 0x106, script: 0x1f, flags: 0x0},
+	9:  {region: 0x38, script: 0x2c, flags: 0x2},
+	10: {region: 0x135, script: 0x57, flags: 0x0},
+	11: {region: 0x7b, script: 0xc5, flags: 0x2},
+	12: {region: 0x114, script: 0x57, flags: 0x0},
+	13: {region: 0x84, script: 0x1, flags: 0x2},
+	14: {region: 0x5d, script: 0x1e, flags: 0x0},
+	15: {region: 0x87, script: 0x5c, flags: 0x2},
+	16: {region: 0xd6, script: 0x57, flags: 0x0},
+	17: {region: 0x52, script: 0x5, flags: 0x4},
+	18: {region: 0x10b, script: 0x5, flags: 0x4},
+	19: {region: 0xae, script: 0x1f, flags: 0x0},
+	20: {region: 0x24, script: 0x5, flags: 0x4},
+	21: {region: 0x53, script: 0x5, flags: 0x4},
+	22: {region: 0x9c, script: 0x5, flags: 0x4},
+	23: {region: 0xc5, script: 0x5, flags: 0x4},
+	24: {region: 0x53, script: 0x5, flags: 0x2},
+	25: {region: 0x12b, script: 0x57, flags: 0x0},
+	26: {region: 0xb0, script: 0x5, flags: 0x4},
+	27: {region: 0x9b, script: 0x5, flags: 0x2},
+	28: {region: 0xa5, script: 0x1f, flags: 0x0},
+	29: {region: 0x53, script: 0x5, flags: 0x4},
+	30: {region: 0x12b, script: 0x57, flags: 0x4},
+	31: {region: 0x53, script: 0x5, flags: 0x2},
+	32: {region: 0x12b, script: 0x57, flags: 0x2},
+	33: {region: 0xdb, script: 0x21, flags: 0x0},
+	34: {region: 0x99, script: 0x5a, flags: 0x2},
+	35: {region: 0x83, script: 0x57, flags: 0x0},
+	36: {region: 0x84, script: 0x78, flags: 0x4},
+	37: {region: 0x84, script: 0x78, flags: 0x2},
+	38: {region: 0xc5, script: 0x1f, flags: 0x0},
+	39: {region: 0x53, script: 0x6d, flags: 0x4},
+	40: {region: 0x53, script: 0x6d, flags: 0x2},
+	41: {region: 0xd0, script: 0x57, flags: 0x0},
+	42: {region: 0x4a, script: 0x5, flags: 0x4},
+	43: {region: 0x95, script: 0x5, flags: 0x4},
+	44: {region: 0x99, script: 0x33, flags: 0x0},
+	45: {region: 0xe8, script: 0x5, flags: 0x4},
+	46: {region: 0xe8, script: 0x5, flags: 0x2},
+	47: {region: 0x9c, script: 0x84, flags: 0x0},
+	48: {region: 0x53, script: 0x85, flags: 0x2},
+	49: {region: 0xba, script: 0xdc, flags: 0x0},
+	50: {region: 0xd9, script: 0x57, flags: 0x4},
+	51: {region: 0xe8, script: 0x5, flags: 0x0},
+	52: {region: 0x99, script: 0x21, flags: 0x2},
+	53: {region: 0x99, script: 0x4c, flags: 0x2},
+	54: {region: 0x99, script: 0xc9, flags: 0x2},
+	55: {region: 0x105, script: 0x1f, flags: 0x0},
+	56: {region: 0xbd, script: 0x57, flags: 0x4},
+	57: {region: 0x104, script: 0x57, flags: 0x4},
+	58: {region: 0x106, script: 0x57, flags: 0x4},
+	59: {region: 0x12b, script: 0x57, flags: 0x4},
+	60: {region: 0x124, script: 0x1f, flags: 0x0},
+	61: {region: 0xe8, script: 0x5, flags: 0x4},
+	62: {region: 0xe8, script: 0x5, flags: 0x2},
+	63: {region: 0x53, script: 0x5, flags: 0x0},
+	64: {region: 0xae, script: 0x1f, flags: 0x4},
+	65: {region: 0xc5, script: 0x1f, flags: 0x4},
+	66: {region: 0xae, script: 0x1f, flags: 0x2},
+	67: {region: 0x99, script: 0xe, flags: 0x0},
+	68: {region: 0xdb, script: 0x21, flags: 0x4},
+	69: {region: 0xdb, script: 0x21, flags: 0x2},
+	70: {region: 0x137, script: 0x57, flags: 0x0},
+	71: {region: 0x24, script: 0x5, flags: 0x4},
+	72: {region: 0x53, script: 0x1f, flags: 0x4},
+	73: {region: 0x24, script: 0x5, flags: 0x2},
+	74: {region: 0x8d, script: 0x39, flags: 0x0},
+	75: {region: 0x53, script: 0x38, flags: 0x4},
+	76: {region: 0x53, script: 0x38, flags: 0x2},
+	77: {region: 0x53, script: 0x38, flags: 0x0},
+	78: {region: 0x2f, script: 0x39, flags: 0x4},
+	79: {region: 0x3e, script: 0x39, flags: 0x4},
+	80: {region: 0x7b, script: 0x39, flags: 0x4},
+	81: {region: 0x7e, script: 0x39, flags: 0x4},
+	82: {region: 0x8d, script: 0x39, flags: 0x4},
+	83: {region: 0x95, script: 0x39, flags: 0x4},
+	84: {region: 0xc6, script: 0x39, flags: 0x4},
+	85: {region: 0xd0, script: 0x39, flags: 0x4},
+	86: {region: 0xe2, script: 0x39, flags: 0x4},
+	87: {region: 0xe5, script: 0x39, flags: 0x4},
+	88: {region: 0xe7, script: 0x39, flags: 0x4},
+	89: {region: 0x116, script: 0x39, flags: 0x4},
+	90: {region: 0x123, script: 0x39, flags: 0x4},
+	91: {region: 0x12e, script: 0x39, flags: 0x4},
+	92: {region: 0x135, script: 0x39, flags: 0x4},
+	93: {region: 0x13e, script: 0x39, flags: 0x4},
+	94: {region: 0x12e, script: 0x11, flags: 0x2},
+	95: {region: 0x12e, script: 0x34, flags: 0x2},
+	96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+	lang   uint16
+	script uint8
+	flags  uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
+	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	36:  {lang: 0x0, script: 0x2, flags: 0x1},
+	39:  {lang: 0x2, script: 0x2, flags: 0x1},
+	40:  {lang: 0x4, script: 0x2, flags: 0x1},
+	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	43:  {lang: 0x0, script: 0x57, flags: 0x0},
+	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
+	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	48:  {lang: 0x367, script: 0x57, flags: 0x0},
+	49:  {lang: 0x444, script: 0x57, flags: 0x0},
+	50:  {lang: 0x58, script: 0x57, flags: 0x0},
+	51:  {lang: 0x6, script: 0x2, flags: 0x1},
+	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
+	54:  {lang: 0x367, script: 0x57, flags: 0x0},
+	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
+	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
+	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
+	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
+	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	67:  {lang: 0x8, script: 0x2, flags: 0x1},
+	69:  {lang: 0x0, script: 0x57, flags: 0x0},
+	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
+	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
+	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
+	75:  {lang: 0x445, script: 0x57, flags: 0x0},
+	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
+	83:  {lang: 0xa, script: 0x4, flags: 0x1},
+	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	85:  {lang: 0x0, script: 0x57, flags: 0x0},
+	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
+	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
+	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
+	93:  {lang: 0xe, script: 0x2, flags: 0x1},
+	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
+	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
+	98:  {lang: 0x1, script: 0x57, flags: 0x0},
+	99:  {lang: 0x101, script: 0x57, flags: 0x0},
+	101: {lang: 0x13e, script: 0x57, flags: 0x0},
+	103: {lang: 0x10, script: 0x2, flags: 0x1},
+	104: {lang: 0x13e, script: 0x57, flags: 0x0},
+	105: {lang: 0x13e, script: 0x57, flags: 0x0},
+	106: {lang: 0x140, script: 0x57, flags: 0x0},
+	107: {lang: 0x3a, script: 0x5, flags: 0x0},
+	108: {lang: 0x3a, script: 0x5, flags: 0x0},
+	109: {lang: 0x46f, script: 0x29, flags: 0x0},
+	110: {lang: 0x13e, script: 0x57, flags: 0x0},
+	111: {lang: 0x12, script: 0x2, flags: 0x1},
+	113: {lang: 0x10d, script: 0x57, flags: 0x0},
+	114: {lang: 0x151, script: 0x57, flags: 0x0},
+	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
+	118: {lang: 0x158, script: 0x57, flags: 0x0},
+	120: {lang: 0x15e, script: 0x57, flags: 0x0},
+	122: {lang: 0x15e, script: 0x57, flags: 0x0},
+	123: {lang: 0x14, script: 0x2, flags: 0x1},
+	125: {lang: 0x16, script: 0x3, flags: 0x1},
+	126: {lang: 0x15e, script: 0x57, flags: 0x0},
+	128: {lang: 0x21, script: 0x57, flags: 0x0},
+	130: {lang: 0x245, script: 0x57, flags: 0x0},
+	132: {lang: 0x15e, script: 0x57, flags: 0x0},
+	133: {lang: 0x15e, script: 0x57, flags: 0x0},
+	134: {lang: 0x13e, script: 0x57, flags: 0x0},
+	135: {lang: 0x19, script: 0x2, flags: 0x1},
+	136: {lang: 0x0, script: 0x57, flags: 0x0},
+	137: {lang: 0x13e, script: 0x57, flags: 0x0},
+	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	141: {lang: 0x529, script: 0x39, flags: 0x0},
+	142: {lang: 0x0, script: 0x57, flags: 0x0},
+	143: {lang: 0x13e, script: 0x57, flags: 0x0},
+	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
+	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
+	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
+	148: {lang: 0x13e, script: 0x57, flags: 0x0},
+	149: {lang: 0x1b, script: 0x2, flags: 0x1},
+	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
+	153: {lang: 0x1d, script: 0x3, flags: 0x1},
+	155: {lang: 0x3a, script: 0x5, flags: 0x0},
+	156: {lang: 0x20, script: 0x2, flags: 0x1},
+	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
+	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	161: {lang: 0x3a, script: 0x5, flags: 0x0},
+	162: {lang: 0x200, script: 0x46, flags: 0x0},
+	164: {lang: 0x445, script: 0x57, flags: 0x0},
+	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
+	166: {lang: 0x22, script: 0x3, flags: 0x1},
+	168: {lang: 0x25, script: 0x2, flags: 0x1},
+	170: {lang: 0x254, script: 0x50, flags: 0x0},
+	171: {lang: 0x254, script: 0x50, flags: 0x0},
+	172: {lang: 0x3a, script: 0x5, flags: 0x0},
+	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	175: {lang: 0x27, script: 0x2, flags: 0x1},
+	176: {lang: 0x3a, script: 0x5, flags: 0x0},
+	178: {lang: 0x10d, script: 0x57, flags: 0x0},
+	179: {lang: 0x40c, script: 0xca, flags: 0x0},
+	181: {lang: 0x43b, script: 0x57, flags: 0x0},
+	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
+	183: {lang: 0x15e, script: 0x57, flags: 0x0},
+	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
+	185: {lang: 0x3a, script: 0x5, flags: 0x0},
+	186: {lang: 0x29, script: 0x2, flags: 0x1},
+	187: {lang: 0x15e, script: 0x57, flags: 0x0},
+	188: {lang: 0x2b, script: 0x2, flags: 0x1},
+	189: {lang: 0x432, script: 0x57, flags: 0x0},
+	190: {lang: 0x15e, script: 0x57, flags: 0x0},
+	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
+	194: {lang: 0x2d, script: 0x2, flags: 0x1},
+	195: {lang: 0xa0, script: 0x57, flags: 0x0},
+	196: {lang: 0x2f, script: 0x2, flags: 0x1},
+	197: {lang: 0x31, script: 0x2, flags: 0x1},
+	198: {lang: 0x33, script: 0x2, flags: 0x1},
+	200: {lang: 0x15e, script: 0x57, flags: 0x0},
+	201: {lang: 0x35, script: 0x2, flags: 0x1},
+	203: {lang: 0x320, script: 0x57, flags: 0x0},
+	204: {lang: 0x37, script: 0x3, flags: 0x1},
+	205: {lang: 0x128, script: 0xde, flags: 0x0},
+	207: {lang: 0x13e, script: 0x57, flags: 0x0},
+	208: {lang: 0x31f, script: 0x57, flags: 0x0},
+	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	210: {lang: 0x16, script: 0x57, flags: 0x0},
+	211: {lang: 0x15e, script: 0x57, flags: 0x0},
+	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
+	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
+	216: {lang: 0x13e, script: 0x57, flags: 0x0},
+	217: {lang: 0x367, script: 0x57, flags: 0x0},
+	218: {lang: 0x347, script: 0x57, flags: 0x0},
+	219: {lang: 0x351, script: 0x21, flags: 0x0},
+	225: {lang: 0x3a, script: 0x5, flags: 0x0},
+	226: {lang: 0x13e, script: 0x57, flags: 0x0},
+	228: {lang: 0x13e, script: 0x57, flags: 0x0},
+	229: {lang: 0x15e, script: 0x57, flags: 0x0},
+	230: {lang: 0x486, script: 0x57, flags: 0x0},
+	231: {lang: 0x153, script: 0x57, flags: 0x0},
+	232: {lang: 0x3a, script: 0x3, flags: 0x1},
+	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	234: {lang: 0x15e, script: 0x57, flags: 0x0},
+	236: {lang: 0x13e, script: 0x57, flags: 0x0},
+	237: {lang: 0x3a, script: 0x5, flags: 0x0},
+	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
+	241: {lang: 0x194, script: 0x57, flags: 0x0},
+	243: {lang: 0x3a, script: 0x5, flags: 0x0},
+	258: {lang: 0x15e, script: 0x57, flags: 0x0},
+	260: {lang: 0x3d, script: 0x2, flags: 0x1},
+	261: {lang: 0x432, script: 0x1f, flags: 0x0},
+	262: {lang: 0x3f, script: 0x2, flags: 0x1},
+	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
+	264: {lang: 0x3a, script: 0x5, flags: 0x0},
+	266: {lang: 0x15e, script: 0x57, flags: 0x0},
+	267: {lang: 0x3a, script: 0x5, flags: 0x0},
+	268: {lang: 0x41, script: 0x2, flags: 0x1},
+	271: {lang: 0x416, script: 0x57, flags: 0x0},
+	272: {lang: 0x347, script: 0x57, flags: 0x0},
+	273: {lang: 0x43, script: 0x2, flags: 0x1},
+	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	276: {lang: 0x15e, script: 0x57, flags: 0x0},
+	277: {lang: 0x429, script: 0x57, flags: 0x0},
+	278: {lang: 0x367, script: 0x57, flags: 0x0},
+	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	282: {lang: 0x13e, script: 0x57, flags: 0x0},
+	284: {lang: 0x45, script: 0x2, flags: 0x1},
+	288: {lang: 0x15e, script: 0x57, flags: 0x0},
+	289: {lang: 0x15e, script: 0x57, flags: 0x0},
+	290: {lang: 0x47, script: 0x2, flags: 0x1},
+	291: {lang: 0x49, script: 0x3, flags: 0x1},
+	292: {lang: 0x4c, script: 0x2, flags: 0x1},
+	293: {lang: 0x477, script: 0x57, flags: 0x0},
+	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	295: {lang: 0x476, script: 0x57, flags: 0x0},
+	296: {lang: 0x4e, script: 0x2, flags: 0x1},
+	297: {lang: 0x482, script: 0x57, flags: 0x0},
+	299: {lang: 0x50, script: 0x4, flags: 0x1},
+	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
+	302: {lang: 0x54, script: 0x2, flags: 0x1},
+	303: {lang: 0x445, script: 0x57, flags: 0x0},
+	304: {lang: 0x56, script: 0x3, flags: 0x1},
+	305: {lang: 0x445, script: 0x57, flags: 0x0},
+	309: {lang: 0x512, script: 0x3b, flags: 0x2},
+	310: {lang: 0x13e, script: 0x57, flags: 0x0},
+	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
+	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
+	315: {lang: 0x13e, script: 0x57, flags: 0x0},
+	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
+	319: {lang: 0x8a, script: 0x57, flags: 0x0},
+	320: {lang: 0x15e, script: 0x57, flags: 0x0},
+	322: {lang: 0x41b, script: 0x57, flags: 0x0},
+	333: {lang: 0x59, script: 0x2, flags: 0x1},
+	350: {lang: 0x3a, script: 0x5, flags: 0x0},
+	351: {lang: 0x5b, script: 0x2, flags: 0x1},
+	356: {lang: 0x423, script: 0x57, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 372 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+	0:  {lang: 0x148, script: 0x5, flags: 0x0},
+	1:  {lang: 0x476, script: 0x57, flags: 0x0},
+	2:  {lang: 0x431, script: 0x57, flags: 0x0},
+	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
+	5:  {lang: 0x274, script: 0x57, flags: 0x0},
+	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
+	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
+	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
+	9:  {lang: 0x351, script: 0x21, flags: 0x0},
+	10: {lang: 0x529, script: 0x38, flags: 0x0},
+	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+	12: {lang: 0x523, script: 0x57, flags: 0x0},
+	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
+	14: {lang: 0x136, script: 0x31, flags: 0x0},
+	15: {lang: 0x48a, script: 0x57, flags: 0x0},
+	16: {lang: 0x3a, script: 0x5, flags: 0x0},
+	17: {lang: 0x15e, script: 0x57, flags: 0x0},
+	18: {lang: 0x27, script: 0x29, flags: 0x0},
+	19: {lang: 0x139, script: 0x57, flags: 0x0},
+	20: {lang: 0x26a, script: 0x5, flags: 0x2},
+	21: {lang: 0x512, script: 0x3b, flags: 0x2},
+	22: {lang: 0x210, script: 0x2b, flags: 0x0},
+	23: {lang: 0x5, script: 0x1f, flags: 0x0},
+	24: {lang: 0x274, script: 0x57, flags: 0x0},
+	25: {lang: 0x136, script: 0x31, flags: 0x0},
+	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
+	28: {lang: 0x31f, script: 0x5, flags: 0x0},
+	29: {lang: 0x1be, script: 0x21, flags: 0x0},
+	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	31: {lang: 0x236, script: 0x72, flags: 0x0},
+	32: {lang: 0x148, script: 0x5, flags: 0x0},
+	33: {lang: 0x476, script: 0x57, flags: 0x0},
+	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
+	35: {lang: 0xe6, script: 0x5, flags: 0x0},
+	36: {lang: 0x226, script: 0xdf, flags: 0x0},
+	37: {lang: 0x3a, script: 0x5, flags: 0x0},
+	38: {lang: 0x15e, script: 0x57, flags: 0x0},
+	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
+	40: {lang: 0x226, script: 0xdf, flags: 0x0},
+	41: {lang: 0x3a, script: 0x5, flags: 0x0},
+	42: {lang: 0x15e, script: 0x57, flags: 0x0},
+	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+	46: {lang: 0x431, script: 0x57, flags: 0x0},
+	47: {lang: 0x331, script: 0x72, flags: 0x0},
+	48: {lang: 0x213, script: 0x57, flags: 0x0},
+	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
+	50: {lang: 0x242, script: 0x5, flags: 0x0},
+	51: {lang: 0x529, script: 0x39, flags: 0x0},
+	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
+	53: {lang: 0x3a, script: 0x5, flags: 0x0},
+	54: {lang: 0x15e, script: 0x57, flags: 0x0},
+	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
+	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	57: {lang: 0x88, script: 0x21, flags: 0x0},
+	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+	60: {lang: 0xbe, script: 0x21, flags: 0x0},
+	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
+	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
+	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+	64: {lang: 0x267, script: 0x57, flags: 0x0},
+	65: {lang: 0x444, script: 0x57, flags: 0x0},
+	66: {lang: 0x512, script: 0x3b, flags: 0x0},
+	67: {lang: 0x412, script: 0x57, flags: 0x0},
+	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	69: {lang: 0x3a, script: 0x5, flags: 0x0},
+	70: {lang: 0x15e, script: 0x57, flags: 0x0},
+	71: {lang: 0x15e, script: 0x57, flags: 0x0},
+	72: {lang: 0x35, script: 0x5, flags: 0x0},
+	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
+	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+	75: {lang: 0x30f, script: 0x72, flags: 0x0},
+	76: {lang: 0x467, script: 0x1f, flags: 0x0},
+	77: {lang: 0x148, script: 0x5, flags: 0x0},
+	78: {lang: 0x3a, script: 0x5, flags: 0x0},
+	79: {lang: 0x15e, script: 0x57, flags: 0x0},
+	80: {lang: 0x48a, script: 0x57, flags: 0x0},
+	81: {lang: 0x58, script: 0x5, flags: 0x0},
+	82: {lang: 0x219, script: 0x1f, flags: 0x0},
+	83: {lang: 0x81, script: 0x31, flags: 0x0},
+	84: {lang: 0x529, script: 0x39, flags: 0x0},
+	85: {lang: 0x48c, script: 0x57, flags: 0x0},
+	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+	87: {lang: 0x512, script: 0x3b, flags: 0x0},
+	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
+	89: {lang: 0x431, script: 0x57, flags: 0x0},
+	90: {lang: 0x432, script: 0x1f, flags: 0x0},
+	91: {lang: 0x15e, script: 0x57, flags: 0x0},
+	92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+	lang   uint16
+	region uint16
+	script uint8
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+	1:  {lang: 0x139, region: 0xd6, script: 0x57},
+	2:  {lang: 0x139, region: 0x135, script: 0x57},
+	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
+	4:  {lang: 0x139, region: 0x2f, script: 0x57},
+	5:  {lang: 0x139, region: 0xd6, script: 0x57},
+	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
+	7:  {lang: 0x445, region: 0x12f, script: 0x57},
+	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
+	9:  {lang: 0x445, region: 0x4b, script: 0x57},
+	10: {lang: 0x139, region: 0x161, script: 0x57},
+	11: {lang: 0x139, region: 0x135, script: 0x57},
+	12: {lang: 0x139, region: 0x135, script: 0x57},
+	13: {lang: 0x13e, region: 0x59, script: 0x57},
+	14: {lang: 0x529, region: 0x53, script: 0x38},
+	15: {lang: 0x1be, region: 0x99, script: 0x21},
+	16: {lang: 0x1e1, region: 0x95, script: 0x57},
+	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
+	18: {lang: 0x139, region: 0x2f, script: 0x57},
+	19: {lang: 0x139, region: 0xe6, script: 0x57},
+	20: {lang: 0x139, region: 0x8a, script: 0x57},
+	21: {lang: 0x41b, region: 0x142, script: 0x57},
+	22: {lang: 0x529, region: 0x53, script: 0x38},
+	23: {lang: 0x4bc, region: 0x137, script: 0x57},
+	24: {lang: 0x3a, region: 0x108, script: 0x5},
+	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
+	27: {lang: 0x139, region: 0x7b, script: 0x57},
+	28: {lang: 0x10d, region: 0x60, script: 0x57},
+	29: {lang: 0x139, region: 0xd6, script: 0x57},
+	30: {lang: 0x13e, region: 0x1f, script: 0x57},
+	31: {lang: 0x139, region: 0x9a, script: 0x57},
+	32: {lang: 0x139, region: 0x7b, script: 0x57},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+	// Entry 0 - 1F
+	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+	// Entry 20 - 3F
+	0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 358 bytes, 358 elements
+var regionInclusion = [358]uint8{
+	// Entry 0 - 3F
+	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+	// Entry 40 - 7F
+	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
+	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
+	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
+	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
+	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
+	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+	// Entry 80 - BF
+	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
+	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
+	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
+	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
+	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
+	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
+	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
+	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+	// Entry C0 - FF
+	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
+	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
+	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
+	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
+	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
+	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
+	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	// Entry 100 - 13F
+	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
+	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
+	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
+	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
+	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
+	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
+	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
+	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+	// Entry 140 - 17F
+	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
+	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings.  These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+	// Entry 0 - 1F
+	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+	// Entry 20 - 3F
+	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+	// Entry 40 - 5F
+	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+	0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+	// Entry 0 - 3F
+	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+	// Entry 40 - 7F
+	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+	0x43,
+}
+
+type parentRel struct {
+	lang       uint16
+	script     uint8
+	maxScript  uint8
+	toRegion   uint16
+	fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
+	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
+	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
+	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
+	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+}
+
+// Total table size 25886 bytes (25KiB); checksum: 50D3D57D
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 0000000..e7afd31
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+	t, err := Parse(s)
+	if err != nil {
+		panic(err)
+	}
+	return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+	b, err := ParseBase(s)
+	if err != nil {
+		panic(err)
+	}
+	return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+	scr, err := ParseScript(s)
+	if err != nil {
+		panic(err)
+	}
+	return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+	r, err := ParseRegion(s)
+	if err != nil {
+		panic(err)
+	}
+	return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go
index a67fcac..1cc004a 100644
--- a/vendor/golang.org/x/text/internal/match.go
+++ b/vendor/golang.org/x/text/internal/match.go
@@ -6,7 +6,7 @@ package internal
 
 // This file contains matchers that implement CLDR inheritance.
 //
-//     See http://unicode.org/reports/tr35/#Locale_Inheritance.
+//     See https://unicode.org/reports/tr35/#Locale_Inheritance.
 //
 // Some of the inheritance described in this document is already handled by
 // the cldr package.
diff --git a/vendor/golang.org/x/text/internal/number/common.go b/vendor/golang.org/x/text/internal/number/common.go
index 052876e..a6e9c8e 100644
--- a/vendor/golang.org/x/text/internal/number/common.go
+++ b/vendor/golang.org/x/text/internal/number/common.go
@@ -2,7 +2,11 @@
 
 package number
 
-import "unicode/utf8"
+import (
+	"unicode/utf8"
+
+	"golang.org/x/text/internal/language/compact"
+)
 
 // A system identifies a CLDR numbering system.
 type system byte
@@ -45,7 +49,7 @@ const hasNonLatnMask = 0x8000
 type symOffset uint16
 
 type altSymData struct {
-	compactTag uint16
+	compactTag compact.ID
 	symIndex   symOffset
 	system     system
 }
diff --git a/vendor/golang.org/x/text/internal/number/format.go b/vendor/golang.org/x/text/internal/number/format.go
index 910bdeb..cd94c5d 100644
--- a/vendor/golang.org/x/text/internal/number/format.go
+++ b/vendor/golang.org/x/text/internal/number/format.go
@@ -39,12 +39,7 @@ type Formatter struct {
 
 func (f *Formatter) init(t language.Tag, index []uint8) {
 	f.Info = InfoFromTag(t)
-	for ; ; t = t.Parent() {
-		if ci, ok := language.CompactIndex(t); ok {
-			f.Pattern = formats[index[ci]]
-			break
-		}
-	}
+	f.Pattern = formats[index[tagToID(t)]]
 }
 
 // InitPattern initializes a Formatter for the given Pattern.
diff --git a/vendor/golang.org/x/text/internal/number/gen.go b/vendor/golang.org/x/text/internal/number/gen.go
index 48f180f..c836221 100644
--- a/vendor/golang.org/x/text/internal/number/gen.go
+++ b/vendor/golang.org/x/text/internal/number/gen.go
@@ -14,11 +14,11 @@ import (
 	"strings"
 	"unicode/utf8"
 
-	"golang.org/x/text/internal"
 	"golang.org/x/text/internal/gen"
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
 	"golang.org/x/text/internal/number"
 	"golang.org/x/text/internal/stringset"
-	"golang.org/x/text/language"
 	"golang.org/x/text/unicode/cldr"
 )
 
@@ -151,19 +151,19 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 	type symbols [NumSymbolTypes]string
 
 	type key struct {
-		tag    int // from language.CompactIndex
+		tag    compact.ID
 		system system
 	}
 	symbolMap := map[key]*symbols{}
 
-	defaults := map[int]system{}
+	defaults := map[compact.ID]system{}
 
 	for _, lang := range data.Locales() {
 		ldml := data.RawLDML(lang)
 		if ldml.Numbers == nil {
 			continue
 		}
-		langIndex, ok := language.CompactIndex(language.MustParse(lang))
+		langIndex, ok := compact.FromTag(language.MustParse(lang))
 		if !ok {
 			log.Fatalf("No compact index for language %s", lang)
 		}
@@ -213,7 +213,7 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 		for t := SymDecimal; t < NumSymbolTypes; t++ {
 			p := k.tag
 			for syms[t] == "" {
-				p = int(internal.Parent[p])
+				p = p.Parent()
 				if pSyms, ok := symbolMap[key{p, k.system}]; ok && (*pSyms)[t] != "" {
 					syms[t] = (*pSyms)[t]
 					break
@@ -234,7 +234,7 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 
 	for ns := system(0); ns < nNumberSystems; ns++ {
 		for _, l := range data.Locales() {
-			langIndex, _ := language.CompactIndex(language.MustParse(l))
+			langIndex, _ := compact.FromTag(language.MustParse(l))
 			s := symbolMap[key{langIndex, ns}]
 			if s == nil {
 				continue
@@ -255,7 +255,7 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 
 	// resolveSymbolIndex gets the index from the closest matching locale,
 	// including the locale itself.
-	resolveSymbolIndex := func(langIndex int, ns system) symOffset {
+	resolveSymbolIndex := func(langIndex compact.ID, ns system) symOffset {
 		for {
 			if sym := symbolMap[key{langIndex, ns}]; sym != nil {
 				return symOffset(m[*sym])
@@ -263,22 +263,22 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 			if langIndex == 0 {
 				return 0 // und, latn
 			}
-			langIndex = int(internal.Parent[langIndex])
+			langIndex = langIndex.Parent()
 		}
 	}
 
 	// Create an index with the symbols for each locale for the latn numbering
 	// system. If this is not the default, or the only one, for a locale, we
 	// will overwrite the value later.
-	var langToDefaults [language.NumCompactTags]symOffset
+	var langToDefaults [compact.NumCompactTags]symOffset
 	for _, l := range data.Locales() {
-		langIndex, _ := language.CompactIndex(language.MustParse(l))
+		langIndex, _ := compact.FromTag(language.MustParse(l))
 		langToDefaults[langIndex] = resolveSymbolIndex(langIndex, 0)
 	}
 
 	// Delete redundant entries.
 	for _, l := range data.Locales() {
-		langIndex, _ := language.CompactIndex(language.MustParse(l))
+		langIndex, _ := compact.FromTag(language.MustParse(l))
 		def := defaults[langIndex]
 		syms := symbolMap[key{langIndex, def}]
 		if syms == nil {
@@ -298,7 +298,7 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 	// be referenced if a user specified an alternative numbering system.
 	var langToAlt []altSymData
 	for _, l := range data.Locales() {
-		langIndex, _ := language.CompactIndex(language.MustParse(l))
+		langIndex, _ := compact.FromTag(language.MustParse(l))
 		start := len(langToAlt)
 		if start >= hasNonLatnMask {
 			log.Fatalf("Number of alternative assignments >= %x", hasNonLatnMask)
@@ -306,7 +306,7 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 		// Create the entry for the default value.
 		def := defaults[langIndex]
 		langToAlt = append(langToAlt, altSymData{
-			compactTag: uint16(langIndex),
+			compactTag: langIndex,
 			system:     def,
 			symIndex:   resolveSymbolIndex(langIndex, def),
 		})
@@ -317,7 +317,7 @@ func genSymbols(w *gen.CodeWriter, data *cldr.CLDR) {
 			}
 			if sym := symbolMap[key{langIndex, ns}]; sym != nil {
 				langToAlt = append(langToAlt, altSymData{
-					compactTag: uint16(langIndex),
+					compactTag: langIndex,
 					system:     ns,
 					symIndex:   resolveSymbolIndex(langIndex, ns),
 				})
@@ -361,16 +361,16 @@ func genFormats(w *gen.CodeWriter, data *cldr.CLDR) {
 
 	// TODO: It would be possible to eliminate two of these slices by having
 	// another indirection and store a reference to the combination of patterns.
-	decimal := make([]byte, language.NumCompactTags)
-	scientific := make([]byte, language.NumCompactTags)
-	percent := make([]byte, language.NumCompactTags)
+	decimal := make([]byte, compact.NumCompactTags)
+	scientific := make([]byte, compact.NumCompactTags)
+	percent := make([]byte, compact.NumCompactTags)
 
 	for _, lang := range data.Locales() {
 		ldml := data.RawLDML(lang)
 		if ldml.Numbers == nil {
 			continue
 		}
-		langIndex, ok := language.CompactIndex(language.MustParse(lang))
+		langIndex, ok := compact.FromTag(language.MustParse(lang))
 		if !ok {
 			log.Fatalf("No compact index for language %s", lang)
 		}
@@ -440,8 +440,8 @@ func genFormats(w *gen.CodeWriter, data *cldr.CLDR) {
 	// indicates an unspecified value.
 	for _, data := range [][]byte{decimal, scientific, percent} {
 		for i := range data {
-			p := uint16(i)
-			for ; data[p] == 0; p = internal.Parent[p] {
+			p := compact.ID(i)
+			for ; data[p] == 0; p = p.Parent() {
 			}
 			data[i] = data[p]
 		}
diff --git a/vendor/golang.org/x/text/internal/number/gen_common.go b/vendor/golang.org/x/text/internal/number/gen_common.go
index f88b838..b1b41a7 100644
--- a/vendor/golang.org/x/text/internal/number/gen_common.go
+++ b/vendor/golang.org/x/text/internal/number/gen_common.go
@@ -6,7 +6,11 @@
 
 package main
 
-import "unicode/utf8"
+import (
+	"unicode/utf8"
+
+	"golang.org/x/text/internal/language/compact"
+)
 
 // A system identifies a CLDR numbering system.
 type system byte
@@ -49,7 +53,7 @@ const hasNonLatnMask = 0x8000
 type symOffset uint16
 
 type altSymData struct {
-	compactTag uint16
+	compactTag compact.ID
 	symIndex   symOffset
 	system     system
 }
diff --git a/vendor/golang.org/x/text/internal/number/number.go b/vendor/golang.org/x/text/internal/number/number.go
index 2a21f07..e1d933c 100644
--- a/vendor/golang.org/x/text/internal/number/number.go
+++ b/vendor/golang.org/x/text/internal/number/number.go
@@ -10,7 +10,7 @@ package number
 import (
 	"unicode/utf8"
 
-	"golang.org/x/text/internal"
+	"golang.org/x/text/internal/language/compact"
 	"golang.org/x/text/language"
 )
 
@@ -23,7 +23,7 @@ type Info struct {
 // InfoFromLangID returns a Info for the given compact language identifier and
 // numbering system identifier. If system is the empty string, the default
 // numbering system will be taken for that language.
-func InfoFromLangID(compactIndex int, numberSystem string) Info {
+func InfoFromLangID(compactIndex compact.ID, numberSystem string) Info {
 	p := langToDefaults[compactIndex]
 	// Lookup the entry for the language.
 	pSymIndex := symOffset(0) // Default: Latin, default symbols
@@ -51,11 +51,11 @@ func InfoFromLangID(compactIndex int, numberSystem string) Info {
 					break
 				}
 				// Move to the parent and retry.
-				langIndex = int(internal.Parent[langIndex])
+				langIndex = langIndex.Parent()
 			} else {
 				// The index points to a list of symbol data indexes.
 				for _, e := range langToAlt[p&^hasNonLatnMask:] {
-					if int(e.compactTag) != langIndex {
+					if e.compactTag != langIndex {
 						if langIndex == 0 {
 							// The CLDR root defines full symbol information for
 							// all numbering systems (even though mostly by
@@ -67,13 +67,13 @@ func InfoFromLangID(compactIndex int, numberSystem string) Info {
 							}
 							// Fall back to Latin and start from the original
 							// language. See
-							// http://unicode.org/reports/tr35/#Locale_Inheritance.
+							// https://unicode.org/reports/tr35/#Locale_Inheritance.
 							ns = numLatn
 							langIndex = compactIndex
 							continue outerLoop
 						}
 						// Fall back to parent.
-						langIndex = int(internal.Parent[langIndex])
+						langIndex = langIndex.Parent()
 					} else if e.system == ns {
 						pSymIndex = e.symIndex
 						break outerLoop
@@ -100,12 +100,7 @@ func InfoFromLangID(compactIndex int, numberSystem string) Info {
 
 // InfoFromTag returns a Info for the given language tag.
 func InfoFromTag(t language.Tag) Info {
-	for {
-		if index, ok := language.CompactIndex(t); ok {
-			return InfoFromLangID(index, t.TypeForKey("nu"))
-		}
-		t = t.Parent()
-	}
+	return InfoFromLangID(tagToID(t), t.TypeForKey("nu"))
 }
 
 // IsDecimal reports if the numbering system can convert decimal to native
@@ -148,9 +143,10 @@ func (n Info) Symbol(t SymbolType) string {
 }
 
 func formatForLang(t language.Tag, index []byte) *Pattern {
-	for ; ; t = t.Parent() {
-		if x, ok := language.CompactIndex(t); ok {
-			return &formats[index[x]]
-		}
-	}
+	return &formats[index[tagToID(t)]]
+}
+
+func tagToID(t language.Tag) compact.ID {
+	id, _ := compact.RegionalID(compact.Tag(t))
+	return id
 }
diff --git a/vendor/golang.org/x/text/internal/number/pattern.go b/vendor/golang.org/x/text/internal/number/pattern.go
index b95ca40..06e5955 100644
--- a/vendor/golang.org/x/text/internal/number/pattern.go
+++ b/vendor/golang.org/x/text/internal/number/pattern.go
@@ -10,7 +10,7 @@ import (
 )
 
 // This file contains a parser for the CLDR number patterns as described in
-// http://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns.
+// https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns.
 //
 // The following BNF is derived from this standard.
 //
@@ -201,7 +201,7 @@ var (
 
 // ParsePattern extracts formatting information from a CLDR number pattern.
 //
-// See http://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns.
+// See https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns.
 func ParsePattern(s string) (f *Pattern, err error) {
 	p := parser{Pattern: &Pattern{}}
 
diff --git a/vendor/golang.org/x/text/internal/number/roundingmode_string.go b/vendor/golang.org/x/text/internal/number/roundingmode_string.go
index f264ea5..bcc2247 100644
--- a/vendor/golang.org/x/text/internal/number/roundingmode_string.go
+++ b/vendor/golang.org/x/text/internal/number/roundingmode_string.go
@@ -2,7 +2,21 @@
 
 package number
 
-import "fmt"
+import "strconv"
+
+func _() {
+	// An "invalid array index" compiler error signifies that the constant values have changed.
+	// Re-run the stringer command to generate them again.
+	var x [1]struct{}
+	_ = x[ToNearestEven-0]
+	_ = x[ToNearestZero-1]
+	_ = x[ToNearestAway-2]
+	_ = x[ToPositiveInf-3]
+	_ = x[ToNegativeInf-4]
+	_ = x[ToZero-5]
+	_ = x[AwayFromZero-6]
+	_ = x[numModes-7]
+}
 
 const _RoundingMode_name = "ToNearestEvenToNearestZeroToNearestAwayToPositiveInfToNegativeInfToZeroAwayFromZeronumModes"
 
@@ -10,7 +24,7 @@ var _RoundingMode_index = [...]uint8{0, 13, 26, 39, 52, 65, 71, 83, 91}
 
 func (i RoundingMode) String() string {
 	if i >= RoundingMode(len(_RoundingMode_index)-1) {
-		return fmt.Sprintf("RoundingMode(%d)", i)
+		return "RoundingMode(" + strconv.FormatInt(int64(i), 10) + ")"
 	}
 	return _RoundingMode_name[_RoundingMode_index[i]:_RoundingMode_index[i+1]]
 }
diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go
index 56a897b..0668a37 100644
--- a/vendor/golang.org/x/text/internal/number/tables.go
+++ b/vendor/golang.org/x/text/internal/number/tables.go
@@ -343,271 +343,273 @@ var symData = stringset.Set{
 
 // langToDefaults maps a compact language index to the default numbering system
 // and default symbol set
-var langToDefaults = [768]symOffset{
+var langToDefaults = [775]symOffset{
 	// Entry 0 - 3F
-	0x8000, 0x0006, 0x0014, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x8003, 0x0002, 0x0002, 0x0002,
-	0x0002, 0x0003, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002,
-	0x0002, 0x0002, 0x0003, 0x0003, 0x0003, 0x0003, 0x0002, 0x0002,
-	0x0002, 0x0004, 0x0002, 0x0004, 0x0002, 0x0002, 0x0002, 0x0003,
-	0x0002, 0x0000, 0x8005, 0x0000, 0x0000, 0x0000, 0x8006, 0x0005,
-	0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001,
-	0x0001, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000,
+	0x8000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x8003, 0x0002, 0x0002, 0x0002, 0x0002, 0x0003,
+	0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002,
+	0x0003, 0x0003, 0x0003, 0x0003, 0x0002, 0x0002, 0x0002, 0x0004,
+	0x0002, 0x0004, 0x0002, 0x0002, 0x0002, 0x0003, 0x0002, 0x0000,
+	0x8005, 0x0000, 0x0000, 0x0000, 0x8006, 0x0005, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000,
 	// Entry 40 - 7F
-	0x0000, 0x0000, 0x8009, 0x0000, 0x0000, 0x800a, 0x0000, 0x0000,
-	0x800c, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006,
-	0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x800e, 0x0000,
-	0x0000, 0x0007, 0x0007, 0x0000, 0x0000, 0x0000, 0x0000, 0x800f,
-	0x0008, 0x0008, 0x8011, 0x0001, 0x0001, 0x0001, 0x803c, 0x0000,
-	0x0009, 0x0009, 0x0009, 0x0000, 0x0000, 0x000a, 0x000b, 0x000a,
-	0x000c, 0x000a, 0x000a, 0x000c, 0x000a, 0x000d, 0x000d, 0x000a,
-	0x000a, 0x0001, 0x0001, 0x0000, 0x0001, 0x0001, 0x803f, 0x0000,
+	0x8009, 0x0000, 0x0000, 0x800a, 0x0000, 0x0000, 0x800c, 0x0001,
+	0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0006, 0x0006, 0x800e, 0x0000, 0x0000, 0x0007,
+	0x0007, 0x0000, 0x0000, 0x0000, 0x0000, 0x800f, 0x0008, 0x0008,
+	0x8011, 0x0001, 0x0001, 0x0001, 0x803c, 0x0000, 0x0009, 0x0009,
+	0x0009, 0x0000, 0x0000, 0x000a, 0x000b, 0x000a, 0x000c, 0x000a,
+	0x000a, 0x000c, 0x000a, 0x000d, 0x000d, 0x000a, 0x000a, 0x0001,
+	0x0001, 0x0000, 0x0001, 0x0001, 0x803f, 0x0000, 0x0000, 0x0000,
 	// Entry 80 - BF
-	0x0000, 0x0000, 0x000e, 0x000e, 0x000e, 0x000f, 0x000f, 0x000f,
-	0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x000a, 0x0010,
-	0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0011,
-	0x0000, 0x000a, 0x0000, 0x0000, 0x0000, 0x0000, 0x000a, 0x0000,
-	0x0009, 0x0000, 0x0000, 0x0012, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x000e, 0x000e, 0x000e, 0x000f, 0x000f, 0x000f, 0x0000, 0x0000,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x000a, 0x0010, 0x0000, 0x0006,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0011, 0x0000, 0x000a,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x000a, 0x0000, 0x0009, 0x0000,
+	0x0000, 0x0012, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
 	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
 	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
 	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
 	// Entry C0 - FF
 	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0013, 0x0000,
+	0x0000, 0x000f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
 	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0013, 0x0000, 0x0000, 0x000f, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0000,
-	0x0000, 0x0015, 0x0015, 0x0006, 0x0000, 0x0006, 0x0006, 0x0000,
-	0x0000, 0x0006, 0x0006, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0000, 0x0000, 0x0015,
+	0x0015, 0x0006, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0006,
+	0x0006, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006,
 	// Entry 100 - 13F
-	0x0006, 0x0006, 0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0006, 0x0000, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006,
-	0x0016, 0x0016, 0x0017, 0x0017, 0x0001, 0x0001, 0x8041, 0x0018,
-	0x0018, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0019, 0x0019,
-	0x0000, 0x0000, 0x0017, 0x0017, 0x0017, 0x8044, 0x0001, 0x0001,
+	0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006,
+	0x0000, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0016, 0x0016,
+	0x0017, 0x0017, 0x0001, 0x0001, 0x8041, 0x0018, 0x0018, 0x0001,
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0019, 0x0019, 0x0000, 0x0000,
+	0x0017, 0x0017, 0x0017, 0x8044, 0x0001, 0x0001, 0x0001, 0x0001,
 	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
 	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
-	0x0001, 0x0001, 0x0001, 0x0001, 0x0006, 0x0006, 0x0001, 0x0001,
+	0x0001, 0x0001, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001,
 	// Entry 140 - 17F
 	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
 	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
-	0x0001, 0x0001, 0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006,
-	0x0000, 0x0000, 0x8047, 0x0000, 0x0006, 0x0006, 0x001a, 0x001a,
-	0x001a, 0x001a, 0x804a, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x804c,
-	0x001b, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x000a, 0x000a,
-	0x0001, 0x0001, 0x001c, 0x001c, 0x0009, 0x0009, 0x804f, 0x0000,
+	0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000, 0x0000,
+	0x8047, 0x0000, 0x0006, 0x0006, 0x001a, 0x001a, 0x001a, 0x001a,
+	0x804a, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x804c, 0x001b, 0x0000,
+	0x0000, 0x0006, 0x0006, 0x0006, 0x000a, 0x000a, 0x0001, 0x0001,
+	0x001c, 0x001c, 0x0009, 0x0009, 0x804f, 0x0000, 0x0000, 0x0000,
 	// Entry 180 - 1BF
-	0x0000, 0x0000, 0x0000, 0x8052, 0x0006, 0x0006, 0x001d, 0x0006,
-	0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006,
-	0x0000, 0x0000, 0x0000, 0x001e, 0x001e, 0x001f, 0x001f, 0x0000,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x000d,
-	0x000d, 0x0000, 0x0000, 0x0020, 0x0020, 0x0006, 0x0006, 0x0021,
-	0x0021, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x8054,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x8056, 0x001b, 0x0000, 0x0000,
-	0x0001, 0x0001, 0x0022, 0x0022, 0x0000, 0x0000, 0x0000, 0x0023,
+	0x0000, 0x0000, 0x8052, 0x0006, 0x0006, 0x001d, 0x0006, 0x0006,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x001e, 0x001e, 0x001f,
+	0x001f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001,
+	0x0001, 0x000d, 0x000d, 0x0000, 0x0000, 0x0020, 0x0020, 0x0006,
+	0x0006, 0x0021, 0x0021, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000,
+	0x0000, 0x8054, 0x0000, 0x0000, 0x0000, 0x0000, 0x8056, 0x001b,
+	0x0000, 0x0000, 0x0001, 0x0001, 0x0022, 0x0022, 0x0000, 0x0000,
 	// Entry 1C0 - 1FF
-	0x0023, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0024, 0x0024,
-	0x8058, 0x0000, 0x0000, 0x0016, 0x0016, 0x0006, 0x0006, 0x0000,
-	0x0000, 0x0000, 0x0000, 0x0025, 0x0025, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x000d, 0x000d, 0x0000, 0x0000, 0x0006, 0x0006,
-	0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x805a, 0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0006, 0x0006, 0x805b, 0x0026, 0x805d, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0023, 0x0023, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006,
+	0x0024, 0x0024, 0x8058, 0x0000, 0x0000, 0x0016, 0x0016, 0x0006,
+	0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0025, 0x0025, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x000d, 0x000d, 0x0000, 0x0000,
+	0x0006, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x805a, 0x0000, 0x0000, 0x0006, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x805b, 0x0026, 0x805d,
 	// Entry 200 - 23F
-	0x0000, 0x805e, 0x0015, 0x0015, 0x0000, 0x0000, 0x0006, 0x0006,
-	0x0006, 0x8061, 0x0000, 0x0000, 0x8062, 0x0006, 0x0006, 0x0006,
-	0x0006, 0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0015, 0x0015,
-	0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x805e, 0x0015, 0x0015, 0x0000,
+	0x0000, 0x0006, 0x0006, 0x0006, 0x8061, 0x0000, 0x0000, 0x8062,
+	0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0001,
+	0x0001, 0x0015, 0x0015, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000,
 	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0027, 0x0027, 0x0027, 0x8065, 0x8067, 0x001b, 0x0000, 0x0000,
-	0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x8069, 0x0028, 0x0006,
-	0x0001, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x0000, 0x0000, 0x0000, 0x0027, 0x0027, 0x0027, 0x8065, 0x8067,
+	0x001b, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x8069, 0x0028, 0x0006, 0x0001, 0x0006, 0x0001, 0x0001, 0x0001,
 	// Entry 240 - 27F
-	0x0001, 0x0001, 0x0001, 0x0001, 0x0000, 0x0006, 0x0000, 0x0000,
-	0x001a, 0x001a, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000,
-	0x0000, 0x0029, 0x0029, 0x0029, 0x0029, 0x0029, 0x0029, 0x0029,
-	0x0006, 0x0006, 0x0000, 0x0000, 0x002a, 0x002a, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x806b, 0x0000, 0x0000, 0x002b, 0x002b, 0x002b,
-	0x002b, 0x0006, 0x0006, 0x000d, 0x000d, 0x0006, 0x0006, 0x0001,
-	0x0001, 0x0001, 0x0001, 0x0001, 0x002c, 0x002c, 0x002d, 0x002d,
-	0x002e, 0x002e, 0x0000, 0x0000, 0x0000, 0x002f, 0x002f, 0x0000,
+	0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000,
+	0x0006, 0x0000, 0x0000, 0x001a, 0x001a, 0x0006, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0000, 0x0000, 0x0029, 0x0029, 0x0029, 0x0029,
+	0x0029, 0x0029, 0x0029, 0x0006, 0x0006, 0x0000, 0x0000, 0x002a,
+	0x002a, 0x0000, 0x0000, 0x0000, 0x0000, 0x806b, 0x0000, 0x0000,
+	0x002b, 0x002b, 0x002b, 0x002b, 0x0006, 0x0006, 0x000d, 0x000d,
+	0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001,
+	0x002c, 0x002c, 0x002d, 0x002d, 0x002e, 0x002e, 0x0000, 0x0000,
 	// Entry 280 - 2BF
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001,
-	0x0001, 0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006,
-	0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000, 0x0000,
-	0x0000, 0x806d, 0x0022, 0x0022, 0x0022, 0x0000, 0x0006, 0x0000,
+	0x0000, 0x002f, 0x002f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0006,
+	0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006,
+	0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x806d, 0x0022, 0x0022,
+	0x0022, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
 	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0030, 0x0030, 0x0000,
-	0x8071, 0x0031, 0x0006, 0x0006, 0x0006, 0x0000, 0x0001, 0x0001,
+	0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0030, 0x0030, 0x0000, 0x0000, 0x8071, 0x0031, 0x0006,
 	// Entry 2C0 - 2FF
-	0x000d, 0x000d, 0x0001, 0x0001, 0x0000, 0x0000, 0x0032, 0x0032,
-	0x8074, 0x8076, 0x001b, 0x8077, 0x8079, 0x0028, 0x807b, 0x0034,
-	0x0033, 0x0033, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000,
-	0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0035,
-	0x0035, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001,
-	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0036, 0x0037, 0x0037,
-	0x0036, 0x0036, 0x0001, 0x0001, 0x807d, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x8080, 0x0036, 0x0036, 0x0036, 0x0000, 0x0000,
-} // Size: 1536 bytes
+	0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x000d, 0x000d, 0x0001,
+	0x0001, 0x0000, 0x0000, 0x0032, 0x0032, 0x8074, 0x8076, 0x001b,
+	0x8077, 0x8079, 0x0028, 0x807b, 0x0034, 0x0033, 0x0033, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000,
+	0x0000, 0x0000, 0x0000, 0x0000, 0x0035, 0x0035, 0x0006, 0x0006,
+	0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000,
+	0x0000, 0x0000, 0x0036, 0x0037, 0x0037, 0x0036, 0x0036, 0x0001,
+	0x0001, 0x807d, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x8080,
+	// Entry 300 - 33F
+	0x0036, 0x0036, 0x0036, 0x0000, 0x0000, 0x0006, 0x0014,
+} // Size: 1550 bytes
 
 // langToAlt is a list of numbering system and symbol set pairs, sorted and
 // marked by compact language index.
 var langToAlt = []altSymData{ // 131 elements
 	1:   {compactTag: 0x0, symIndex: 0x38, system: 0x3},
 	2:   {compactTag: 0x0, symIndex: 0x42, system: 0x4},
-	3:   {compactTag: 0xc, symIndex: 0x39, system: 0x3},
-	4:   {compactTag: 0xc, symIndex: 0x2, system: 0x0},
-	5:   {compactTag: 0x2a, symIndex: 0x0, system: 0x6},
-	6:   {compactTag: 0x2e, symIndex: 0x5, system: 0x0},
-	7:   {compactTag: 0x2e, symIndex: 0x3a, system: 0x3},
-	8:   {compactTag: 0x2e, symIndex: 0x42, system: 0x4},
-	9:   {compactTag: 0x42, symIndex: 0x0, system: 0x6},
-	10:  {compactTag: 0x45, symIndex: 0x0, system: 0x0},
-	11:  {compactTag: 0x45, symIndex: 0x4f, system: 0x37},
-	12:  {compactTag: 0x48, symIndex: 0x1, system: 0x0},
-	13:  {compactTag: 0x48, symIndex: 0x38, system: 0x3},
-	14:  {compactTag: 0x56, symIndex: 0x0, system: 0x9},
-	15:  {compactTag: 0x5f, symIndex: 0x3a, system: 0x3},
-	16:  {compactTag: 0x5f, symIndex: 0x8, system: 0x0},
-	17:  {compactTag: 0x62, symIndex: 0x1, system: 0x0},
-	18:  {compactTag: 0x62, symIndex: 0x38, system: 0x3},
-	19:  {compactTag: 0x62, symIndex: 0x42, system: 0x4},
-	20:  {compactTag: 0x62, symIndex: 0x0, system: 0x5},
-	21:  {compactTag: 0x62, symIndex: 0x0, system: 0x6},
-	22:  {compactTag: 0x62, symIndex: 0x0, system: 0x8},
-	23:  {compactTag: 0x62, symIndex: 0x0, system: 0x9},
-	24:  {compactTag: 0x62, symIndex: 0x0, system: 0xa},
-	25:  {compactTag: 0x62, symIndex: 0x0, system: 0xb},
-	26:  {compactTag: 0x62, symIndex: 0x0, system: 0xc},
-	27:  {compactTag: 0x62, symIndex: 0x0, system: 0xd},
-	28:  {compactTag: 0x62, symIndex: 0x0, system: 0xe},
-	29:  {compactTag: 0x62, symIndex: 0x0, system: 0xf},
-	30:  {compactTag: 0x62, symIndex: 0x0, system: 0x11},
-	31:  {compactTag: 0x62, symIndex: 0x0, system: 0x12},
-	32:  {compactTag: 0x62, symIndex: 0x0, system: 0x13},
-	33:  {compactTag: 0x62, symIndex: 0x0, system: 0x14},
-	34:  {compactTag: 0x62, symIndex: 0x0, system: 0x15},
-	35:  {compactTag: 0x62, symIndex: 0x0, system: 0x16},
-	36:  {compactTag: 0x62, symIndex: 0x0, system: 0x17},
-	37:  {compactTag: 0x62, symIndex: 0x0, system: 0x18},
-	38:  {compactTag: 0x62, symIndex: 0x0, system: 0x19},
-	39:  {compactTag: 0x62, symIndex: 0x0, system: 0x1f},
-	40:  {compactTag: 0x62, symIndex: 0x0, system: 0x21},
-	41:  {compactTag: 0x62, symIndex: 0x0, system: 0x23},
-	42:  {compactTag: 0x62, symIndex: 0x0, system: 0x24},
-	43:  {compactTag: 0x62, symIndex: 0x0, system: 0x25},
-	44:  {compactTag: 0x62, symIndex: 0x0, system: 0x28},
-	45:  {compactTag: 0x62, symIndex: 0x0, system: 0x29},
-	46:  {compactTag: 0x62, symIndex: 0x0, system: 0x2a},
-	47:  {compactTag: 0x62, symIndex: 0x0, system: 0x2b},
-	48:  {compactTag: 0x62, symIndex: 0x0, system: 0x2c},
-	49:  {compactTag: 0x62, symIndex: 0x0, system: 0x2d},
-	50:  {compactTag: 0x62, symIndex: 0x0, system: 0x30},
-	51:  {compactTag: 0x62, symIndex: 0x0, system: 0x31},
-	52:  {compactTag: 0x62, symIndex: 0x0, system: 0x32},
-	53:  {compactTag: 0x62, symIndex: 0x0, system: 0x33},
-	54:  {compactTag: 0x62, symIndex: 0x0, system: 0x34},
-	55:  {compactTag: 0x62, symIndex: 0x0, system: 0x35},
-	56:  {compactTag: 0x62, symIndex: 0x0, system: 0x36},
-	57:  {compactTag: 0x62, symIndex: 0x0, system: 0x37},
-	58:  {compactTag: 0x62, symIndex: 0x0, system: 0x39},
-	59:  {compactTag: 0x62, symIndex: 0x0, system: 0x43},
-	60:  {compactTag: 0x66, symIndex: 0x0, system: 0x0},
-	61:  {compactTag: 0x66, symIndex: 0x38, system: 0x3},
-	62:  {compactTag: 0x66, symIndex: 0x42, system: 0x4},
-	63:  {compactTag: 0x7e, symIndex: 0x50, system: 0x37},
-	64:  {compactTag: 0x7e, symIndex: 0x0, system: 0x0},
-	65:  {compactTag: 0x116, symIndex: 0x43, system: 0x4},
-	66:  {compactTag: 0x116, symIndex: 0x18, system: 0x0},
-	67:  {compactTag: 0x116, symIndex: 0x3b, system: 0x3},
-	68:  {compactTag: 0x125, symIndex: 0x1, system: 0x0},
-	69:  {compactTag: 0x125, symIndex: 0x3c, system: 0x3},
-	70:  {compactTag: 0x125, symIndex: 0x44, system: 0x4},
-	71:  {compactTag: 0x15a, symIndex: 0x0, system: 0x0},
-	72:  {compactTag: 0x15a, symIndex: 0x3b, system: 0x3},
-	73:  {compactTag: 0x15a, symIndex: 0x45, system: 0x4},
-	74:  {compactTag: 0x162, symIndex: 0x0, system: 0x0},
-	75:  {compactTag: 0x162, symIndex: 0x38, system: 0x3},
-	76:  {compactTag: 0x16f, symIndex: 0x1b, system: 0x0},
-	77:  {compactTag: 0x16f, symIndex: 0x0, system: 0x9},
-	78:  {compactTag: 0x16f, symIndex: 0x0, system: 0xa},
-	79:  {compactTag: 0x17e, symIndex: 0x0, system: 0x0},
-	80:  {compactTag: 0x17e, symIndex: 0x3d, system: 0x3},
-	81:  {compactTag: 0x17e, symIndex: 0x42, system: 0x4},
-	82:  {compactTag: 0x183, symIndex: 0x6, system: 0x0},
-	83:  {compactTag: 0x183, symIndex: 0x38, system: 0x3},
-	84:  {compactTag: 0x1af, symIndex: 0x0, system: 0x0},
-	85:  {compactTag: 0x1af, symIndex: 0x3e, system: 0x3},
-	86:  {compactTag: 0x1b4, symIndex: 0x42, system: 0x4},
-	87:  {compactTag: 0x1b4, symIndex: 0x1b, system: 0x0},
-	88:  {compactTag: 0x1d0, symIndex: 0x42, system: 0x4},
-	89:  {compactTag: 0x1d0, symIndex: 0x0, system: 0x0},
-	90:  {compactTag: 0x1f0, symIndex: 0x0, system: 0xb},
-	91:  {compactTag: 0x1fa, symIndex: 0x4e, system: 0x24},
-	92:  {compactTag: 0x1fa, symIndex: 0x26, system: 0x0},
-	93:  {compactTag: 0x1fc, symIndex: 0x42, system: 0x4},
-	94:  {compactTag: 0x201, symIndex: 0x15, system: 0x0},
-	95:  {compactTag: 0x201, symIndex: 0x3f, system: 0x3},
-	96:  {compactTag: 0x201, symIndex: 0x46, system: 0x4},
-	97:  {compactTag: 0x209, symIndex: 0x0, system: 0xb},
-	98:  {compactTag: 0x20c, symIndex: 0x6, system: 0x0},
-	99:  {compactTag: 0x20c, symIndex: 0x38, system: 0x3},
-	100: {compactTag: 0x20c, symIndex: 0x42, system: 0x4},
-	101: {compactTag: 0x22b, symIndex: 0x0, system: 0x0},
-	102: {compactTag: 0x22b, symIndex: 0x47, system: 0x4},
-	103: {compactTag: 0x22c, symIndex: 0x42, system: 0x4},
-	104: {compactTag: 0x22c, symIndex: 0x1b, system: 0x0},
-	105: {compactTag: 0x235, symIndex: 0x42, system: 0x4},
-	106: {compactTag: 0x235, symIndex: 0x28, system: 0x0},
-	107: {compactTag: 0x262, symIndex: 0x38, system: 0x3},
-	108: {compactTag: 0x262, symIndex: 0x0, system: 0x0},
-	109: {compactTag: 0x299, symIndex: 0x22, system: 0x0},
-	110: {compactTag: 0x299, symIndex: 0x40, system: 0x3},
-	111: {compactTag: 0x299, symIndex: 0x48, system: 0x4},
-	112: {compactTag: 0x299, symIndex: 0x4d, system: 0xc},
-	113: {compactTag: 0x2b8, symIndex: 0x31, system: 0x0},
-	114: {compactTag: 0x2b8, symIndex: 0x3e, system: 0x3},
-	115: {compactTag: 0x2b8, symIndex: 0x42, system: 0x4},
-	116: {compactTag: 0x2c8, symIndex: 0x1b, system: 0x0},
-	117: {compactTag: 0x2c8, symIndex: 0x49, system: 0x4},
-	118: {compactTag: 0x2c9, symIndex: 0x49, system: 0x4},
-	119: {compactTag: 0x2cb, symIndex: 0x33, system: 0x0},
-	120: {compactTag: 0x2cb, symIndex: 0x4a, system: 0x4},
-	121: {compactTag: 0x2cc, symIndex: 0x42, system: 0x4},
-	122: {compactTag: 0x2cc, symIndex: 0x28, system: 0x0},
-	123: {compactTag: 0x2ce, symIndex: 0x34, system: 0x0},
-	124: {compactTag: 0x2ce, symIndex: 0x4b, system: 0x4},
-	125: {compactTag: 0x2f4, symIndex: 0x0, system: 0x0},
-	126: {compactTag: 0x2f4, symIndex: 0x38, system: 0x3},
-	127: {compactTag: 0x2f4, symIndex: 0x42, system: 0x4},
-	128: {compactTag: 0x2fa, symIndex: 0x36, system: 0x0},
-	129: {compactTag: 0x2fa, symIndex: 0x41, system: 0x3},
-	130: {compactTag: 0x2fa, symIndex: 0x4c, system: 0x4},
+	3:   {compactTag: 0xa, symIndex: 0x39, system: 0x3},
+	4:   {compactTag: 0xa, symIndex: 0x2, system: 0x0},
+	5:   {compactTag: 0x28, symIndex: 0x0, system: 0x6},
+	6:   {compactTag: 0x2c, symIndex: 0x5, system: 0x0},
+	7:   {compactTag: 0x2c, symIndex: 0x3a, system: 0x3},
+	8:   {compactTag: 0x2c, symIndex: 0x42, system: 0x4},
+	9:   {compactTag: 0x40, symIndex: 0x0, system: 0x6},
+	10:  {compactTag: 0x43, symIndex: 0x0, system: 0x0},
+	11:  {compactTag: 0x43, symIndex: 0x4f, system: 0x37},
+	12:  {compactTag: 0x46, symIndex: 0x1, system: 0x0},
+	13:  {compactTag: 0x46, symIndex: 0x38, system: 0x3},
+	14:  {compactTag: 0x54, symIndex: 0x0, system: 0x9},
+	15:  {compactTag: 0x5d, symIndex: 0x3a, system: 0x3},
+	16:  {compactTag: 0x5d, symIndex: 0x8, system: 0x0},
+	17:  {compactTag: 0x60, symIndex: 0x1, system: 0x0},
+	18:  {compactTag: 0x60, symIndex: 0x38, system: 0x3},
+	19:  {compactTag: 0x60, symIndex: 0x42, system: 0x4},
+	20:  {compactTag: 0x60, symIndex: 0x0, system: 0x5},
+	21:  {compactTag: 0x60, symIndex: 0x0, system: 0x6},
+	22:  {compactTag: 0x60, symIndex: 0x0, system: 0x8},
+	23:  {compactTag: 0x60, symIndex: 0x0, system: 0x9},
+	24:  {compactTag: 0x60, symIndex: 0x0, system: 0xa},
+	25:  {compactTag: 0x60, symIndex: 0x0, system: 0xb},
+	26:  {compactTag: 0x60, symIndex: 0x0, system: 0xc},
+	27:  {compactTag: 0x60, symIndex: 0x0, system: 0xd},
+	28:  {compactTag: 0x60, symIndex: 0x0, system: 0xe},
+	29:  {compactTag: 0x60, symIndex: 0x0, system: 0xf},
+	30:  {compactTag: 0x60, symIndex: 0x0, system: 0x11},
+	31:  {compactTag: 0x60, symIndex: 0x0, system: 0x12},
+	32:  {compactTag: 0x60, symIndex: 0x0, system: 0x13},
+	33:  {compactTag: 0x60, symIndex: 0x0, system: 0x14},
+	34:  {compactTag: 0x60, symIndex: 0x0, system: 0x15},
+	35:  {compactTag: 0x60, symIndex: 0x0, system: 0x16},
+	36:  {compactTag: 0x60, symIndex: 0x0, system: 0x17},
+	37:  {compactTag: 0x60, symIndex: 0x0, system: 0x18},
+	38:  {compactTag: 0x60, symIndex: 0x0, system: 0x19},
+	39:  {compactTag: 0x60, symIndex: 0x0, system: 0x1f},
+	40:  {compactTag: 0x60, symIndex: 0x0, system: 0x21},
+	41:  {compactTag: 0x60, symIndex: 0x0, system: 0x23},
+	42:  {compactTag: 0x60, symIndex: 0x0, system: 0x24},
+	43:  {compactTag: 0x60, symIndex: 0x0, system: 0x25},
+	44:  {compactTag: 0x60, symIndex: 0x0, system: 0x28},
+	45:  {compactTag: 0x60, symIndex: 0x0, system: 0x29},
+	46:  {compactTag: 0x60, symIndex: 0x0, system: 0x2a},
+	47:  {compactTag: 0x60, symIndex: 0x0, system: 0x2b},
+	48:  {compactTag: 0x60, symIndex: 0x0, system: 0x2c},
+	49:  {compactTag: 0x60, symIndex: 0x0, system: 0x2d},
+	50:  {compactTag: 0x60, symIndex: 0x0, system: 0x30},
+	51:  {compactTag: 0x60, symIndex: 0x0, system: 0x31},
+	52:  {compactTag: 0x60, symIndex: 0x0, system: 0x32},
+	53:  {compactTag: 0x60, symIndex: 0x0, system: 0x33},
+	54:  {compactTag: 0x60, symIndex: 0x0, system: 0x34},
+	55:  {compactTag: 0x60, symIndex: 0x0, system: 0x35},
+	56:  {compactTag: 0x60, symIndex: 0x0, system: 0x36},
+	57:  {compactTag: 0x60, symIndex: 0x0, system: 0x37},
+	58:  {compactTag: 0x60, symIndex: 0x0, system: 0x39},
+	59:  {compactTag: 0x60, symIndex: 0x0, system: 0x43},
+	60:  {compactTag: 0x64, symIndex: 0x0, system: 0x0},
+	61:  {compactTag: 0x64, symIndex: 0x38, system: 0x3},
+	62:  {compactTag: 0x64, symIndex: 0x42, system: 0x4},
+	63:  {compactTag: 0x7c, symIndex: 0x50, system: 0x37},
+	64:  {compactTag: 0x7c, symIndex: 0x0, system: 0x0},
+	65:  {compactTag: 0x114, symIndex: 0x43, system: 0x4},
+	66:  {compactTag: 0x114, symIndex: 0x18, system: 0x0},
+	67:  {compactTag: 0x114, symIndex: 0x3b, system: 0x3},
+	68:  {compactTag: 0x123, symIndex: 0x1, system: 0x0},
+	69:  {compactTag: 0x123, symIndex: 0x3c, system: 0x3},
+	70:  {compactTag: 0x123, symIndex: 0x44, system: 0x4},
+	71:  {compactTag: 0x158, symIndex: 0x0, system: 0x0},
+	72:  {compactTag: 0x158, symIndex: 0x3b, system: 0x3},
+	73:  {compactTag: 0x158, symIndex: 0x45, system: 0x4},
+	74:  {compactTag: 0x160, symIndex: 0x0, system: 0x0},
+	75:  {compactTag: 0x160, symIndex: 0x38, system: 0x3},
+	76:  {compactTag: 0x16d, symIndex: 0x1b, system: 0x0},
+	77:  {compactTag: 0x16d, symIndex: 0x0, system: 0x9},
+	78:  {compactTag: 0x16d, symIndex: 0x0, system: 0xa},
+	79:  {compactTag: 0x17c, symIndex: 0x0, system: 0x0},
+	80:  {compactTag: 0x17c, symIndex: 0x3d, system: 0x3},
+	81:  {compactTag: 0x17c, symIndex: 0x42, system: 0x4},
+	82:  {compactTag: 0x182, symIndex: 0x6, system: 0x0},
+	83:  {compactTag: 0x182, symIndex: 0x38, system: 0x3},
+	84:  {compactTag: 0x1b1, symIndex: 0x0, system: 0x0},
+	85:  {compactTag: 0x1b1, symIndex: 0x3e, system: 0x3},
+	86:  {compactTag: 0x1b6, symIndex: 0x42, system: 0x4},
+	87:  {compactTag: 0x1b6, symIndex: 0x1b, system: 0x0},
+	88:  {compactTag: 0x1d2, symIndex: 0x42, system: 0x4},
+	89:  {compactTag: 0x1d2, symIndex: 0x0, system: 0x0},
+	90:  {compactTag: 0x1f3, symIndex: 0x0, system: 0xb},
+	91:  {compactTag: 0x1fd, symIndex: 0x4e, system: 0x24},
+	92:  {compactTag: 0x1fd, symIndex: 0x26, system: 0x0},
+	93:  {compactTag: 0x1ff, symIndex: 0x42, system: 0x4},
+	94:  {compactTag: 0x204, symIndex: 0x15, system: 0x0},
+	95:  {compactTag: 0x204, symIndex: 0x3f, system: 0x3},
+	96:  {compactTag: 0x204, symIndex: 0x46, system: 0x4},
+	97:  {compactTag: 0x20c, symIndex: 0x0, system: 0xb},
+	98:  {compactTag: 0x20f, symIndex: 0x6, system: 0x0},
+	99:  {compactTag: 0x20f, symIndex: 0x38, system: 0x3},
+	100: {compactTag: 0x20f, symIndex: 0x42, system: 0x4},
+	101: {compactTag: 0x22e, symIndex: 0x0, system: 0x0},
+	102: {compactTag: 0x22e, symIndex: 0x47, system: 0x4},
+	103: {compactTag: 0x22f, symIndex: 0x42, system: 0x4},
+	104: {compactTag: 0x22f, symIndex: 0x1b, system: 0x0},
+	105: {compactTag: 0x238, symIndex: 0x42, system: 0x4},
+	106: {compactTag: 0x238, symIndex: 0x28, system: 0x0},
+	107: {compactTag: 0x265, symIndex: 0x38, system: 0x3},
+	108: {compactTag: 0x265, symIndex: 0x0, system: 0x0},
+	109: {compactTag: 0x29d, symIndex: 0x22, system: 0x0},
+	110: {compactTag: 0x29d, symIndex: 0x40, system: 0x3},
+	111: {compactTag: 0x29d, symIndex: 0x48, system: 0x4},
+	112: {compactTag: 0x29d, symIndex: 0x4d, system: 0xc},
+	113: {compactTag: 0x2bd, symIndex: 0x31, system: 0x0},
+	114: {compactTag: 0x2bd, symIndex: 0x3e, system: 0x3},
+	115: {compactTag: 0x2bd, symIndex: 0x42, system: 0x4},
+	116: {compactTag: 0x2cd, symIndex: 0x1b, system: 0x0},
+	117: {compactTag: 0x2cd, symIndex: 0x49, system: 0x4},
+	118: {compactTag: 0x2ce, symIndex: 0x49, system: 0x4},
+	119: {compactTag: 0x2d0, symIndex: 0x33, system: 0x0},
+	120: {compactTag: 0x2d0, symIndex: 0x4a, system: 0x4},
+	121: {compactTag: 0x2d1, symIndex: 0x42, system: 0x4},
+	122: {compactTag: 0x2d1, symIndex: 0x28, system: 0x0},
+	123: {compactTag: 0x2d3, symIndex: 0x34, system: 0x0},
+	124: {compactTag: 0x2d3, symIndex: 0x4b, system: 0x4},
+	125: {compactTag: 0x2f9, symIndex: 0x0, system: 0x0},
+	126: {compactTag: 0x2f9, symIndex: 0x38, system: 0x3},
+	127: {compactTag: 0x2f9, symIndex: 0x42, system: 0x4},
+	128: {compactTag: 0x2ff, symIndex: 0x36, system: 0x0},
+	129: {compactTag: 0x2ff, symIndex: 0x41, system: 0x3},
+	130: {compactTag: 0x2ff, symIndex: 0x4c, system: 0x4},
 } // Size: 810 bytes
 
-var tagToDecimal = []uint8{ // 768 elements
+var tagToDecimal = []uint8{ // 775 elements
 	// Entry 0 - 3F
-	0x01, 0x01, 0x08, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	// Entry 40 - 7F
-	0x01, 0x01, 0x05, 0x05, 0x05, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05,
-	0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x05, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01,
 	// Entry 80 - BF
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
@@ -615,7 +617,7 @@ var tagToDecimal = []uint8{ // 768 elements
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x05, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	// Entry C0 - FF
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
@@ -640,9 +642,9 @@ var tagToDecimal = []uint8{ // 768 elements
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05,
+	0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	// Entry 180 - 1BF
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
@@ -651,7 +653,7 @@ var tagToDecimal = []uint8{ // 768 elements
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x05, 0x05, 0x05, 0x05, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x05,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	// Entry 1C0 - 1FF
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
@@ -659,17 +661,17 @@ var tagToDecimal = []uint8{ // 768 elements
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01,
-	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05,
+	0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	// Entry 200 - 23F
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05,
-	0x01, 0x01, 0x01, 0x05, 0x01, 0x01, 0x05, 0x05,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x05, 0x01,
+	0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	// Entry 240 - 27F
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
@@ -685,8 +687,8 @@ var tagToDecimal = []uint8{ // 768 elements
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x01, 0x01,
-	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05,
+	0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	// Entry 2C0 - 2FF
@@ -698,11 +700,13 @@ var tagToDecimal = []uint8{ // 768 elements
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
 	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01,
-} // Size: 792 bytes
+	// Entry 300 - 33F
+	0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x08,
+} // Size: 799 bytes
 
-var tagToScientific = []uint8{ // 768 elements
+var tagToScientific = []uint8{ // 775 elements
 	// Entry 0 - 3F
-	0x02, 0x02, 0x09, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
@@ -751,9 +755,9 @@ var tagToScientific = []uint8{ // 768 elements
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c,
+	0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	// Entry 180 - 1BF
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
@@ -766,12 +770,12 @@ var tagToScientific = []uint8{ // 768 elements
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	// Entry 1C0 - 1FF
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0d, 0x0d,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	// Entry 200 - 23F
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
@@ -779,8 +783,8 @@ var tagToScientific = []uint8{ // 768 elements
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x02, 0x02, 0x0c, 0x02, 0x02, 0x0c, 0x0c,
-	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, 0x02,
+	0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	// Entry 240 - 27F
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
@@ -789,8 +793,8 @@ var tagToScientific = []uint8{ // 768 elements
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-	0x02, 0x02, 0x02, 0x02, 0x0d, 0x0d, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
+	0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	// Entry 280 - 2BF
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
@@ -809,118 +813,122 @@ var tagToScientific = []uint8{ // 768 elements
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
 	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02,
-} // Size: 792 bytes
+	// Entry 300 - 33F
+	0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x09,
+} // Size: 799 bytes
 
-var tagToPercent = []uint8{ // 768 elements
+var tagToPercent = []uint8{ // 775 elements
 	// Entry 0 - 3F
-	0x04, 0x04, 0x0a, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03,
-	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	// Entry 40 - 7F
-	0x04, 0x04, 0x06, 0x06, 0x06, 0x04, 0x04, 0x04,
-	0x03, 0x03, 0x06, 0x06, 0x03, 0x04, 0x04, 0x03,
-	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, 0x06,
-	0x06, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04,
-	0x03, 0x03, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03,
-	0x04, 0x03, 0x03, 0x04, 0x03, 0x04, 0x04, 0x03,
-	0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x07, 0x07,
+	0x06, 0x06, 0x06, 0x04, 0x04, 0x04, 0x03, 0x03,
+	0x06, 0x06, 0x03, 0x04, 0x04, 0x03, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03,
+	0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, 0x03,
+	0x03, 0x04, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x07, 0x07, 0x04, 0x04,
 	// Entry 80 - BF
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04,
-	0x03, 0x04, 0x04, 0x03, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x03, 0x04,
+	0x04, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x06, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	// Entry C0 - FF
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
 	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
 	// Entry 100 - 13F
 	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04,
+	0x0b, 0x0b, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04,
 	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
-	0x04, 0x04, 0x0b, 0x0b, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03,
-	0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
-	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x03, 0x03,
 	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
 	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
 	// Entry 140 - 17F
 	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
 	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
-	0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03,
-	0x03, 0x03, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x03, 0x03,
+	0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06,
+	0x06, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	// Entry 180 - 1BF
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03,
-	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04,
-	0x04, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x06,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04,
 	// Entry 1C0 - 1FF
-	0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	// Entry 200 - 23F
-	0x04, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, 0x06,
-	0x04, 0x04, 0x04, 0x06, 0x04, 0x04, 0x06, 0x06,
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x06, 0x04,
+	0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	// Entry 240 - 27F
-	0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03,
-	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04,
-	0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03,
+	0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03,
+	0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03,
-	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03,
-	0x03, 0x03, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04,
-	// Entry 280 - 2BF
+	0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04,
+	// Entry 280 - 2BF
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x04, 0x04,
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06,
+	0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04,
-	0x04, 0x04, 0x0e, 0x0e, 0x0e, 0x04, 0x03, 0x03,
+	0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x0e,
 	// Entry 2C0 - 2FF
+	0x0e, 0x0e, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
 	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04,
-	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
-} // Size: 792 bytes
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03,
+	0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04,
+	// Entry 300 - 33F
+	0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x0a,
+} // Size: 799 bytes
 
 var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0,
 	MaxFractionDigits:    0,
@@ -1208,4 +1216,4 @@ var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantD
 			0x0},
 		Flags: 0x0}}
 
-// Total table size 8599 bytes (8KiB); checksum: F01E770E
+// Total table size 8634 bytes (8KiB); checksum: BE6D4A33
diff --git a/vendor/golang.org/x/text/internal/tables.go b/vendor/golang.org/x/text/internal/tables.go
deleted file mode 100644
index 85991d3..0000000
--- a/vendor/golang.org/x/text/internal/tables.go
+++ /dev/null
@@ -1,118 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package internal
-
-// Parent maps a compact index of a tag to the compact index of the parent of
-// this tag.
-var Parent = []uint16{ // 768 elements
-	// Entry 0 - 3F
-	0x0000, 0x0053, 0x00e8, 0x0000, 0x0003, 0x0003, 0x0000, 0x0006,
-	0x0000, 0x0008, 0x0000, 0x000a, 0x0000, 0x000c, 0x000c, 0x000c,
-	0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c,
-	0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c,
-	0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c,
-	0x000c, 0x0000, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x002e,
-	0x0000, 0x0000, 0x0031, 0x0030, 0x0030, 0x0000, 0x0035, 0x0000,
-	0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x003d, 0x0000,
-	// Entry 40 - 7F
-	0x0000, 0x0040, 0x0000, 0x0042, 0x0042, 0x0000, 0x0045, 0x0045,
-	0x0000, 0x0048, 0x0000, 0x004a, 0x0000, 0x0000, 0x004d, 0x004c,
-	0x004c, 0x0000, 0x0051, 0x0051, 0x0051, 0x0051, 0x0000, 0x0056,
-	0x0056, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x0000,
-	0x005f, 0x005f, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
-	0x0000, 0x0068, 0x0068, 0x0000, 0x006b, 0x0000, 0x006d, 0x006d,
-	0x006d, 0x006d, 0x006d, 0x006d, 0x006d, 0x0000, 0x0075, 0x0000,
-	0x0077, 0x0000, 0x0079, 0x0000, 0x0000, 0x007c, 0x0000, 0x007e,
-	// Entry 80 - BF
-	0x0000, 0x0080, 0x0000, 0x0082, 0x0082, 0x0000, 0x0085, 0x0085,
-	0x0000, 0x0088, 0x0089, 0x0089, 0x0089, 0x0088, 0x008a, 0x0089,
-	0x0089, 0x0089, 0x0088, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x0089, 0x008a, 0x0089, 0x0089, 0x0089, 0x0089, 0x008a, 0x0089,
-	0x008a, 0x0089, 0x0089, 0x008a, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0088, 0x0089, 0x0089,
-	0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0088,
-	// Entry C0 - FF
-	0x0089, 0x0088, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x0089, 0x0089, 0x008a, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x0089, 0x0089, 0x0088, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x008a, 0x0089, 0x0089, 0x008a, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0089, 0x0088,
-	0x0088, 0x0089, 0x0089, 0x0088, 0x0089, 0x0089, 0x0089, 0x0089,
-	0x0089, 0x0000, 0x00f1, 0x0000, 0x00f3, 0x00f4, 0x00f4, 0x00f4,
-	0x00f4, 0x00f4, 0x00f4, 0x00f4, 0x00f4, 0x00f4, 0x00f3, 0x00f4,
-	// Entry 100 - 13F
-	0x00f3, 0x00f3, 0x00f4, 0x00f4, 0x00f3, 0x00f4, 0x00f4, 0x00f4,
-	0x00f4, 0x00f3, 0x00f4, 0x00f4, 0x00f4, 0x00f4, 0x00f4, 0x00f4,
-	0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0000, 0x0116,
-	0x0116, 0x0000, 0x0119, 0x0119, 0x0119, 0x0119, 0x0000, 0x011e,
-	0x0000, 0x0120, 0x0000, 0x0122, 0x0122, 0x0000, 0x0125, 0x0125,
-	0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125,
-	0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125,
-	0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125,
-	// Entry 140 - 17F
-	0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125,
-	0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125, 0x0125,
-	0x0125, 0x0125, 0x0125, 0x0125, 0x0000, 0x0154, 0x0000, 0x0156,
-	0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x0000, 0x015e,
-	0x015e, 0x015e, 0x0000, 0x0162, 0x0000, 0x0000, 0x0165, 0x0000,
-	0x0167, 0x0000, 0x0169, 0x0169, 0x0169, 0x0000, 0x016d, 0x0000,
-	0x016f, 0x0000, 0x0171, 0x0000, 0x0173, 0x0173, 0x0000, 0x0176,
-	0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
-	// Entry 180 - 1BF
-	0x0000, 0x0180, 0x0000, 0x0000, 0x0183, 0x0000, 0x0185, 0x0185,
-	0x0185, 0x0185, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
-	0x0000, 0x0190, 0x0000, 0x0000, 0x0193, 0x0000, 0x0195, 0x0000,
-	0x0000, 0x0198, 0x0000, 0x0000, 0x019b, 0x0000, 0x019d, 0x0000,
-	0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
-	0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
-	0x01af, 0x01af, 0x0000, 0x01b2, 0x0000, 0x01b4, 0x0000, 0x01b6,
-	0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x0000, 0x01bd, 0x0000,
-	// Entry 1C0 - 1FF
-	0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
-	0x01c7, 0x0000, 0x01c9, 0x01c9, 0x01c9, 0x01c9, 0x0000, 0x01ce,
-	0x0000, 0x01d0, 0x01d0, 0x0000, 0x01d3, 0x0000, 0x01d5, 0x0000,
-	0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x01dd,
-	0x0000, 0x01e0, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
-	0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
-	0x0000, 0x01f0, 0x0000, 0x01f2, 0x01f2, 0x01f2, 0x0000, 0x01f6,
-	0x0000, 0x01f8, 0x0000, 0x01fa, 0x0000, 0x01fc, 0x0000, 0x0000,
-	// Entry 200 - 23F
-	0x01ff, 0x0000, 0x0201, 0x0201, 0x0000, 0x0204, 0x0000, 0x0206,
-	0x0206, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x020c,
-	0x020c, 0x020c, 0x020c, 0x020c, 0x0000, 0x0214, 0x0000, 0x0216,
-	0x0000, 0x0218, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x021e,
-	0x0000, 0x0000, 0x0221, 0x0000, 0x0223, 0x0223, 0x0000, 0x0226,
-	0x0000, 0x0228, 0x0228, 0x0000, 0x0000, 0x022c, 0x022b, 0x022b,
-	0x0000, 0x0000, 0x0231, 0x0000, 0x0233, 0x0000, 0x0235, 0x0000,
-	0x0241, 0x0237, 0x0241, 0x0241, 0x0241, 0x0241, 0x0241, 0x0241,
-	// Entry 240 - 27F
-	0x0241, 0x0237, 0x0241, 0x0241, 0x0000, 0x0244, 0x0244, 0x0244,
-	0x0000, 0x0248, 0x0000, 0x024a, 0x0000, 0x024c, 0x024c, 0x0000,
-	0x024f, 0x0000, 0x0251, 0x0251, 0x0251, 0x0251, 0x0251, 0x0251,
-	0x0000, 0x0258, 0x0000, 0x025a, 0x0000, 0x025c, 0x0000, 0x025e,
-	0x0000, 0x0260, 0x0000, 0x0262, 0x0000, 0x0000, 0x0265, 0x0265,
-	0x0265, 0x0000, 0x0269, 0x0000, 0x026b, 0x0000, 0x026d, 0x0000,
-	0x0000, 0x0270, 0x026f, 0x026f, 0x0000, 0x0274, 0x0000, 0x0276,
-	0x0000, 0x0278, 0x0000, 0x0000, 0x0000, 0x0000, 0x027d, 0x0000,
-	// Entry 280 - 2BF
-	0x0000, 0x0280, 0x0000, 0x0282, 0x0282, 0x0282, 0x0282, 0x0000,
-	0x0287, 0x0287, 0x0287, 0x0000, 0x028b, 0x028b, 0x028b, 0x028b,
-	0x028b, 0x0000, 0x0291, 0x0291, 0x0291, 0x0291, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0299, 0x0299, 0x0299, 0x0000, 0x029d, 0x029d,
-	0x029d, 0x029d, 0x0000, 0x0000, 0x02a3, 0x02a3, 0x02a3, 0x02a3,
-	0x0000, 0x02a8, 0x0000, 0x02aa, 0x02aa, 0x0000, 0x02ad, 0x0000,
-	0x02af, 0x0000, 0x02b1, 0x02b1, 0x0000, 0x0000, 0x02b5, 0x0000,
-	0x0000, 0x02b8, 0x0000, 0x02ba, 0x02ba, 0x0000, 0x0000, 0x02be,
-	// Entry 2C0 - 2FF
-	0x0000, 0x02c0, 0x0000, 0x02c2, 0x0000, 0x02c4, 0x0000, 0x02c6,
-	0x0000, 0x02c8, 0x02c8, 0x0000, 0x0000, 0x02cc, 0x0000, 0x02ce,
-	0x02cb, 0x02cb, 0x0000, 0x0000, 0x02d3, 0x02d2, 0x02d2, 0x0000,
-	0x0000, 0x02d8, 0x0000, 0x02da, 0x0000, 0x02dc, 0x0000, 0x0000,
-	0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
-	0x0000, 0x02e8, 0x0000, 0x02ea, 0x02ea, 0x0000, 0x0000, 0x02ee,
-	0x02ed, 0x02ed, 0x0000, 0x02f2, 0x0000, 0x02f4, 0x02f4, 0x02f4,
-	0x02f4, 0x02f4, 0x0000, 0x02fa, 0x02fb, 0x02fa, 0x0000, 0x02fe,
-} // Size: 1560 bytes
-
-// Total table size 1560 bytes (1KiB); checksum: 4897681C
diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile
deleted file mode 100644
index 79f0057..0000000
--- a/vendor/golang.org/x/text/language/Makefile
+++ /dev/null
@@ -1,16 +0,0 @@
-# Copyright 2013 The Go Authors. All rights reserved.
-# Use of this source code is governed by a BSD-style
-# license that can be found in the LICENSE file.
-
-CLEANFILES+=maketables
-
-maketables: maketables.go
-	go build $^
-
-tables:	maketables
-	./maketables > tables.go
-	gofmt -w -s tables.go
-
-# Build (but do not run) maketables during testing,
-# just to make sure it still compiles.
-testshort: maketables
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
index 101fd23..a24fd1a 100644
--- a/vendor/golang.org/x/text/language/coverage.go
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -7,6 +7,8 @@ package language
 import (
 	"fmt"
 	"sort"
+
+	"golang.org/x/text/internal/language"
 )
 
 // The Coverage interface is used to define the level of coverage of an
@@ -44,9 +46,9 @@ type allSubtags struct{}
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" region is not returned.
 func (s allSubtags) Regions() []Region {
-	reg := make([]Region, numRegions)
+	reg := make([]Region, language.NumRegions)
 	for i := range reg {
-		reg[i] = Region{regionID(i + 1)}
+		reg[i] = Region{language.Region(i + 1)}
 	}
 	return reg
 }
@@ -55,9 +57,9 @@ func (s allSubtags) Regions() []Region {
 // consecutive range, it simply returns a slice of numbers in increasing order.
 // The "undefined" script is not returned.
 func (s allSubtags) Scripts() []Script {
-	scr := make([]Script, numScripts)
+	scr := make([]Script, language.NumScripts)
 	for i := range scr {
-		scr[i] = Script{scriptID(i + 1)}
+		scr[i] = Script{language.Script(i + 1)}
 	}
 	return scr
 }
@@ -65,22 +67,10 @@ func (s allSubtags) Scripts() []Script {
 // BaseLanguages returns the list of all supported base languages. It generates
 // the list by traversing the internal structures.
 func (s allSubtags) BaseLanguages() []Base {
-	base := make([]Base, 0, numLanguages)
-	for i := 0; i < langNoIndexOffset; i++ {
-		// We included "und" already for the value 0.
-		if i != nonCanonicalUnd {
-			base = append(base, Base{langID(i)})
-		}
-	}
-	i := langNoIndexOffset
-	for _, v := range langNoIndex {
-		for k := 0; k < 8; k++ {
-			if v&1 == 1 {
-				base = append(base, Base{langID(i)})
-			}
-			v >>= 1
-			i++
-		}
+	bs := language.BaseLanguages()
+	base := make([]Base, len(bs))
+	for i, b := range bs {
+		base[i] = Base{b}
 	}
 	return base
 }
@@ -90,7 +80,7 @@ func (s allSubtags) Tags() []Tag {
 	return nil
 }
 
-// coverage is used used by NewCoverage which is used as a convenient way for
+// coverage is used by NewCoverage which is used as a convenient way for
 // creating Coverage implementations for partially defined data. Very often a
 // package will only need to define a subset of slices. coverage provides a
 // convenient way to do this. Moreover, packages using NewCoverage, instead of
@@ -134,7 +124,7 @@ func (s *coverage) BaseLanguages() []Base {
 		}
 		a := make([]Base, len(tags))
 		for i, t := range tags {
-			a[i] = Base{langID(t.lang)}
+			a[i] = Base{language.Language(t.lang())}
 		}
 		sort.Sort(bases(a))
 		k := 0
diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go
index 302f194..3004eb4 100644
--- a/vendor/golang.org/x/text/language/gen.go
+++ b/vendor/golang.org/x/text/language/gen.go
@@ -10,21 +10,16 @@
 package main
 
 import (
-	"bufio"
 	"flag"
 	"fmt"
 	"io"
-	"io/ioutil"
 	"log"
-	"math"
-	"reflect"
-	"regexp"
 	"sort"
 	"strconv"
 	"strings"
 
 	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/internal/language"
 	"golang.org/x/text/unicode/cldr"
 )
 
@@ -37,272 +32,17 @@ var (
 		"output file for generated tables")
 )
 
-var comment = []string{
-	`
-lang holds an alphabetically sorted list of ISO-639 language identifiers.
-All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-For 2-byte language identifiers, the two successive bytes have the following meaning:
-    - if the first letter of the 2- and 3-letter ISO codes are the same:
-      the second and third letter of the 3-letter ISO code.
-    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-For 3-byte language identifiers the 4th byte is 0.`,
-	`
-langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-in lookup tables. The language ids for these language codes are derived directly
-from the letters and are not consecutive.`,
-	`
-altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-to 2-letter language codes that cannot be derived using the method described above.
-Each 3-letter code is followed by its 1-byte langID.`,
-	`
-altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
-	`
-langAliasMap maps langIDs to their suggested replacements.`,
-	`
-script is an alphabetically sorted list of ISO 15924 codes. The index
-of the script in the string, divided by 4, is the internal scriptID.`,
-	`
-isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-the UN.M49 codes used for groups.)`,
-	`
-regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-Each 2-letter codes is followed by two bytes with the following meaning:
-    - [A-Z}{2}: the first letter of the 2-letter code plus these two 
-                letters form the 3-letter ISO code.
-    - 0, n:     index into altRegionISO3.`,
-	`
-regionTypes defines the status of a region for various standards.`,
-	`
-m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-codes indicating collections of regions.`,
-	`
-m49Index gives indexes into fromM49 based on the three most significant bits
-of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-The region code is stored in the 9 lsb of the indexed value.`,
-	`
-fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
-	`
-altRegionISO3 holds a list of 3-letter region codes that cannot be
-mapped to 2-letter codes using the default algorithm. This is a short list.`,
-	`
-altRegionIDs holds a list of regionIDs the positions of which match those
-of the 3-letter ISO codes in altRegionISO3.`,
-	`
-variantNumSpecialized is the number of specialized variants in variants.`,
-	`
-suppressScript is an index from langID to the dominant script for that language,
-if it exists.  If a script is given, it should be suppressed from the language tag.`,
-	`
-likelyLang is a lookup table, indexed by langID, for the most likely
-scripts and regions given incomplete information. If more entries exist for a
-given language, region and script are the index and size respectively
-of the list in likelyLangList.`,
-	`
-likelyLangList holds lists info associated with likelyLang.`,
-	`
-likelyRegion is a lookup table, indexed by regionID, for the most likely
-languages and scripts given incomplete information. If more entries exist
-for a given regionID, lang and script are the index and size respectively
-of the list in likelyRegionList.
-TODO: exclude containers and user-definable regions from the list.`,
-	`
-likelyRegionList holds lists info associated with likelyRegion.`,
-	`
-likelyScript is a lookup table, indexed by scriptID, for the most likely
-languages and regions given a script.`,
-	`
-matchLang holds pairs of langIDs of base languages that are typically
-mutually intelligible. Each pair is associated with a confidence and
-whether the intelligibility goes one or both ways.`,
-	`
-matchScript holds pairs of scriptIDs where readers of one script
-can typically also read the other. Each is associated with a confidence.`,
-	`
-nRegionGroups is the number of region groups.`,
-	`
-regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-where each set holds all groupings that are directly connected in a region
-containment graph.`,
-	`
-regionInclusionBits is an array of bit vectors where every vector represents
-a set of region groupings.  These sets are used to compute the distance
-between two regions for the purpose of language matching.`,
-	`
-regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-all groups that are reachable from the groups set in the respective entry.`,
-}
-
-// TODO: consider changing some of these structures to tries. This can reduce
-// memory, but may increase the need for memory allocations. This could be
-// mitigated if we can piggyback on language tags for common cases.
-
-func failOnError(e error) {
-	if e != nil {
-		log.Panic(e)
-	}
-}
-
-type setType int
-
-const (
-	Indexed setType = 1 + iota // all elements must be of same size
-	Linear
-)
-
-type stringSet struct {
-	s              []string
-	sorted, frozen bool
-
-	// We often need to update values after the creation of an index is completed.
-	// We include a convenience map for keeping track of this.
-	update map[string]string
-	typ    setType // used for checking.
-}
-
-func (ss *stringSet) clone() stringSet {
-	c := *ss
-	c.s = append([]string(nil), c.s...)
-	return c
-}
-
-func (ss *stringSet) setType(t setType) {
-	if ss.typ != t && ss.typ != 0 {
-		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
-	}
-}
-
-// parse parses a whitespace-separated string and initializes ss with its
-// components.
-func (ss *stringSet) parse(s string) {
-	scan := bufio.NewScanner(strings.NewReader(s))
-	scan.Split(bufio.ScanWords)
-	for scan.Scan() {
-		ss.add(scan.Text())
-	}
-}
-
-func (ss *stringSet) assertChangeable() {
-	if ss.frozen {
-		log.Panic("attempt to modify a frozen stringSet")
-	}
-}
-
-func (ss *stringSet) add(s string) {
-	ss.assertChangeable()
-	ss.s = append(ss.s, s)
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) freeze() {
-	ss.compact()
-	ss.frozen = true
-}
-
-func (ss *stringSet) compact() {
-	if ss.sorted {
-		return
-	}
-	a := ss.s
-	sort.Strings(a)
-	k := 0
-	for i := 1; i < len(a); i++ {
-		if a[k] != a[i] {
-			a[k+1] = a[i]
-			k++
-		}
-	}
-	ss.s = a[:k+1]
-	ss.sorted = ss.frozen
-}
-
-type funcSorter struct {
-	fn func(a, b string) bool
-	sort.StringSlice
-}
-
-func (s funcSorter) Less(i, j int) bool {
-	return s.fn(s.StringSlice[i], s.StringSlice[j])
-}
-
-func (ss *stringSet) sortFunc(f func(a, b string) bool) {
-	ss.compact()
-	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
-}
-
-func (ss *stringSet) remove(s string) {
-	ss.assertChangeable()
-	if i, ok := ss.find(s); ok {
-		copy(ss.s[i:], ss.s[i+1:])
-		ss.s = ss.s[:len(ss.s)-1]
-	}
-}
-
-func (ss *stringSet) replace(ol, nu string) {
-	ss.s[ss.index(ol)] = nu
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) index(s string) int {
-	ss.setType(Indexed)
-	i, ok := ss.find(s)
-	if !ok {
-		if i < len(ss.s) {
-			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
-		}
-		log.Panicf("find: item %q is not in list", s)
-
-	}
-	return i
-}
-
-func (ss *stringSet) find(s string) (int, bool) {
-	ss.compact()
-	i := sort.SearchStrings(ss.s, s)
-	return i, i != len(ss.s) && ss.s[i] == s
-}
-
-func (ss *stringSet) slice() []string {
-	ss.compact()
-	return ss.s
-}
+func main() {
+	gen.Init()
 
-func (ss *stringSet) updateLater(v, key string) {
-	if ss.update == nil {
-		ss.update = map[string]string{}
-	}
-	ss.update[v] = key
-}
+	w := gen.NewCodeWriter()
+	defer w.WriteGoFile("tables.go", "language")
 
-// join joins the string and ensures that all entries are of the same length.
-func (ss *stringSet) join() string {
-	ss.setType(Indexed)
-	n := len(ss.s[0])
-	for _, s := range ss.s {
-		if len(s) != n {
-			log.Panicf("join: not all entries are of the same length: %q", s)
-		}
-	}
-	ss.s = append(ss.s, strings.Repeat("\xff", n))
-	return strings.Join(ss.s, "")
-}
+	b := newBuilder(w)
+	gen.WriteCLDRVersion(w)
 
-// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
-// All types use the same entry.
-// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
-// fields.
-type ianaEntry struct {
-	typ            string
-	description    []string
-	scope          string
-	added          string
-	preferred      string
-	deprecated     string
-	suppressScript string
-	macro          string
-	prefix         []string
+	b.writeConstants()
+	b.writeMatchData()
 }
 
 type builder struct {
@@ -310,546 +50,51 @@ type builder struct {
 	hw   io.Writer // MultiWriter for w and w.Hash
 	data *cldr.CLDR
 	supp *cldr.SupplementalData
+}
 
-	// indices
-	locale      stringSet // common locales
-	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
-	langNoIndex stringSet // 3-letter ISO codes with no associated data
-	script      stringSet // 4-letter ISO codes
-	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
-	variant     stringSet // 4-8-alphanumeric variant code.
-
-	// Region codes that are groups with their corresponding group IDs.
-	groups map[int]index
+func (b *builder) langIndex(s string) uint16 {
+	return uint16(language.MustParseBase(s))
+}
 
-	// langInfo
-	registry map[string]*ianaEntry
+func (b *builder) regionIndex(s string) int {
+	return int(language.MustParseRegion(s))
 }
 
-type index uint
+func (b *builder) scriptIndex(s string) int {
+	return int(language.MustParseScript(s))
+}
 
 func newBuilder(w *gen.CodeWriter) *builder {
 	r := gen.OpenCLDRCoreZip()
 	defer r.Close()
 	d := &cldr.Decoder{}
 	data, err := d.DecodeZip(r)
-	failOnError(err)
+	if err != nil {
+		log.Fatal(err)
+	}
 	b := builder{
 		w:    w,
 		hw:   io.MultiWriter(w, w.Hash),
 		data: data,
 		supp: data.Supplemental(),
 	}
-	b.parseRegistry()
 	return &b
 }
 
-func (b *builder) parseRegistry() {
-	r := gen.OpenIANAFile("assignments/language-subtag-registry")
-	defer r.Close()
-	b.registry = make(map[string]*ianaEntry)
-
-	scan := bufio.NewScanner(r)
-	scan.Split(bufio.ScanWords)
-	var record *ianaEntry
-	for more := scan.Scan(); more; {
-		key := scan.Text()
-		more = scan.Scan()
-		value := scan.Text()
-		switch key {
-		case "Type:":
-			record = &ianaEntry{typ: value}
-		case "Subtag:", "Tag:":
-			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
-				for a := s[0]; a <= s[1]; a = inc(a) {
-					b.addToRegistry(a, record)
-				}
-			} else {
-				b.addToRegistry(value, record)
-			}
-		case "Suppress-Script:":
-			record.suppressScript = value
-		case "Added:":
-			record.added = value
-		case "Deprecated:":
-			record.deprecated = value
-		case "Macrolanguage:":
-			record.macro = value
-		case "Preferred-Value:":
-			record.preferred = value
-		case "Prefix:":
-			record.prefix = append(record.prefix, value)
-		case "Scope:":
-			record.scope = value
-		case "Description:":
-			buf := []byte(value)
-			for more = scan.Scan(); more; more = scan.Scan() {
-				b := scan.Bytes()
-				if b[0] == '%' || b[len(b)-1] == ':' {
-					break
-				}
-				buf = append(buf, ' ')
-				buf = append(buf, b...)
-			}
-			record.description = append(record.description, string(buf))
-			continue
-		default:
-			continue
-		}
-		more = scan.Scan()
-	}
-	if scan.Err() != nil {
-		log.Panic(scan.Err())
-	}
-}
-
-func (b *builder) addToRegistry(key string, entry *ianaEntry) {
-	if info, ok := b.registry[key]; ok {
-		if info.typ != "language" || entry.typ != "extlang" {
-			log.Fatalf("parseRegistry: tag %q already exists", key)
-		}
-	} else {
-		b.registry[key] = entry
-	}
-}
-
-var commentIndex = make(map[string]string)
-
-func init() {
-	for _, s := range comment {
-		key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
-		commentIndex[key] = s
-	}
-}
-
-func (b *builder) comment(name string) {
-	if s := commentIndex[name]; len(s) > 0 {
-		b.w.WriteComment(s)
-	} else {
-		fmt.Fprintln(b.w)
-	}
-}
-
-func (b *builder) pf(f string, x ...interface{}) {
-	fmt.Fprintf(b.hw, f, x...)
-	fmt.Fprint(b.hw, "\n")
-}
-
-func (b *builder) p(x ...interface{}) {
-	fmt.Fprintln(b.hw, x...)
-}
-
-func (b *builder) addSize(s int) {
-	b.w.Size += s
-	b.pf("// Size: %d bytes", s)
-}
-
-func (b *builder) writeConst(name string, x interface{}) {
-	b.comment(name)
-	b.w.WriteConst(name, x)
-}
-
 // writeConsts computes f(v) for all v in values and writes the results
 // as constants named _v to a single constant block.
 func (b *builder) writeConsts(f func(string) int, values ...string) {
-	b.pf("const (")
+	fmt.Fprintln(b.w, "const (")
 	for _, v := range values {
-		b.pf("\t_%s = %v", v, f(v))
-	}
-	b.pf(")")
-}
-
-// writeType writes the type of the given value, which must be a struct.
-func (b *builder) writeType(value interface{}) {
-	b.comment(reflect.TypeOf(value).Name())
-	b.w.WriteType(value)
-}
-
-func (b *builder) writeSlice(name string, ss interface{}) {
-	b.writeSliceAddSize(name, 0, ss)
-}
-
-func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
-	b.comment(name)
-	b.w.Size += extraSize
-	v := reflect.ValueOf(ss)
-	t := v.Type().Elem()
-	b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
-
-	fmt.Fprintf(b.w, "var %s = ", name)
-	b.w.WriteArray(ss)
-	b.p()
-}
-
-type fromTo struct {
-	from, to uint16
-}
-
-func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
-	ss.sortFunc(func(a, b string) bool {
-		return index(a) < index(b)
-	})
-	m := []fromTo{}
-	for _, s := range ss.s {
-		m = append(m, fromTo{index(s), index(ss.update[s])})
-	}
-	b.writeSlice(name, m)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s string) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-func (b *builder) writeBitVector(name string, ss []string) {
-	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
-	for _, s := range ss {
-		v := strToInt(s)
-		vec[v/8] |= 1 << (v % 8)
-	}
-	b.writeSlice(name, vec)
-}
-
-// TODO: convert this type into a list or two-stage trie.
-func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()))
-	for _, k := range m {
-		sz += len(k)
-	}
-	b.addSize(sz)
-	keys := []string{}
-	b.pf(`var %s = map[string]uint16{`, name)
-	for k := range m {
-		keys = append(keys, k)
-	}
-	sort.Strings(keys)
-	for _, k := range keys {
-		b.pf("\t%q: %v,", k, f(m[k]))
-	}
-	b.p("}")
-}
-
-func (b *builder) writeMap(name string, m interface{}) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
-	b.addSize(sz)
-	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
-		return strings.IndexRune("{}, ", r) != -1
-	})
-	sort.Strings(f[1:])
-	b.pf(`var %s = %s{`, name, f[0])
-	for _, kv := range f[1:] {
-		b.pf("\t%s,", kv)
-	}
-	b.p("}")
-}
-
-func (b *builder) langIndex(s string) uint16 {
-	if s == "und" {
-		return 0
-	}
-	if i, ok := b.lang.find(s); ok {
-		return uint16(i)
-	}
-	return uint16(strToInt(s)) + uint16(len(b.lang.s))
-}
-
-// inc advances the string to its lexicographical successor.
-func inc(s string) string {
-	const maxTagLength = 4
-	var buf [maxTagLength]byte
-	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
-	for i := 0; i < len(s); i++ {
-		if s[i] <= 'Z' {
-			buf[i] -= 'a' - 'A'
-		}
-	}
-	return string(buf[:len(s)])
-}
-
-func (b *builder) parseIndices() {
-	meta := b.supp.Metadata
-
-	for k, v := range b.registry {
-		var ss *stringSet
-		switch v.typ {
-		case "language":
-			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
-				b.lang.add(k)
-				continue
-			} else {
-				ss = &b.langNoIndex
-			}
-		case "region":
-			ss = &b.region
-		case "script":
-			ss = &b.script
-		case "variant":
-			ss = &b.variant
-		default:
-			continue
-		}
-		ss.add(k)
-	}
-	// Include any language for which there is data.
-	for _, lang := range b.data.Locales() {
-		if x := b.data.RawLDML(lang); false ||
-			x.LocaleDisplayNames != nil ||
-			x.Characters != nil ||
-			x.Delimiters != nil ||
-			x.Measurement != nil ||
-			x.Dates != nil ||
-			x.Numbers != nil ||
-			x.Units != nil ||
-			x.ListPatterns != nil ||
-			x.Collations != nil ||
-			x.Segmentations != nil ||
-			x.Rbnf != nil ||
-			x.Annotations != nil ||
-			x.Metadata != nil {
-
-			from := strings.Split(lang, "_")
-			if lang := from[0]; lang != "root" {
-				b.lang.add(lang)
-			}
-		}
-	}
-	// Include locales for plural rules, which uses a different structure.
-	for _, plurals := range b.data.Supplemental().Plurals {
-		for _, rules := range plurals.PluralRules {
-			for _, lang := range strings.Split(rules.Locales, " ") {
-				if lang = strings.Split(lang, "_")[0]; lang != "root" {
-					b.lang.add(lang)
-				}
-			}
-		}
+		fmt.Fprintf(b.w, "\t_%s = %v\n", v, f(v))
 	}
-	// Include languages in likely subtags.
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		b.lang.add(from[0])
-	}
-	// Include ISO-639 alpha-3 bibliographic entries.
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Reason == "bibliographic" {
-			b.langNoIndex.add(a.Type)
-		}
-	}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 {
-			b.region.add(reg.Type)
-		}
-	}
-
-	for _, s := range b.lang.s {
-		if len(s) == 3 {
-			b.langNoIndex.remove(s)
-		}
-	}
-	b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
-	b.writeConst("numScripts", len(b.script.slice()))
-	b.writeConst("numRegions", len(b.region.slice()))
-
-	// Add dummy codes at the start of each list to represent "unspecified".
-	b.lang.add("---")
-	b.script.add("----")
-	b.region.add("---")
-
-	// common locales
-	b.locale.parse(meta.DefaultContent.Locales)
+	fmt.Fprintln(b.w, ")")
 }
 
 // TODO: region inclusion data will probably not be use used in future matchers.
 
-func (b *builder) computeRegionGroups() {
-	b.groups = make(map[int]index)
-
-	// Create group indices.
-	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
-		b.groups[i] = index(len(b.groups))
-	}
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		if _, ok := b.groups[group]; !ok {
-			b.groups[group] = index(len(b.groups))
-		}
-	}
-	if len(b.groups) > 64 {
-		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
-	}
-	b.writeConst("nRegionGroups", len(b.groups))
-}
-
 var langConsts = []string{
-	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
-	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
-	"it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
-	"mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
-	"ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
-	"tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
-
-	// constants for grandfathered tags (if not already defined)
-	"jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
-	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
-}
-
-// writeLanguage generates all tables needed for language canonicalization.
-func (b *builder) writeLanguage() {
-	meta := b.supp.Metadata
-
-	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
-	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
-	b.writeConst("langPrivateStart", b.langIndex("qaa"))
-	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
-
-	// Get language codes that need to be mapped (overlong 3-letter codes,
-	// deprecated 2-letter codes, legacy and grandfathered tags.)
-	langAliasMap := stringSet{}
-	aliasTypeMap := map[string]langAliasType{}
-
-	// altLangISO3 get the alternative ISO3 names that need to be mapped.
-	altLangISO3 := stringSet{}
-	// Add dummy start to avoid the use of index 0.
-	altLangISO3.add("---")
-	altLangISO3.updateLater("---", "aa")
-
-	lang := b.lang.clone()
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Replacement == "" {
-			a.Replacement = "und"
-		}
-		// TODO: support mapping to tags
-		repl := strings.SplitN(a.Replacement, "_", 2)[0]
-		if a.Reason == "overlong" {
-			if len(a.Replacement) == 2 && len(a.Type) == 3 {
-				lang.updateLater(a.Replacement, a.Type)
-			}
-		} else if len(a.Type) <= 3 {
-			switch a.Reason {
-			case "macrolanguage":
-				aliasTypeMap[a.Type] = langMacro
-			case "deprecated":
-				// handled elsewhere
-				continue
-			case "bibliographic", "legacy":
-				if a.Type == "no" {
-					continue
-				}
-				aliasTypeMap[a.Type] = langLegacy
-			default:
-				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
-			}
-			langAliasMap.add(a.Type)
-			langAliasMap.updateLater(a.Type, repl)
-		}
-	}
-	// Manually add the mapping of "nb" (Norwegian) to its macro language.
-	// This can be removed if CLDR adopts this change.
-	langAliasMap.add("nb")
-	langAliasMap.updateLater("nb", "no")
-	aliasTypeMap["nb"] = langMacro
-
-	for k, v := range b.registry {
-		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
-		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
-			langAliasMap.add(k)
-			langAliasMap.updateLater(k, v.preferred)
-			aliasTypeMap[k] = langDeprecated
-		}
-	}
-	// Fix CLDR mappings.
-	lang.updateLater("tl", "tgl")
-	lang.updateLater("sh", "hbs")
-	lang.updateLater("mo", "mol")
-	lang.updateLater("no", "nor")
-	lang.updateLater("tw", "twi")
-	lang.updateLater("nb", "nob")
-	lang.updateLater("ak", "aka")
-	lang.updateLater("bh", "bih")
-
-	// Ensure that each 2-letter code is matched with a 3-letter code.
-	for _, v := range lang.s[1:] {
-		s, ok := lang.update[v]
-		if !ok {
-			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
-				continue
-			}
-			lang.update[v] = s
-		}
-		if v[0] != s[0] {
-			altLangISO3.add(s)
-			altLangISO3.updateLater(s, v)
-		}
-	}
-
-	// Complete canonicalized language tags.
-	lang.freeze()
-	for i, v := range lang.s {
-		// We can avoid these manual entries by using the IANA registry directly.
-		// Seems easier to update the list manually, as changes are rare.
-		// The panic in this loop will trigger if we miss an entry.
-		add := ""
-		if s, ok := lang.update[v]; ok {
-			if s[0] == v[0] {
-				add = s[1:]
-			} else {
-				add = string([]byte{0, byte(altLangISO3.index(s))})
-			}
-		} else if len(v) == 3 {
-			add = "\x00"
-		} else {
-			log.Panicf("no data for long form of %q", v)
-		}
-		lang.s[i] += add
-	}
-	b.writeConst("lang", tag.Index(lang.join()))
-
-	b.writeConst("langNoIndexOffset", len(b.lang.s))
-
-	// space of all valid 3-letter language identifiers.
-	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
-
-	altLangIndex := []uint16{}
-	for i, s := range altLangISO3.slice() {
-		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
-		if i > 0 {
-			idx := b.lang.index(altLangISO3.update[s])
-			altLangIndex = append(altLangIndex, uint16(idx))
-		}
-	}
-	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
-	b.writeSlice("altLangIndex", altLangIndex)
-
-	b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex)
-	types := make([]langAliasType, len(langAliasMap.s))
-	for i, s := range langAliasMap.s {
-		types[i] = aliasTypeMap[s]
-	}
-	b.writeSlice("langAliasTypes", types)
+	"de", "en", "fr", "it", "mo", "no", "nb", "pt", "sh", "mul", "und",
 }
 
 var scriptConsts = []string{
@@ -857,508 +102,15 @@ var scriptConsts = []string{
 	"Zzzz",
 }
 
-func (b *builder) writeScript() {
-	b.writeConsts(b.script.index, scriptConsts...)
-	b.writeConst("script", tag.Index(b.script.join()))
-
-	supp := make([]uint8, len(b.lang.slice()))
-	for i, v := range b.lang.slice()[1:] {
-		if sc := b.registry[v].suppressScript; sc != "" {
-			supp[i+1] = uint8(b.script.index(sc))
-		}
-	}
-	b.writeSlice("suppressScript", supp)
-
-	// There is only one deprecated script in CLDR. This value is hard-coded.
-	// We check here if the code must be updated.
-	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
-		if a.Type != "Qaai" {
-			log.Panicf("unexpected deprecated stript %q", a.Type)
-		}
-	}
-}
-
-func parseM49(s string) int16 {
-	if len(s) == 0 {
-		return 0
-	}
-	v, err := strconv.ParseUint(s, 10, 10)
-	failOnError(err)
-	return int16(v)
-}
-
 var regionConsts = []string{
 	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
 	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
 }
 
-func (b *builder) writeRegion() {
-	b.writeConsts(b.region.index, regionConsts...)
-
-	isoOffset := b.region.index("AA")
-	m49map := make([]int16, len(b.region.slice()))
-	fromM49map := make(map[int16]int)
-	altRegionISO3 := ""
-	altRegionIDs := []uint16{}
-
-	b.writeConst("isoRegionOffset", isoOffset)
-
-	// 2-letter region lookup and mapping to numeric codes.
-	regionISO := b.region.clone()
-	regionISO.s = regionISO.s[isoOffset:]
-	regionISO.sorted = false
-
-	regionTypes := make([]byte, len(b.region.s))
-
-	// Is the region valid BCP 47?
-	for s, e := range b.registry {
-		if len(s) == 2 && s == strings.ToUpper(s) {
-			i := b.region.index(s)
-			for _, d := range e.description {
-				if strings.Contains(d, "Private use") {
-					regionTypes[i] = iso3166UserAssigned
-				}
-			}
-			regionTypes[i] |= bcp47Region
-		}
-	}
-
-	// Is the region a valid ccTLD?
-	r := gen.OpenIANAFile("domains/root/db")
-	defer r.Close()
-
-	buf, err := ioutil.ReadAll(r)
-	failOnError(err)
-	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
-	for _, m := range re.FindAllSubmatch(buf, -1) {
-		i := b.region.index(strings.ToUpper(string(m[1])))
-		regionTypes[i] |= ccTLD
-	}
-
-	b.writeSlice("regionTypes", regionTypes)
-
-	iso3Set := make(map[string]int)
-	update := func(iso2, iso3 string) {
-		i := regionISO.index(iso2)
-		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
-			regionISO.s[i] += iso3[1:]
-			iso3Set[iso3] = -1
-		} else {
-			if ok && j >= 0 {
-				regionISO.s[i] += string([]byte{0, byte(j)})
-			} else {
-				iso3Set[iso3] = len(altRegionISO3)
-				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
-				altRegionISO3 += iso3
-				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		i := regionISO.index(tc.Type) + isoOffset
-		if d := m49map[i]; d != 0 {
-			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
-		}
-		m49 := parseM49(tc.Numeric)
-		m49map[i] = m49
-		if r := fromM49map[m49]; r == 0 {
-			fromM49map[m49] = i
-		} else if r != i {
-			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
-			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
-				fromM49map[m49] = i
-			}
-		}
-	}
-	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
-			from := parseM49(ta.Type)
-			if r := fromM49map[from]; r == 0 {
-				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		if len(tc.Alpha3) == 3 {
-			update(tc.Type, tc.Alpha3)
-		}
-	}
-	// This entries are not included in territoryCodes. Mostly 3-letter variants
-	// of deleted codes and an entry for QU.
-	for _, m := range []struct{ iso2, iso3 string }{
-		{"CT", "CTE"},
-		{"DY", "DHY"},
-		{"HV", "HVO"},
-		{"JT", "JTN"},
-		{"MI", "MID"},
-		{"NH", "NHB"},
-		{"NQ", "ATN"},
-		{"PC", "PCI"},
-		{"PU", "PUS"},
-		{"PZ", "PCZ"},
-		{"RH", "RHO"},
-		{"VD", "VDR"},
-		{"WK", "WAK"},
-		// These three-letter codes are used for others as well.
-		{"FQ", "ATF"},
-	} {
-		update(m.iso2, m.iso3)
-	}
-	for i, s := range regionISO.s {
-		if len(s) != 4 {
-			regionISO.s[i] = s + "  "
-		}
-	}
-	b.writeConst("regionISO", tag.Index(regionISO.join()))
-	b.writeConst("altRegionISO3", altRegionISO3)
-	b.writeSlice("altRegionIDs", altRegionIDs)
-
-	// Create list of deprecated regions.
-	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
-	// Transitionally-reserved mapping not included.
-	regionOldMap := stringSet{}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
-			regionOldMap.add(reg.Type)
-			regionOldMap.updateLater(reg.Type, reg.Replacement)
-			i, _ := regionISO.find(reg.Type)
-			j, _ := regionISO.find(reg.Replacement)
-			if k := m49map[i+isoOffset]; k == 0 {
-				m49map[i+isoOffset] = m49map[j+isoOffset]
-			}
-		}
-	}
-	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
-		return uint16(b.region.index(s))
-	})
-	// 3-digit region lookup, groupings.
-	for i := 1; i < isoOffset; i++ {
-		m := parseM49(b.region.s[i])
-		m49map[i] = m
-		fromM49map[m] = i
-	}
-	b.writeSlice("m49", m49map)
-
-	const (
-		searchBits = 7
-		regionBits = 9
-	)
-	if len(m49map) >= 1<<regionBits {
-		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
-	}
-	m49Index := [9]int16{}
-	fromM49 := []uint16{}
-	m49 := []int{}
-	for k, _ := range fromM49map {
-		m49 = append(m49, int(k))
-	}
-	sort.Ints(m49)
-	for _, k := range m49[1:] {
-		val := (k & (1<<searchBits - 1)) << regionBits
-		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
-		m49Index[1:][k>>searchBits] = int16(len(fromM49))
-	}
-	b.writeSlice("m49Index", m49Index)
-	b.writeSlice("fromM49", fromM49)
-}
-
-const (
-	// TODO: put these lists in regionTypes as user data? Could be used for
-	// various optimizations and refinements and could be exposed in the API.
-	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
-	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
-	// DY and RH are actually not deleted, but indeterminately reserved.
-	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
-)
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func find(list []string, s string) int {
-	for i, t := range list {
-		if t == s {
-			return i
-		}
-	}
-	return -1
-}
-
-// writeVariants generates per-variant information and creates a map from variant
-// name to index value. We assign index values such that sorting multiple
-// variants by index value will result in the correct order.
-// There are two types of variants: specialized and general. Specialized variants
-// are only applicable to certain language or language-script pairs. Generalized
-// variants apply to any language. Generalized variants always sort after
-// specialized variants.  We will therefore always assign a higher index value
-// to a generalized variant than any other variant. Generalized variants are
-// sorted alphabetically among themselves.
-// Specialized variants may also sort after other specialized variants. Such
-// variants will be ordered after any of the variants they may follow.
-// We assume that if a variant x is followed by a variant y, then for any prefix
-// p of x, p-x is a prefix of y. This allows us to order tags based on the
-// maximum of the length of any of its prefixes.
-// TODO: it is possible to define a set of Prefix values on variants such that
-// a total order cannot be defined to the point that this algorithm breaks.
-// In other words, we cannot guarantee the same order of variants for the
-// future using the same algorithm or for non-compliant combinations of
-// variants. For this reason, consider using simple alphabetic sorting
-// of variants and ignore Prefix restrictions altogether.
-func (b *builder) writeVariant() {
-	generalized := stringSet{}
-	specialized := stringSet{}
-	specializedExtend := stringSet{}
-	// Collate the variants by type and check assumptions.
-	for _, v := range b.variant.slice() {
-		e := b.registry[v]
-		if len(e.prefix) == 0 {
-			generalized.add(v)
-			continue
-		}
-		c := strings.Split(e.prefix[0], "-")
-		hasScriptOrRegion := false
-		if len(c) > 1 {
-			_, hasScriptOrRegion = b.script.find(c[1])
-			if !hasScriptOrRegion {
-				_, hasScriptOrRegion = b.region.find(c[1])
-
-			}
-		}
-		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
-			// Variant is preceded by a language.
-			specialized.add(v)
-			continue
-		}
-		// Variant is preceded by another variant.
-		specializedExtend.add(v)
-		prefix := c[0] + "-"
-		if hasScriptOrRegion {
-			prefix += c[1]
-		}
-		for _, p := range e.prefix {
-			// Verify that the prefix minus the last element is a prefix of the
-			// predecessor element.
-			i := strings.LastIndex(p, "-")
-			pred := b.registry[p[i+1:]]
-			if find(pred.prefix, p[:i]) < 0 {
-				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
-			}
-			// The sorting used below does not work in the general case. It works
-			// if we assume that variants that may be followed by others only have
-			// prefixes of the same length. Verify this.
-			count := strings.Count(p[:i], "-")
-			for _, q := range pred.prefix {
-				if c := strings.Count(q, "-"); c != count {
-					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
-				}
-			}
-			if !strings.HasPrefix(p, prefix) {
-				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
-			}
-		}
-	}
-
-	// Sort extended variants.
-	a := specializedExtend.s
-	less := func(v, w string) bool {
-		// Sort by the maximum number of elements.
-		maxCount := func(s string) (max int) {
-			for _, p := range b.registry[s].prefix {
-				if c := strings.Count(p, "-"); c > max {
-					max = c
-				}
-			}
-			return
-		}
-		if cv, cw := maxCount(v), maxCount(w); cv != cw {
-			return cv < cw
-		}
-		// Sort by name as tie breaker.
-		return v < w
-	}
-	sort.Sort(funcSorter{less, sort.StringSlice(a)})
-	specializedExtend.frozen = true
-
-	// Create index from variant name to index.
-	variantIndex := make(map[string]uint8)
-	add := func(s []string) {
-		for _, v := range s {
-			variantIndex[v] = uint8(len(variantIndex))
-		}
-	}
-	add(specialized.slice())
-	add(specializedExtend.s)
-	numSpecialized := len(variantIndex)
-	add(generalized.slice())
-	if n := len(variantIndex); n > 255 {
-		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
-	}
-	b.writeMap("variantIndex", variantIndex)
-	b.writeConst("variantNumSpecialized", numSpecialized)
-}
-
-func (b *builder) writeLanguageInfo() {
-}
-
-// writeLikelyData writes tables that are used both for finding parent relations and for
-// language matching.  Each entry contains additional bits to indicate the status of the
-// data to know when it cannot be used for parent relations.
-func (b *builder) writeLikelyData() {
-	const (
-		isList = 1 << iota
-		scriptInFrom
-		regionInFrom
-	)
-	type ( // generated types
-		likelyScriptRegion struct {
-			region uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangScript struct {
-			lang   uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangRegion struct {
-			lang   uint16
-			region uint16
-		}
-		// likelyTag is used for getting likely tags for group regions, where
-		// the likely region might be a region contained in the group.
-		likelyTag struct {
-			lang   uint16
-			region uint16
-			script uint8
-		}
-	)
-	var ( // generated variables
-		likelyRegionGroup = make([]likelyTag, len(b.groups))
-		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
-		likelyRegion      = make([]likelyLangScript, len(b.region.s))
-		likelyScript      = make([]likelyLangRegion, len(b.script.s))
-		likelyLangList    = []likelyScriptRegion{}
-		likelyRegionList  = []likelyLangScript{}
-	)
-	type fromTo struct {
-		from, to []string
-	}
-	langToOther := map[int][]fromTo{}
-	regionToOther := map[int][]fromTo{}
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		to := strings.Split(m.To, "_")
-		if len(to) != 3 {
-			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
-		}
-		if len(from) > 3 {
-			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
-		}
-		if from[0] != to[0] && from[0] != "und" {
-			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
-		}
-		if len(from) == 3 {
-			if from[2] != to[2] {
-				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
-			}
-			if from[0] != "und" {
-				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
-			}
-		}
-		if len(from) == 1 || from[0] != "und" {
-			id := 0
-			if from[0] != "und" {
-				id = b.lang.index(from[0])
-			}
-			langToOther[id] = append(langToOther[id], fromTo{from, to})
-		} else if len(from) == 2 && len(from[1]) == 4 {
-			sid := b.script.index(from[1])
-			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
-			likelyScript[sid].region = uint16(b.region.index(to[2]))
-		} else {
-			r := b.region.index(from[len(from)-1])
-			if id, ok := b.groups[r]; ok {
-				if from[0] != "und" {
-					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
-				}
-				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
-				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
-				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
-			} else {
-				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
-			}
-		}
-	}
-	b.writeType(likelyLangRegion{})
-	b.writeSlice("likelyScript", likelyScript)
-
-	for id := range b.lang.s {
-		list := langToOther[id]
-		if len(list) == 1 {
-			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
-			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
-		} else if len(list) > 1 {
-			likelyLang[id].flags = isList
-			likelyLang[id].region = uint16(len(likelyLangList))
-			likelyLang[id].script = uint8(len(list))
-			for _, x := range list {
-				flags := uint8(0)
-				if len(x.from) > 1 {
-					if x.from[1] == x.to[2] {
-						flags = regionInFrom
-					} else {
-						flags = scriptInFrom
-					}
-				}
-				likelyLangList = append(likelyLangList, likelyScriptRegion{
-					region: uint16(b.region.index(x.to[2])),
-					script: uint8(b.script.index(x.to[1])),
-					flags:  flags,
-				})
-			}
-		}
-	}
-	// TODO: merge suppressScript data with this table.
-	b.writeType(likelyScriptRegion{})
-	b.writeSlice("likelyLang", likelyLang)
-	b.writeSlice("likelyLangList", likelyLangList)
-
-	for id := range b.region.s {
-		list := regionToOther[id]
-		if len(list) == 1 {
-			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
-			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
-			if len(list[0].from) > 2 {
-				likelyRegion[id].flags = scriptInFrom
-			}
-		} else if len(list) > 1 {
-			likelyRegion[id].flags = isList
-			likelyRegion[id].lang = uint16(len(likelyRegionList))
-			likelyRegion[id].script = uint8(len(list))
-			for i, x := range list {
-				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
-					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
-				}
-				x := likelyLangScript{
-					lang:   uint16(b.langIndex(x.to[0])),
-					script: uint8(b.script.index(x.to[1])),
-				}
-				if len(list[0].from) > 2 {
-					x.flags = scriptInFrom
-				}
-				likelyRegionList = append(likelyRegionList, x)
-			}
-		}
-	}
-	b.writeType(likelyLangScript{})
-	b.writeSlice("likelyRegion", likelyRegion)
-	b.writeSlice("likelyRegionList", likelyRegionList)
-
-	b.writeType(likelyTag{})
-	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
+func (b *builder) writeConstants() {
+	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
+	b.writeConsts(b.regionIndex, regionConsts...)
+	b.writeConsts(b.scriptIndex, scriptConsts...)
 }
 
 type mutualIntelligibility struct {
@@ -1397,7 +149,7 @@ func (b *builder) writeMatchData() {
 		regions := strings.Split(g.Contains, " ")
 		regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...)
 	}
-	regionToGroups := make([]uint8, len(b.region.s))
+	regionToGroups := make([]uint8, language.NumRegions)
 
 	idToIndex := map[string]uint8{}
 	for i, mv := range lm[0].MatchVariable {
@@ -1410,12 +162,12 @@ func (b *builder) writeMatchData() {
 			todo := []string{r}
 			for k := 0; k < len(todo); k++ {
 				r := todo[k]
-				regionToGroups[b.region.index(r)] |= 1 << uint8(i)
+				regionToGroups[b.regionIndex(r)] |= 1 << uint8(i)
 				todo = append(todo, regionHierarchy[r]...)
 			}
 		}
 	}
-	b.writeSlice("regionToGroups", regionToGroups)
+	b.w.WriteVar("regionToGroups", regionToGroups)
 
 	// maps language id to in- and out-of-group region.
 	paradigmLocales := [][3]uint16{}
@@ -1426,16 +178,16 @@ func (b *builder) writeMatchData() {
 			pc := strings.SplitN(locales[i+j], "-", 2)
 			x[0] = b.langIndex(pc[0])
 			if len(pc) == 2 {
-				x[1+j] = uint16(b.region.index(pc[1]))
+				x[1+j] = uint16(b.regionIndex(pc[1]))
 			}
 		}
 		paradigmLocales = append(paradigmLocales, x)
 	}
-	b.writeSlice("paradigmLocales", paradigmLocales)
+	b.w.WriteVar("paradigmLocales", paradigmLocales)
 
-	b.writeType(mutualIntelligibility{})
-	b.writeType(scriptIntelligibility{})
-	b.writeType(regionIntelligibility{})
+	b.w.WriteType(mutualIntelligibility{})
+	b.w.WriteType(scriptIntelligibility{})
+	b.w.WriteType(regionIntelligibility{})
 
 	matchLang := []mutualIntelligibility{}
 	matchScript := []scriptIntelligibility{}
@@ -1461,16 +213,16 @@ func (b *builder) writeMatchData() {
 			matchScript = append(matchScript, scriptIntelligibility{
 				wantLang:   uint16(b.langIndex(d[0])),
 				haveLang:   uint16(b.langIndex(s[0])),
-				wantScript: uint8(b.script.index(d[1])),
-				haveScript: uint8(b.script.index(s[1])),
+				wantScript: uint8(b.scriptIndex(d[1])),
+				haveScript: uint8(b.scriptIndex(s[1])),
 				distance:   uint8(distance),
 			})
 			if m.Oneway != "true" {
 				matchScript = append(matchScript, scriptIntelligibility{
 					wantLang:   uint16(b.langIndex(s[0])),
 					haveLang:   uint16(b.langIndex(d[0])),
-					wantScript: uint8(b.script.index(s[1])),
-					haveScript: uint8(b.script.index(d[1])),
+					wantScript: uint8(b.scriptIndex(s[1])),
+					haveScript: uint8(b.scriptIndex(d[1])),
 					distance:   uint8(distance),
 				})
 			}
@@ -1512,7 +264,7 @@ func (b *builder) writeMatchData() {
 				distance: uint8(distance),
 			}
 			if d[1] != "*" {
-				ri.script = uint8(b.script.index(d[1]))
+				ri.script = uint8(b.scriptIndex(d[1]))
 			}
 			switch {
 			case d[2] == "*":
@@ -1532,181 +284,22 @@ func (b *builder) writeMatchData() {
 	sort.SliceStable(matchLang, func(i, j int) bool {
 		return matchLang[i].distance < matchLang[j].distance
 	})
-	b.writeSlice("matchLang", matchLang)
-
+	b.w.WriteComment(`
+		matchLang holds pairs of langIDs of base languages that are typically
+		mutually intelligible. Each pair is associated with a confidence and
+		whether the intelligibility goes one or both ways.`)
+	b.w.WriteVar("matchLang", matchLang)
+
+	b.w.WriteComment(`
+		matchScript holds pairs of scriptIDs where readers of one script
+		can typically also read the other. Each is associated with a confidence.`)
 	sort.SliceStable(matchScript, func(i, j int) bool {
 		return matchScript[i].distance < matchScript[j].distance
 	})
-	b.writeSlice("matchScript", matchScript)
+	b.w.WriteVar("matchScript", matchScript)
 
 	sort.SliceStable(matchRegion, func(i, j int) bool {
 		return matchRegion[i].distance < matchRegion[j].distance
 	})
-	b.writeSlice("matchRegion", matchRegion)
-}
-
-func (b *builder) writeRegionInclusionData() {
-	var (
-		// mm holds for each group the set of groups with a distance of 1.
-		mm = make(map[int][]index)
-
-		// containment holds for each group the transitive closure of
-		// containment of other groups.
-		containment = make(map[index][]index)
-	)
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		groupIdx := b.groups[group]
-		for _, mem := range strings.Split(g.Contains, " ") {
-			r := b.region.index(mem)
-			mm[r] = append(mm[r], groupIdx)
-			if g, ok := b.groups[r]; ok {
-				mm[group] = append(mm[group], g)
-				containment[groupIdx] = append(containment[groupIdx], g)
-			}
-		}
-	}
-
-	regionContainment := make([]uint64, len(b.groups))
-	for _, g := range b.groups {
-		l := containment[g]
-
-		// Compute the transitive closure of containment.
-		for i := 0; i < len(l); i++ {
-			l = append(l, containment[l[i]]...)
-		}
-
-		// Compute the bitmask.
-		regionContainment[g] = 1 << g
-		for _, v := range l {
-			regionContainment[g] |= 1 << v
-		}
-	}
-	b.writeSlice("regionContainment", regionContainment)
-
-	regionInclusion := make([]uint8, len(b.region.s))
-	bvs := make(map[uint64]index)
-	// Make the first bitvector positions correspond with the groups.
-	for r, i := range b.groups {
-		bv := uint64(1 << i)
-		for _, g := range mm[r] {
-			bv |= 1 << g
-		}
-		bvs[bv] = i
-		regionInclusion[r] = uint8(bvs[bv])
-	}
-	for r := 1; r < len(b.region.s); r++ {
-		if _, ok := b.groups[r]; !ok {
-			bv := uint64(0)
-			for _, g := range mm[r] {
-				bv |= 1 << g
-			}
-			if bv == 0 {
-				// Pick the world for unspecified regions.
-				bv = 1 << b.groups[b.region.index("001")]
-			}
-			if _, ok := bvs[bv]; !ok {
-				bvs[bv] = index(len(bvs))
-			}
-			regionInclusion[r] = uint8(bvs[bv])
-		}
-	}
-	b.writeSlice("regionInclusion", regionInclusion)
-	regionInclusionBits := make([]uint64, len(bvs))
-	for k, v := range bvs {
-		regionInclusionBits[v] = uint64(k)
-	}
-	// Add bit vectors for increasingly large distances until a fixed point is reached.
-	regionInclusionNext := []uint8{}
-	for i := 0; i < len(regionInclusionBits); i++ {
-		bits := regionInclusionBits[i]
-		next := bits
-		for i := uint(0); i < uint(len(b.groups)); i++ {
-			if bits&(1<<i) != 0 {
-				next |= regionInclusionBits[i]
-			}
-		}
-		if _, ok := bvs[next]; !ok {
-			bvs[next] = index(len(bvs))
-			regionInclusionBits = append(regionInclusionBits, next)
-		}
-		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
-	}
-	b.writeSlice("regionInclusionBits", regionInclusionBits)
-	b.writeSlice("regionInclusionNext", regionInclusionNext)
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-func (b *builder) writeParents() {
-	b.writeType(parentRel{})
-
-	parents := []parentRel{}
-
-	// Construct parent overrides.
-	n := 0
-	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
-		// Skipping non-standard scripts to root is implemented using addTags.
-		if p.Parent == "root" {
-			continue
-		}
-
-		sub := strings.Split(p.Parent, "_")
-		parent := parentRel{lang: b.langIndex(sub[0])}
-		if len(sub) == 2 {
-			// TODO: check that all undefined scripts are indeed Latn in these
-			// cases.
-			parent.maxScript = uint8(b.script.index("Latn"))
-			parent.toRegion = uint16(b.region.index(sub[1]))
-		} else {
-			parent.script = uint8(b.script.index(sub[1]))
-			parent.maxScript = parent.script
-			parent.toRegion = uint16(b.region.index(sub[2]))
-		}
-		for _, c := range strings.Split(p.Locales, " ") {
-			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
-			parent.fromRegion = append(parent.fromRegion, uint16(region))
-		}
-		parents = append(parents, parent)
-		n += len(parent.fromRegion)
-	}
-	b.writeSliceAddSize("parents", n*2, parents)
-}
-
-func main() {
-	gen.Init()
-
-	gen.Repackage("gen_common.go", "common.go", "language")
-
-	w := gen.NewCodeWriter()
-	defer w.WriteGoFile("tables.go", "language")
-
-	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
-
-	b := newBuilder(w)
-	gen.WriteCLDRVersion(w)
-
-	b.parseIndices()
-	b.writeType(fromTo{})
-	b.writeLanguage()
-	b.writeScript()
-	b.writeRegion()
-	b.writeVariant()
-	// TODO: b.writeLocale()
-	b.computeRegionGroups()
-	b.writeLikelyData()
-	b.writeMatchData()
-	b.writeRegionInclusionData()
-	b.writeParents()
+	b.w.WriteVar("matchRegion", matchRegion)
 }
diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go
deleted file mode 100644
index 5ca9bcc..0000000
--- a/vendor/golang.org/x/text/language/gen_index.go
+++ /dev/null
@@ -1,162 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This file generates derivative tables based on the language package itself.
-
-import (
-	"bytes"
-	"flag"
-	"fmt"
-	"io/ioutil"
-	"log"
-	"reflect"
-	"sort"
-	"strings"
-
-	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/language"
-	"golang.org/x/text/unicode/cldr"
-)
-
-var (
-	test = flag.Bool("test", false,
-		"test existing tables; can be used to compare web data with package data.")
-
-	draft = flag.String("draft",
-		"contributed",
-		`Minimal draft requirements (approved, contributed, provisional, unconfirmed).`)
-)
-
-func main() {
-	gen.Init()
-
-	// Read the CLDR zip file.
-	r := gen.OpenCLDRCoreZip()
-	defer r.Close()
-
-	d := &cldr.Decoder{}
-	data, err := d.DecodeZip(r)
-	if err != nil {
-		log.Fatalf("DecodeZip: %v", err)
-	}
-
-	w := gen.NewCodeWriter()
-	defer func() {
-		buf := &bytes.Buffer{}
-
-		if _, err = w.WriteGo(buf, "language", ""); err != nil {
-			log.Fatalf("Error formatting file index.go: %v", err)
-		}
-
-		// Since we're generating a table for our own package we need to rewrite
-		// doing the equivalent of go fmt -r 'language.b -> b'. Using
-		// bytes.Replace will do.
-		out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1)
-		if err := ioutil.WriteFile("index.go", out, 0600); err != nil {
-			log.Fatalf("Could not create file index.go: %v", err)
-		}
-	}()
-
-	m := map[language.Tag]bool{}
-	for _, lang := range data.Locales() {
-		// We include all locales unconditionally to be consistent with en_US.
-		// We want en_US, even though it has no data associated with it.
-
-		// TODO: put any of the languages for which no data exists at the end
-		// of the index. This allows all components based on ICU to use that
-		// as the cutoff point.
-		// if x := data.RawLDML(lang); false ||
-		// 	x.LocaleDisplayNames != nil ||
-		// 	x.Characters != nil ||
-		// 	x.Delimiters != nil ||
-		// 	x.Measurement != nil ||
-		// 	x.Dates != nil ||
-		// 	x.Numbers != nil ||
-		// 	x.Units != nil ||
-		// 	x.ListPatterns != nil ||
-		// 	x.Collations != nil ||
-		// 	x.Segmentations != nil ||
-		// 	x.Rbnf != nil ||
-		// 	x.Annotations != nil ||
-		// 	x.Metadata != nil {
-
-		// TODO: support POSIX natively, albeit non-standard.
-		tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
-		m[tag] = true
-		// }
-	}
-	// Include locales for plural rules, which uses a different structure.
-	for _, plurals := range data.Supplemental().Plurals {
-		for _, rules := range plurals.PluralRules {
-			for _, lang := range strings.Split(rules.Locales, " ") {
-				m[language.Make(lang)] = true
-			}
-		}
-	}
-
-	var core, special []language.Tag
-
-	for t := range m {
-		if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
-			log.Fatalf("Unexpected extension %v in %v", x, t)
-		}
-		if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
-			core = append(core, t)
-		} else {
-			special = append(special, t)
-		}
-	}
-
-	w.WriteComment(`
-	NumCompactTags is the number of common tags. The maximum tag is
-	NumCompactTags-1.`)
-	w.WriteConst("NumCompactTags", len(core)+len(special))
-
-	sort.Sort(byAlpha(special))
-	w.WriteVar("specialTags", special)
-
-	// TODO: order by frequency?
-	sort.Sort(byAlpha(core))
-
-	// Size computations are just an estimate.
-	w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size())
-	w.Size += len(core) * 6 // size of uint32 and uint16
-
-	fmt.Fprintln(w)
-	fmt.Fprintln(w, "var coreTags = map[uint32]uint16{")
-	fmt.Fprintln(w, "0x0: 0, // und")
-	i := len(special) + 1 // Und and special tags already written.
-	for _, t := range core {
-		if t == language.Und {
-			continue
-		}
-		fmt.Fprint(w.Hash, t, i)
-		b, s, r := t.Raw()
-		fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n",
-			getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number
-			getIndex(s, 2),
-			getIndex(r, 3),
-			i, t)
-		i++
-	}
-	fmt.Fprintln(w, "}")
-}
-
-// getIndex prints the subtag type and extracts its index of size nibble.
-// If the index is less than n nibbles, the result is prefixed with 0s.
-func getIndex(x interface{}, n int) string {
-	s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00}
-	s = s[strings.Index(s, "0x")+2 : len(s)-1]
-	return strings.Repeat("0", n-len(s)) + s
-}
-
-type byAlpha []language.Tag
-
-func (a byAlpha) Len() int           { return len(a) }
-func (a byAlpha) Swap(i, j int)      { a[i], a[j] = a[j], a[i] }
-func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() }
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
deleted file mode 100644
index 5311e5c..0000000
--- a/vendor/golang.org/x/text/language/index.go
+++ /dev/null
@@ -1,783 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 768
-
-var specialTags = []Tag{ // 2 elements
-	0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
-	1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
-} // Size: 72 bytes
-
-var coreTags = map[uint32]uint16{
-	0x0:        0,   // und
-	0x01600000: 3,   // af
-	0x016000d2: 4,   // af-NA
-	0x01600161: 5,   // af-ZA
-	0x01c00000: 6,   // agq
-	0x01c00052: 7,   // agq-CM
-	0x02100000: 8,   // ak
-	0x02100080: 9,   // ak-GH
-	0x02700000: 10,  // am
-	0x0270006f: 11,  // am-ET
-	0x03a00000: 12,  // ar
-	0x03a00001: 13,  // ar-001
-	0x03a00023: 14,  // ar-AE
-	0x03a00039: 15,  // ar-BH
-	0x03a00062: 16,  // ar-DJ
-	0x03a00067: 17,  // ar-DZ
-	0x03a0006b: 18,  // ar-EG
-	0x03a0006c: 19,  // ar-EH
-	0x03a0006d: 20,  // ar-ER
-	0x03a00097: 21,  // ar-IL
-	0x03a0009b: 22,  // ar-IQ
-	0x03a000a1: 23,  // ar-JO
-	0x03a000a8: 24,  // ar-KM
-	0x03a000ac: 25,  // ar-KW
-	0x03a000b0: 26,  // ar-LB
-	0x03a000b9: 27,  // ar-LY
-	0x03a000ba: 28,  // ar-MA
-	0x03a000c9: 29,  // ar-MR
-	0x03a000e1: 30,  // ar-OM
-	0x03a000ed: 31,  // ar-PS
-	0x03a000f3: 32,  // ar-QA
-	0x03a00108: 33,  // ar-SA
-	0x03a0010b: 34,  // ar-SD
-	0x03a00115: 35,  // ar-SO
-	0x03a00117: 36,  // ar-SS
-	0x03a0011c: 37,  // ar-SY
-	0x03a00120: 38,  // ar-TD
-	0x03a00128: 39,  // ar-TN
-	0x03a0015e: 40,  // ar-YE
-	0x04000000: 41,  // ars
-	0x04300000: 42,  // as
-	0x04300099: 43,  // as-IN
-	0x04400000: 44,  // asa
-	0x0440012f: 45,  // asa-TZ
-	0x04800000: 46,  // ast
-	0x0480006e: 47,  // ast-ES
-	0x05800000: 48,  // az
-	0x0581f000: 49,  // az-Cyrl
-	0x0581f032: 50,  // az-Cyrl-AZ
-	0x05857000: 51,  // az-Latn
-	0x05857032: 52,  // az-Latn-AZ
-	0x05e00000: 53,  // bas
-	0x05e00052: 54,  // bas-CM
-	0x07100000: 55,  // be
-	0x07100047: 56,  // be-BY
-	0x07500000: 57,  // bem
-	0x07500162: 58,  // bem-ZM
-	0x07900000: 59,  // bez
-	0x0790012f: 60,  // bez-TZ
-	0x07e00000: 61,  // bg
-	0x07e00038: 62,  // bg-BG
-	0x08200000: 63,  // bh
-	0x0a000000: 64,  // bm
-	0x0a0000c3: 65,  // bm-ML
-	0x0a500000: 66,  // bn
-	0x0a500035: 67,  // bn-BD
-	0x0a500099: 68,  // bn-IN
-	0x0a900000: 69,  // bo
-	0x0a900053: 70,  // bo-CN
-	0x0a900099: 71,  // bo-IN
-	0x0b200000: 72,  // br
-	0x0b200078: 73,  // br-FR
-	0x0b500000: 74,  // brx
-	0x0b500099: 75,  // brx-IN
-	0x0b700000: 76,  // bs
-	0x0b71f000: 77,  // bs-Cyrl
-	0x0b71f033: 78,  // bs-Cyrl-BA
-	0x0b757000: 79,  // bs-Latn
-	0x0b757033: 80,  // bs-Latn-BA
-	0x0d700000: 81,  // ca
-	0x0d700022: 82,  // ca-AD
-	0x0d70006e: 83,  // ca-ES
-	0x0d700078: 84,  // ca-FR
-	0x0d70009e: 85,  // ca-IT
-	0x0db00000: 86,  // ccp
-	0x0db00035: 87,  // ccp-BD
-	0x0db00099: 88,  // ccp-IN
-	0x0dc00000: 89,  // ce
-	0x0dc00106: 90,  // ce-RU
-	0x0df00000: 91,  // cgg
-	0x0df00131: 92,  // cgg-UG
-	0x0e500000: 93,  // chr
-	0x0e500135: 94,  // chr-US
-	0x0e900000: 95,  // ckb
-	0x0e90009b: 96,  // ckb-IQ
-	0x0e90009c: 97,  // ckb-IR
-	0x0fa00000: 98,  // cs
-	0x0fa0005e: 99,  // cs-CZ
-	0x0fe00000: 100, // cu
-	0x0fe00106: 101, // cu-RU
-	0x10000000: 102, // cy
-	0x1000007b: 103, // cy-GB
-	0x10100000: 104, // da
-	0x10100063: 105, // da-DK
-	0x10100082: 106, // da-GL
-	0x10800000: 107, // dav
-	0x108000a4: 108, // dav-KE
-	0x10d00000: 109, // de
-	0x10d0002e: 110, // de-AT
-	0x10d00036: 111, // de-BE
-	0x10d0004e: 112, // de-CH
-	0x10d00060: 113, // de-DE
-	0x10d0009e: 114, // de-IT
-	0x10d000b2: 115, // de-LI
-	0x10d000b7: 116, // de-LU
-	0x11700000: 117, // dje
-	0x117000d4: 118, // dje-NE
-	0x11f00000: 119, // dsb
-	0x11f00060: 120, // dsb-DE
-	0x12400000: 121, // dua
-	0x12400052: 122, // dua-CM
-	0x12800000: 123, // dv
-	0x12b00000: 124, // dyo
-	0x12b00114: 125, // dyo-SN
-	0x12d00000: 126, // dz
-	0x12d00043: 127, // dz-BT
-	0x12f00000: 128, // ebu
-	0x12f000a4: 129, // ebu-KE
-	0x13000000: 130, // ee
-	0x13000080: 131, // ee-GH
-	0x13000122: 132, // ee-TG
-	0x13600000: 133, // el
-	0x1360005d: 134, // el-CY
-	0x13600087: 135, // el-GR
-	0x13900000: 136, // en
-	0x13900001: 137, // en-001
-	0x1390001a: 138, // en-150
-	0x13900025: 139, // en-AG
-	0x13900026: 140, // en-AI
-	0x1390002d: 141, // en-AS
-	0x1390002e: 142, // en-AT
-	0x1390002f: 143, // en-AU
-	0x13900034: 144, // en-BB
-	0x13900036: 145, // en-BE
-	0x1390003a: 146, // en-BI
-	0x1390003d: 147, // en-BM
-	0x13900042: 148, // en-BS
-	0x13900046: 149, // en-BW
-	0x13900048: 150, // en-BZ
-	0x13900049: 151, // en-CA
-	0x1390004a: 152, // en-CC
-	0x1390004e: 153, // en-CH
-	0x13900050: 154, // en-CK
-	0x13900052: 155, // en-CM
-	0x1390005c: 156, // en-CX
-	0x1390005d: 157, // en-CY
-	0x13900060: 158, // en-DE
-	0x13900061: 159, // en-DG
-	0x13900063: 160, // en-DK
-	0x13900064: 161, // en-DM
-	0x1390006d: 162, // en-ER
-	0x13900072: 163, // en-FI
-	0x13900073: 164, // en-FJ
-	0x13900074: 165, // en-FK
-	0x13900075: 166, // en-FM
-	0x1390007b: 167, // en-GB
-	0x1390007c: 168, // en-GD
-	0x1390007f: 169, // en-GG
-	0x13900080: 170, // en-GH
-	0x13900081: 171, // en-GI
-	0x13900083: 172, // en-GM
-	0x1390008a: 173, // en-GU
-	0x1390008c: 174, // en-GY
-	0x1390008d: 175, // en-HK
-	0x13900096: 176, // en-IE
-	0x13900097: 177, // en-IL
-	0x13900098: 178, // en-IM
-	0x13900099: 179, // en-IN
-	0x1390009a: 180, // en-IO
-	0x1390009f: 181, // en-JE
-	0x139000a0: 182, // en-JM
-	0x139000a4: 183, // en-KE
-	0x139000a7: 184, // en-KI
-	0x139000a9: 185, // en-KN
-	0x139000ad: 186, // en-KY
-	0x139000b1: 187, // en-LC
-	0x139000b4: 188, // en-LR
-	0x139000b5: 189, // en-LS
-	0x139000bf: 190, // en-MG
-	0x139000c0: 191, // en-MH
-	0x139000c6: 192, // en-MO
-	0x139000c7: 193, // en-MP
-	0x139000ca: 194, // en-MS
-	0x139000cb: 195, // en-MT
-	0x139000cc: 196, // en-MU
-	0x139000ce: 197, // en-MW
-	0x139000d0: 198, // en-MY
-	0x139000d2: 199, // en-NA
-	0x139000d5: 200, // en-NF
-	0x139000d6: 201, // en-NG
-	0x139000d9: 202, // en-NL
-	0x139000dd: 203, // en-NR
-	0x139000df: 204, // en-NU
-	0x139000e0: 205, // en-NZ
-	0x139000e6: 206, // en-PG
-	0x139000e7: 207, // en-PH
-	0x139000e8: 208, // en-PK
-	0x139000eb: 209, // en-PN
-	0x139000ec: 210, // en-PR
-	0x139000f0: 211, // en-PW
-	0x13900107: 212, // en-RW
-	0x13900109: 213, // en-SB
-	0x1390010a: 214, // en-SC
-	0x1390010b: 215, // en-SD
-	0x1390010c: 216, // en-SE
-	0x1390010d: 217, // en-SG
-	0x1390010e: 218, // en-SH
-	0x1390010f: 219, // en-SI
-	0x13900112: 220, // en-SL
-	0x13900117: 221, // en-SS
-	0x1390011b: 222, // en-SX
-	0x1390011d: 223, // en-SZ
-	0x1390011f: 224, // en-TC
-	0x13900125: 225, // en-TK
-	0x13900129: 226, // en-TO
-	0x1390012c: 227, // en-TT
-	0x1390012d: 228, // en-TV
-	0x1390012f: 229, // en-TZ
-	0x13900131: 230, // en-UG
-	0x13900133: 231, // en-UM
-	0x13900135: 232, // en-US
-	0x13900139: 233, // en-VC
-	0x1390013c: 234, // en-VG
-	0x1390013d: 235, // en-VI
-	0x1390013f: 236, // en-VU
-	0x13900142: 237, // en-WS
-	0x13900161: 238, // en-ZA
-	0x13900162: 239, // en-ZM
-	0x13900164: 240, // en-ZW
-	0x13c00000: 241, // eo
-	0x13c00001: 242, // eo-001
-	0x13e00000: 243, // es
-	0x13e0001f: 244, // es-419
-	0x13e0002c: 245, // es-AR
-	0x13e0003f: 246, // es-BO
-	0x13e00041: 247, // es-BR
-	0x13e00048: 248, // es-BZ
-	0x13e00051: 249, // es-CL
-	0x13e00054: 250, // es-CO
-	0x13e00056: 251, // es-CR
-	0x13e00059: 252, // es-CU
-	0x13e00065: 253, // es-DO
-	0x13e00068: 254, // es-EA
-	0x13e00069: 255, // es-EC
-	0x13e0006e: 256, // es-ES
-	0x13e00086: 257, // es-GQ
-	0x13e00089: 258, // es-GT
-	0x13e0008f: 259, // es-HN
-	0x13e00094: 260, // es-IC
-	0x13e000cf: 261, // es-MX
-	0x13e000d8: 262, // es-NI
-	0x13e000e2: 263, // es-PA
-	0x13e000e4: 264, // es-PE
-	0x13e000e7: 265, // es-PH
-	0x13e000ec: 266, // es-PR
-	0x13e000f1: 267, // es-PY
-	0x13e0011a: 268, // es-SV
-	0x13e00135: 269, // es-US
-	0x13e00136: 270, // es-UY
-	0x13e0013b: 271, // es-VE
-	0x14000000: 272, // et
-	0x1400006a: 273, // et-EE
-	0x14500000: 274, // eu
-	0x1450006e: 275, // eu-ES
-	0x14600000: 276, // ewo
-	0x14600052: 277, // ewo-CM
-	0x14800000: 278, // fa
-	0x14800024: 279, // fa-AF
-	0x1480009c: 280, // fa-IR
-	0x14e00000: 281, // ff
-	0x14e00052: 282, // ff-CM
-	0x14e00084: 283, // ff-GN
-	0x14e000c9: 284, // ff-MR
-	0x14e00114: 285, // ff-SN
-	0x15100000: 286, // fi
-	0x15100072: 287, // fi-FI
-	0x15300000: 288, // fil
-	0x153000e7: 289, // fil-PH
-	0x15800000: 290, // fo
-	0x15800063: 291, // fo-DK
-	0x15800076: 292, // fo-FO
-	0x15e00000: 293, // fr
-	0x15e00036: 294, // fr-BE
-	0x15e00037: 295, // fr-BF
-	0x15e0003a: 296, // fr-BI
-	0x15e0003b: 297, // fr-BJ
-	0x15e0003c: 298, // fr-BL
-	0x15e00049: 299, // fr-CA
-	0x15e0004b: 300, // fr-CD
-	0x15e0004c: 301, // fr-CF
-	0x15e0004d: 302, // fr-CG
-	0x15e0004e: 303, // fr-CH
-	0x15e0004f: 304, // fr-CI
-	0x15e00052: 305, // fr-CM
-	0x15e00062: 306, // fr-DJ
-	0x15e00067: 307, // fr-DZ
-	0x15e00078: 308, // fr-FR
-	0x15e0007a: 309, // fr-GA
-	0x15e0007e: 310, // fr-GF
-	0x15e00084: 311, // fr-GN
-	0x15e00085: 312, // fr-GP
-	0x15e00086: 313, // fr-GQ
-	0x15e00091: 314, // fr-HT
-	0x15e000a8: 315, // fr-KM
-	0x15e000b7: 316, // fr-LU
-	0x15e000ba: 317, // fr-MA
-	0x15e000bb: 318, // fr-MC
-	0x15e000be: 319, // fr-MF
-	0x15e000bf: 320, // fr-MG
-	0x15e000c3: 321, // fr-ML
-	0x15e000c8: 322, // fr-MQ
-	0x15e000c9: 323, // fr-MR
-	0x15e000cc: 324, // fr-MU
-	0x15e000d3: 325, // fr-NC
-	0x15e000d4: 326, // fr-NE
-	0x15e000e5: 327, // fr-PF
-	0x15e000ea: 328, // fr-PM
-	0x15e00102: 329, // fr-RE
-	0x15e00107: 330, // fr-RW
-	0x15e0010a: 331, // fr-SC
-	0x15e00114: 332, // fr-SN
-	0x15e0011c: 333, // fr-SY
-	0x15e00120: 334, // fr-TD
-	0x15e00122: 335, // fr-TG
-	0x15e00128: 336, // fr-TN
-	0x15e0013f: 337, // fr-VU
-	0x15e00140: 338, // fr-WF
-	0x15e0015f: 339, // fr-YT
-	0x16900000: 340, // fur
-	0x1690009e: 341, // fur-IT
-	0x16d00000: 342, // fy
-	0x16d000d9: 343, // fy-NL
-	0x16e00000: 344, // ga
-	0x16e00096: 345, // ga-IE
-	0x17e00000: 346, // gd
-	0x17e0007b: 347, // gd-GB
-	0x19000000: 348, // gl
-	0x1900006e: 349, // gl-ES
-	0x1a300000: 350, // gsw
-	0x1a30004e: 351, // gsw-CH
-	0x1a300078: 352, // gsw-FR
-	0x1a3000b2: 353, // gsw-LI
-	0x1a400000: 354, // gu
-	0x1a400099: 355, // gu-IN
-	0x1a900000: 356, // guw
-	0x1ab00000: 357, // guz
-	0x1ab000a4: 358, // guz-KE
-	0x1ac00000: 359, // gv
-	0x1ac00098: 360, // gv-IM
-	0x1b400000: 361, // ha
-	0x1b400080: 362, // ha-GH
-	0x1b4000d4: 363, // ha-NE
-	0x1b4000d6: 364, // ha-NG
-	0x1b800000: 365, // haw
-	0x1b800135: 366, // haw-US
-	0x1bc00000: 367, // he
-	0x1bc00097: 368, // he-IL
-	0x1be00000: 369, // hi
-	0x1be00099: 370, // hi-IN
-	0x1d100000: 371, // hr
-	0x1d100033: 372, // hr-BA
-	0x1d100090: 373, // hr-HR
-	0x1d200000: 374, // hsb
-	0x1d200060: 375, // hsb-DE
-	0x1d500000: 376, // hu
-	0x1d500092: 377, // hu-HU
-	0x1d700000: 378, // hy
-	0x1d700028: 379, // hy-AM
-	0x1e100000: 380, // id
-	0x1e100095: 381, // id-ID
-	0x1e700000: 382, // ig
-	0x1e7000d6: 383, // ig-NG
-	0x1ea00000: 384, // ii
-	0x1ea00053: 385, // ii-CN
-	0x1f500000: 386, // io
-	0x1f800000: 387, // is
-	0x1f80009d: 388, // is-IS
-	0x1f900000: 389, // it
-	0x1f90004e: 390, // it-CH
-	0x1f90009e: 391, // it-IT
-	0x1f900113: 392, // it-SM
-	0x1f900138: 393, // it-VA
-	0x1fa00000: 394, // iu
-	0x20000000: 395, // ja
-	0x200000a2: 396, // ja-JP
-	0x20300000: 397, // jbo
-	0x20700000: 398, // jgo
-	0x20700052: 399, // jgo-CM
-	0x20a00000: 400, // jmc
-	0x20a0012f: 401, // jmc-TZ
-	0x20e00000: 402, // jv
-	0x21000000: 403, // ka
-	0x2100007d: 404, // ka-GE
-	0x21200000: 405, // kab
-	0x21200067: 406, // kab-DZ
-	0x21600000: 407, // kaj
-	0x21700000: 408, // kam
-	0x217000a4: 409, // kam-KE
-	0x21f00000: 410, // kcg
-	0x22300000: 411, // kde
-	0x2230012f: 412, // kde-TZ
-	0x22700000: 413, // kea
-	0x2270005a: 414, // kea-CV
-	0x23400000: 415, // khq
-	0x234000c3: 416, // khq-ML
-	0x23900000: 417, // ki
-	0x239000a4: 418, // ki-KE
-	0x24200000: 419, // kk
-	0x242000ae: 420, // kk-KZ
-	0x24400000: 421, // kkj
-	0x24400052: 422, // kkj-CM
-	0x24500000: 423, // kl
-	0x24500082: 424, // kl-GL
-	0x24600000: 425, // kln
-	0x246000a4: 426, // kln-KE
-	0x24a00000: 427, // km
-	0x24a000a6: 428, // km-KH
-	0x25100000: 429, // kn
-	0x25100099: 430, // kn-IN
-	0x25400000: 431, // ko
-	0x254000aa: 432, // ko-KP
-	0x254000ab: 433, // ko-KR
-	0x25600000: 434, // kok
-	0x25600099: 435, // kok-IN
-	0x26a00000: 436, // ks
-	0x26a00099: 437, // ks-IN
-	0x26b00000: 438, // ksb
-	0x26b0012f: 439, // ksb-TZ
-	0x26d00000: 440, // ksf
-	0x26d00052: 441, // ksf-CM
-	0x26e00000: 442, // ksh
-	0x26e00060: 443, // ksh-DE
-	0x27400000: 444, // ku
-	0x28100000: 445, // kw
-	0x2810007b: 446, // kw-GB
-	0x28a00000: 447, // ky
-	0x28a000a5: 448, // ky-KG
-	0x29100000: 449, // lag
-	0x2910012f: 450, // lag-TZ
-	0x29500000: 451, // lb
-	0x295000b7: 452, // lb-LU
-	0x2a300000: 453, // lg
-	0x2a300131: 454, // lg-UG
-	0x2af00000: 455, // lkt
-	0x2af00135: 456, // lkt-US
-	0x2b500000: 457, // ln
-	0x2b50002a: 458, // ln-AO
-	0x2b50004b: 459, // ln-CD
-	0x2b50004c: 460, // ln-CF
-	0x2b50004d: 461, // ln-CG
-	0x2b800000: 462, // lo
-	0x2b8000af: 463, // lo-LA
-	0x2bf00000: 464, // lrc
-	0x2bf0009b: 465, // lrc-IQ
-	0x2bf0009c: 466, // lrc-IR
-	0x2c000000: 467, // lt
-	0x2c0000b6: 468, // lt-LT
-	0x2c200000: 469, // lu
-	0x2c20004b: 470, // lu-CD
-	0x2c400000: 471, // luo
-	0x2c4000a4: 472, // luo-KE
-	0x2c500000: 473, // luy
-	0x2c5000a4: 474, // luy-KE
-	0x2c700000: 475, // lv
-	0x2c7000b8: 476, // lv-LV
-	0x2d100000: 477, // mas
-	0x2d1000a4: 478, // mas-KE
-	0x2d10012f: 479, // mas-TZ
-	0x2e900000: 480, // mer
-	0x2e9000a4: 481, // mer-KE
-	0x2ed00000: 482, // mfe
-	0x2ed000cc: 483, // mfe-MU
-	0x2f100000: 484, // mg
-	0x2f1000bf: 485, // mg-MG
-	0x2f200000: 486, // mgh
-	0x2f2000d1: 487, // mgh-MZ
-	0x2f400000: 488, // mgo
-	0x2f400052: 489, // mgo-CM
-	0x2ff00000: 490, // mk
-	0x2ff000c2: 491, // mk-MK
-	0x30400000: 492, // ml
-	0x30400099: 493, // ml-IN
-	0x30b00000: 494, // mn
-	0x30b000c5: 495, // mn-MN
-	0x31b00000: 496, // mr
-	0x31b00099: 497, // mr-IN
-	0x31f00000: 498, // ms
-	0x31f0003e: 499, // ms-BN
-	0x31f000d0: 500, // ms-MY
-	0x31f0010d: 501, // ms-SG
-	0x32000000: 502, // mt
-	0x320000cb: 503, // mt-MT
-	0x32500000: 504, // mua
-	0x32500052: 505, // mua-CM
-	0x33100000: 506, // my
-	0x331000c4: 507, // my-MM
-	0x33a00000: 508, // mzn
-	0x33a0009c: 509, // mzn-IR
-	0x34100000: 510, // nah
-	0x34500000: 511, // naq
-	0x345000d2: 512, // naq-NA
-	0x34700000: 513, // nb
-	0x347000da: 514, // nb-NO
-	0x34700110: 515, // nb-SJ
-	0x34e00000: 516, // nd
-	0x34e00164: 517, // nd-ZW
-	0x35000000: 518, // nds
-	0x35000060: 519, // nds-DE
-	0x350000d9: 520, // nds-NL
-	0x35100000: 521, // ne
-	0x35100099: 522, // ne-IN
-	0x351000db: 523, // ne-NP
-	0x36700000: 524, // nl
-	0x36700030: 525, // nl-AW
-	0x36700036: 526, // nl-BE
-	0x36700040: 527, // nl-BQ
-	0x3670005b: 528, // nl-CW
-	0x367000d9: 529, // nl-NL
-	0x36700116: 530, // nl-SR
-	0x3670011b: 531, // nl-SX
-	0x36800000: 532, // nmg
-	0x36800052: 533, // nmg-CM
-	0x36a00000: 534, // nn
-	0x36a000da: 535, // nn-NO
-	0x36c00000: 536, // nnh
-	0x36c00052: 537, // nnh-CM
-	0x36f00000: 538, // no
-	0x37500000: 539, // nqo
-	0x37600000: 540, // nr
-	0x37a00000: 541, // nso
-	0x38000000: 542, // nus
-	0x38000117: 543, // nus-SS
-	0x38700000: 544, // ny
-	0x38900000: 545, // nyn
-	0x38900131: 546, // nyn-UG
-	0x39000000: 547, // om
-	0x3900006f: 548, // om-ET
-	0x390000a4: 549, // om-KE
-	0x39500000: 550, // or
-	0x39500099: 551, // or-IN
-	0x39800000: 552, // os
-	0x3980007d: 553, // os-GE
-	0x39800106: 554, // os-RU
-	0x39d00000: 555, // pa
-	0x39d05000: 556, // pa-Arab
-	0x39d050e8: 557, // pa-Arab-PK
-	0x39d33000: 558, // pa-Guru
-	0x39d33099: 559, // pa-Guru-IN
-	0x3a100000: 560, // pap
-	0x3b300000: 561, // pl
-	0x3b3000e9: 562, // pl-PL
-	0x3bd00000: 563, // prg
-	0x3bd00001: 564, // prg-001
-	0x3be00000: 565, // ps
-	0x3be00024: 566, // ps-AF
-	0x3c000000: 567, // pt
-	0x3c00002a: 568, // pt-AO
-	0x3c000041: 569, // pt-BR
-	0x3c00004e: 570, // pt-CH
-	0x3c00005a: 571, // pt-CV
-	0x3c000086: 572, // pt-GQ
-	0x3c00008b: 573, // pt-GW
-	0x3c0000b7: 574, // pt-LU
-	0x3c0000c6: 575, // pt-MO
-	0x3c0000d1: 576, // pt-MZ
-	0x3c0000ee: 577, // pt-PT
-	0x3c000118: 578, // pt-ST
-	0x3c000126: 579, // pt-TL
-	0x3c400000: 580, // qu
-	0x3c40003f: 581, // qu-BO
-	0x3c400069: 582, // qu-EC
-	0x3c4000e4: 583, // qu-PE
-	0x3d400000: 584, // rm
-	0x3d40004e: 585, // rm-CH
-	0x3d900000: 586, // rn
-	0x3d90003a: 587, // rn-BI
-	0x3dc00000: 588, // ro
-	0x3dc000bc: 589, // ro-MD
-	0x3dc00104: 590, // ro-RO
-	0x3de00000: 591, // rof
-	0x3de0012f: 592, // rof-TZ
-	0x3e200000: 593, // ru
-	0x3e200047: 594, // ru-BY
-	0x3e2000a5: 595, // ru-KG
-	0x3e2000ae: 596, // ru-KZ
-	0x3e2000bc: 597, // ru-MD
-	0x3e200106: 598, // ru-RU
-	0x3e200130: 599, // ru-UA
-	0x3e500000: 600, // rw
-	0x3e500107: 601, // rw-RW
-	0x3e600000: 602, // rwk
-	0x3e60012f: 603, // rwk-TZ
-	0x3eb00000: 604, // sah
-	0x3eb00106: 605, // sah-RU
-	0x3ec00000: 606, // saq
-	0x3ec000a4: 607, // saq-KE
-	0x3f300000: 608, // sbp
-	0x3f30012f: 609, // sbp-TZ
-	0x3fa00000: 610, // sd
-	0x3fa000e8: 611, // sd-PK
-	0x3fc00000: 612, // sdh
-	0x3fd00000: 613, // se
-	0x3fd00072: 614, // se-FI
-	0x3fd000da: 615, // se-NO
-	0x3fd0010c: 616, // se-SE
-	0x3ff00000: 617, // seh
-	0x3ff000d1: 618, // seh-MZ
-	0x40100000: 619, // ses
-	0x401000c3: 620, // ses-ML
-	0x40200000: 621, // sg
-	0x4020004c: 622, // sg-CF
-	0x40800000: 623, // shi
-	0x40857000: 624, // shi-Latn
-	0x408570ba: 625, // shi-Latn-MA
-	0x408dc000: 626, // shi-Tfng
-	0x408dc0ba: 627, // shi-Tfng-MA
-	0x40c00000: 628, // si
-	0x40c000b3: 629, // si-LK
-	0x41200000: 630, // sk
-	0x41200111: 631, // sk-SK
-	0x41600000: 632, // sl
-	0x4160010f: 633, // sl-SI
-	0x41c00000: 634, // sma
-	0x41d00000: 635, // smi
-	0x41e00000: 636, // smj
-	0x41f00000: 637, // smn
-	0x41f00072: 638, // smn-FI
-	0x42200000: 639, // sms
-	0x42300000: 640, // sn
-	0x42300164: 641, // sn-ZW
-	0x42900000: 642, // so
-	0x42900062: 643, // so-DJ
-	0x4290006f: 644, // so-ET
-	0x429000a4: 645, // so-KE
-	0x42900115: 646, // so-SO
-	0x43100000: 647, // sq
-	0x43100027: 648, // sq-AL
-	0x431000c2: 649, // sq-MK
-	0x4310014d: 650, // sq-XK
-	0x43200000: 651, // sr
-	0x4321f000: 652, // sr-Cyrl
-	0x4321f033: 653, // sr-Cyrl-BA
-	0x4321f0bd: 654, // sr-Cyrl-ME
-	0x4321f105: 655, // sr-Cyrl-RS
-	0x4321f14d: 656, // sr-Cyrl-XK
-	0x43257000: 657, // sr-Latn
-	0x43257033: 658, // sr-Latn-BA
-	0x432570bd: 659, // sr-Latn-ME
-	0x43257105: 660, // sr-Latn-RS
-	0x4325714d: 661, // sr-Latn-XK
-	0x43700000: 662, // ss
-	0x43a00000: 663, // ssy
-	0x43b00000: 664, // st
-	0x44400000: 665, // sv
-	0x44400031: 666, // sv-AX
-	0x44400072: 667, // sv-FI
-	0x4440010c: 668, // sv-SE
-	0x44500000: 669, // sw
-	0x4450004b: 670, // sw-CD
-	0x445000a4: 671, // sw-KE
-	0x4450012f: 672, // sw-TZ
-	0x44500131: 673, // sw-UG
-	0x44e00000: 674, // syr
-	0x45000000: 675, // ta
-	0x45000099: 676, // ta-IN
-	0x450000b3: 677, // ta-LK
-	0x450000d0: 678, // ta-MY
-	0x4500010d: 679, // ta-SG
-	0x46100000: 680, // te
-	0x46100099: 681, // te-IN
-	0x46400000: 682, // teo
-	0x464000a4: 683, // teo-KE
-	0x46400131: 684, // teo-UG
-	0x46700000: 685, // tg
-	0x46700124: 686, // tg-TJ
-	0x46b00000: 687, // th
-	0x46b00123: 688, // th-TH
-	0x46f00000: 689, // ti
-	0x46f0006d: 690, // ti-ER
-	0x46f0006f: 691, // ti-ET
-	0x47100000: 692, // tig
-	0x47600000: 693, // tk
-	0x47600127: 694, // tk-TM
-	0x48000000: 695, // tn
-	0x48200000: 696, // to
-	0x48200129: 697, // to-TO
-	0x48a00000: 698, // tr
-	0x48a0005d: 699, // tr-CY
-	0x48a0012b: 700, // tr-TR
-	0x48e00000: 701, // ts
-	0x49400000: 702, // tt
-	0x49400106: 703, // tt-RU
-	0x4a400000: 704, // twq
-	0x4a4000d4: 705, // twq-NE
-	0x4a900000: 706, // tzm
-	0x4a9000ba: 707, // tzm-MA
-	0x4ac00000: 708, // ug
-	0x4ac00053: 709, // ug-CN
-	0x4ae00000: 710, // uk
-	0x4ae00130: 711, // uk-UA
-	0x4b400000: 712, // ur
-	0x4b400099: 713, // ur-IN
-	0x4b4000e8: 714, // ur-PK
-	0x4bc00000: 715, // uz
-	0x4bc05000: 716, // uz-Arab
-	0x4bc05024: 717, // uz-Arab-AF
-	0x4bc1f000: 718, // uz-Cyrl
-	0x4bc1f137: 719, // uz-Cyrl-UZ
-	0x4bc57000: 720, // uz-Latn
-	0x4bc57137: 721, // uz-Latn-UZ
-	0x4be00000: 722, // vai
-	0x4be57000: 723, // vai-Latn
-	0x4be570b4: 724, // vai-Latn-LR
-	0x4bee3000: 725, // vai-Vaii
-	0x4bee30b4: 726, // vai-Vaii-LR
-	0x4c000000: 727, // ve
-	0x4c300000: 728, // vi
-	0x4c30013e: 729, // vi-VN
-	0x4c900000: 730, // vo
-	0x4c900001: 731, // vo-001
-	0x4cc00000: 732, // vun
-	0x4cc0012f: 733, // vun-TZ
-	0x4ce00000: 734, // wa
-	0x4cf00000: 735, // wae
-	0x4cf0004e: 736, // wae-CH
-	0x4e500000: 737, // wo
-	0x4e500114: 738, // wo-SN
-	0x4f200000: 739, // xh
-	0x4fb00000: 740, // xog
-	0x4fb00131: 741, // xog-UG
-	0x50900000: 742, // yav
-	0x50900052: 743, // yav-CM
-	0x51200000: 744, // yi
-	0x51200001: 745, // yi-001
-	0x51800000: 746, // yo
-	0x5180003b: 747, // yo-BJ
-	0x518000d6: 748, // yo-NG
-	0x51f00000: 749, // yue
-	0x51f38000: 750, // yue-Hans
-	0x51f38053: 751, // yue-Hans-CN
-	0x51f39000: 752, // yue-Hant
-	0x51f3908d: 753, // yue-Hant-HK
-	0x52800000: 754, // zgh
-	0x528000ba: 755, // zgh-MA
-	0x52900000: 756, // zh
-	0x52938000: 757, // zh-Hans
-	0x52938053: 758, // zh-Hans-CN
-	0x5293808d: 759, // zh-Hans-HK
-	0x529380c6: 760, // zh-Hans-MO
-	0x5293810d: 761, // zh-Hans-SG
-	0x52939000: 762, // zh-Hant
-	0x5293908d: 763, // zh-Hant-HK
-	0x529390c6: 764, // zh-Hant-MO
-	0x5293912e: 765, // zh-Hant-TW
-	0x52f00000: 766, // zu
-	0x52f00161: 767, // zu-ZA
-}
-
-// Total table size 4676 bytes (4KiB); checksum: 17BE3673
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
index b65e213..abfa17f 100644
--- a/vendor/golang.org/x/text/language/language.go
+++ b/vendor/golang.org/x/text/language/language.go
@@ -2,8 +2,7 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:generate go run gen.go gen_common.go -output tables.go
-//go:generate go run gen_index.go
+//go:generate go run gen.go -output tables.go
 
 package language
 
@@ -11,47 +10,34 @@ package language
 // - verifying that tables are dropped correctly (most notably matcher tables).
 
 import (
-	"errors"
-	"fmt"
 	"strings"
-)
-
-const (
-	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
-	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
-	maxCoreSize = 12
 
-	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
-	// is large enough to hold at least 99% of the BCP 47 tags.
-	max99thPercentileSize = 32
-
-	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
-	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
-	maxSimpleUExtensionSize = 14
+	"golang.org/x/text/internal/language"
+	"golang.org/x/text/internal/language/compact"
 )
 
 // Tag represents a BCP 47 language tag. It is used to specify an instance of a
 // specific language or locale. All language tag values are guaranteed to be
 // well-formed.
-type Tag struct {
-	lang   langID
-	region regionID
-	// TODO: we will soon run out of positions for script. Idea: instead of
-	// storing lang, region, and script codes, store only the compact index and
-	// have a lookup table from this code to its expansion. This greatly speeds
-	// up table lookup, speed up common variant cases.
-	// This will also immediately free up 3 extra bytes. Also, the pVariant
-	// field can now be moved to the lookup table, as the compact index uniquely
-	// determines the offset of a possible variant.
-	script   scriptID
-	pVariant byte   // offset in str, includes preceding '-'
-	pExt     uint16 // offset of first extension, includes preceding '-'
-
-	// str is the string representation of the Tag. It will only be used if the
-	// tag has variants or extensions.
-	str string
+type Tag compact.Tag
+
+func makeTag(t language.Tag) (tag Tag) {
+	return Tag(compact.Make(t))
+}
+
+func (t *Tag) tag() language.Tag {
+	return (*compact.Tag)(t).Tag()
+}
+
+func (t *Tag) isCompact() bool {
+	return (*compact.Tag)(t).IsCompact()
 }
 
+// TODO: improve performance.
+func (t *Tag) lang() language.Language { return t.tag().LangID }
+func (t *Tag) region() language.Region { return t.tag().RegionID }
+func (t *Tag) script() language.Script { return t.tag().ScriptID }
+
 // Make is a convenience wrapper for Parse that omits the error.
 // In case of an error, a sensible default is returned.
 func Make(s string) Tag {
@@ -68,25 +54,13 @@ func (c CanonType) Make(s string) Tag {
 // Raw returns the raw base language, script and region, without making an
 // attempt to infer their values.
 func (t Tag) Raw() (b Base, s Script, r Region) {
-	return Base{t.lang}, Script{t.script}, Region{t.region}
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
-	return t.lang == a.lang && t.script == a.script && t.region == a.region
+	tt := t.tag()
+	return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
 }
 
 // IsRoot returns true if t is equal to language "und".
 func (t Tag) IsRoot() bool {
-	if int(t.pVariant) < len(t.str) {
-		return false
-	}
-	return t.equalTags(und)
-}
-
-// private reports whether the Tag consists solely of a private use tag.
-func (t Tag) private() bool {
-	return t.str != "" && t.pVariant == 0
+	return compact.Tag(t).IsRoot()
 }
 
 // CanonType can be used to enable or disable various types of canonicalization.
@@ -138,73 +112,73 @@ const (
 
 // canonicalize returns the canonicalized equivalent of the tag and
 // whether there was any change.
-func (t Tag) canonicalize(c CanonType) (Tag, bool) {
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
 	if c == Raw {
 		return t, false
 	}
 	changed := false
 	if c&SuppressScript != 0 {
-		if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
-			t.script = 0
+		if t.LangID.SuppressScript() == t.ScriptID {
+			t.ScriptID = 0
 			changed = true
 		}
 	}
 	if c&canonLang != 0 {
 		for {
-			if l, aliasType := normLang(t.lang); l != t.lang {
+			if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
 				switch aliasType {
-				case langLegacy:
+				case language.Legacy:
 					if c&Legacy != 0 {
-						if t.lang == _sh && t.script == 0 {
-							t.script = _Latn
+						if t.LangID == _sh && t.ScriptID == 0 {
+							t.ScriptID = _Latn
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 					}
-				case langMacro:
+				case language.Macro:
 					if c&Macro != 0 {
 						// We deviate here from CLDR. The mapping "nb" -> "no"
 						// qualifies as a typical Macro language mapping.  However,
 						// for legacy reasons, CLDR maps "no", the macro language
 						// code for Norwegian, to the dominant variant "nb". This
 						// change is currently under consideration for CLDR as well.
-						// See http://unicode.org/cldr/trac/ticket/2698 and also
-						// http://unicode.org/cldr/trac/ticket/1790 for some of the
+						// See https://unicode.org/cldr/trac/ticket/2698 and also
+						// https://unicode.org/cldr/trac/ticket/1790 for some of the
 						// practical implications. TODO: this check could be removed
 						// if CLDR adopts this change.
-						if c&CLDR == 0 || t.lang != _nb {
+						if c&CLDR == 0 || t.LangID != _nb {
 							changed = true
-							t.lang = l
+							t.LangID = l
 						}
 					}
-				case langDeprecated:
+				case language.Deprecated:
 					if c&DeprecatedBase != 0 {
-						if t.lang == _mo && t.region == 0 {
-							t.region = _MD
+						if t.LangID == _mo && t.RegionID == 0 {
+							t.RegionID = _MD
 						}
-						t.lang = l
+						t.LangID = l
 						changed = true
 						// Other canonicalization types may still apply.
 						continue
 					}
 				}
-			} else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
-				t.lang = _nb
+			} else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+				t.LangID = _nb
 				changed = true
 			}
 			break
 		}
 	}
 	if c&DeprecatedScript != 0 {
-		if t.script == _Qaai {
+		if t.ScriptID == _Qaai {
 			changed = true
-			t.script = _Zinh
+			t.ScriptID = _Zinh
 		}
 	}
 	if c&DeprecatedRegion != 0 {
-		if r := normRegion(t.region); r != 0 {
+		if r := t.RegionID.Canonicalize(); r != t.RegionID {
 			changed = true
-			t.region = r
+			t.RegionID = r
 		}
 	}
 	return t, changed
@@ -212,11 +186,20 @@ func (t Tag) canonicalize(c CanonType) (Tag, bool) {
 
 // Canonicalize returns the canonicalized equivalent of the tag.
 func (c CanonType) Canonicalize(t Tag) (Tag, error) {
-	t, changed := t.canonicalize(c)
-	if changed {
-		t.remakeString()
+	// First try fast path.
+	if t.isCompact() {
+		if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
+			return t, nil
+		}
+	}
+	// It is unlikely that one will canonicalize a tag after matching. So do
+	// a slow but simple approach here.
+	if tag, changed := canonicalize(c, t.tag()); changed {
+		tag.RemakeString()
+		return makeTag(tag), nil
 	}
 	return t, nil
+
 }
 
 // Confidence indicates the level of certainty for a given return value.
@@ -239,83 +222,21 @@ func (c Confidence) String() string {
 	return confName[c]
 }
 
-// remakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) remakeString() {
-	if t.str == "" {
-		return
-	}
-	extra := t.str[t.pVariant:]
-	if t.pVariant > 0 {
-		extra = extra[1:]
-	}
-	if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
-		t.str = extra
-		t.pVariant = 0
-		t.pExt = 0
-		return
-	}
-	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
-	b := buf[:t.genCoreBytes(buf[:])]
-	if extra != "" {
-		diff := len(b) - int(t.pVariant)
-		b = append(b, '-')
-		b = append(b, extra...)
-		t.pVariant = uint8(int(t.pVariant) + diff)
-		t.pExt = uint16(int(t.pExt) + diff)
-	} else {
-		t.pVariant = uint8(len(b))
-		t.pExt = uint16(len(b))
-	}
-	t.str = string(b)
-}
-
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
-	n := t.lang.stringToBuf(buf[:])
-	if t.script != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.script.String())
-	}
-	if t.region != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.region.String())
-	}
-	return n
-}
-
 // String returns the canonical string representation of the language tag.
 func (t Tag) String() string {
-	if t.str != "" {
-		return t.str
-	}
-	if t.script == 0 && t.region == 0 {
-		return t.lang.String()
-	}
-	buf := [maxCoreSize]byte{}
-	return string(buf[:t.genCoreBytes(buf[:])])
+	return t.tag().String()
 }
 
 // MarshalText implements encoding.TextMarshaler.
 func (t Tag) MarshalText() (text []byte, err error) {
-	if t.str != "" {
-		text = append(text, t.str...)
-	} else if t.script == 0 && t.region == 0 {
-		text = append(text, t.lang.String()...)
-	} else {
-		buf := [maxCoreSize]byte{}
-		text = buf[:t.genCoreBytes(buf[:])]
-	}
-	return text, nil
+	return t.tag().MarshalText()
 }
 
 // UnmarshalText implements encoding.TextUnmarshaler.
 func (t *Tag) UnmarshalText(text []byte) error {
-	tag, err := Raw.Parse(string(text))
-	*t = tag
+	var tag language.Tag
+	err := tag.UnmarshalText(text)
+	*t = makeTag(tag)
 	return err
 }
 
@@ -323,15 +244,16 @@ func (t *Tag) UnmarshalText(text []byte) error {
 // unspecified, an attempt will be made to infer it from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Base() (Base, Confidence) {
-	if t.lang != 0 {
-		return Base{t.lang}, Exact
+	if b := t.lang(); b != 0 {
+		return Base{b}, Exact
 	}
+	tt := t.tag()
 	c := High
-	if t.script == 0 && !(Region{t.region}).IsCountry() {
+	if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
 		c = Low
 	}
-	if tag, err := addTags(t); err == nil && tag.lang != 0 {
-		return Base{tag.lang}, c
+	if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+		return Base{tag.LangID}, c
 	}
 	return Base{0}, No
 }
@@ -344,35 +266,34 @@ func (t Tag) Base() (Base, Confidence) {
 // If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
 // as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
 // common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
-// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
 // unknown value in CLDR.  (Zzzz, Exact) is returned if Zzzz was explicitly specified.
 // Note that an inferred script is never guaranteed to be the correct one. Latin is
 // almost exclusively used for Afrikaans, but Arabic has been used for some texts
 // in the past.  Also, the script that is commonly used may change over time.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Script() (Script, Confidence) {
-	if t.script != 0 {
-		return Script{t.script}, Exact
-	}
-	sc, c := scriptID(_Zzzz), No
-	if t.lang < langNoIndexOffset {
-		if scr := scriptID(suppressScript[t.lang]); scr != 0 {
-			// Note: it is not always the case that a language with a suppress
-			// script value is only written in one script (e.g. kk, ms, pa).
-			if t.region == 0 {
-				return Script{scriptID(scr)}, High
-			}
-			sc, c = scr, High
+	if scr := t.script(); scr != 0 {
+		return Script{scr}, Exact
+	}
+	tt := t.tag()
+	sc, c := language.Script(_Zzzz), No
+	if scr := tt.LangID.SuppressScript(); scr != 0 {
+		// Note: it is not always the case that a language with a suppress
+		// script value is only written in one script (e.g. kk, ms, pa).
+		if tt.RegionID == 0 {
+			return Script{scr}, High
 		}
+		sc, c = scr, High
 	}
-	if tag, err := addTags(t); err == nil {
-		if tag.script != sc {
-			sc, c = tag.script, Low
+	if tag, err := tt.Maximize(); err == nil {
+		if tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	} else {
-		t, _ = (Deprecated | Macro).Canonicalize(t)
-		if tag, err := addTags(t); err == nil && tag.script != sc {
-			sc, c = tag.script, Low
+		tt, _ = canonicalize(Deprecated|Macro, tt)
+		if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
+			sc, c = tag.ScriptID, Low
 		}
 	}
 	return Script{sc}, c
@@ -382,28 +303,31 @@ func (t Tag) Script() (Script, Confidence) {
 // infer a most likely candidate from the context.
 // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
 func (t Tag) Region() (Region, Confidence) {
-	if t.region != 0 {
-		return Region{t.region}, Exact
+	if r := t.region(); r != 0 {
+		return Region{r}, Exact
 	}
-	if t, err := addTags(t); err == nil {
-		return Region{t.region}, Low // TODO: differentiate between high and low.
+	tt := t.tag()
+	if tt, err := tt.Maximize(); err == nil {
+		return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
 	}
-	t, _ = (Deprecated | Macro).Canonicalize(t)
-	if tag, err := addTags(t); err == nil {
-		return Region{tag.region}, Low
+	tt, _ = canonicalize(Deprecated|Macro, tt)
+	if tag, err := tt.Maximize(); err == nil {
+		return Region{tag.RegionID}, Low
 	}
 	return Region{_ZZ}, No // TODO: return world instead of undetermined?
 }
 
-// Variant returns the variants specified explicitly for this language tag.
+// Variants returns the variants specified explicitly for this language tag.
 // or nil if no variant was specified.
 func (t Tag) Variants() []Variant {
+	if !compact.Tag(t).MayHaveVariants() {
+		return nil
+	}
 	v := []Variant{}
-	if int(t.pVariant) < int(t.pExt) {
-		for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
-			x, str = nextToken(str)
-			v = append(v, Variant{x})
-		}
+	x, str := "", t.tag().Variants()
+	for str != "" {
+		x, str = nextToken(str)
+		v = append(v, Variant{x})
 	}
 	return v
 }
@@ -411,57 +335,13 @@ func (t Tag) Variants() []Variant {
 // Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
 // specific language are substituted with fields from the parent language.
 // The parent for a language may change for newer versions of CLDR.
+//
+// Parent returns a tag for a less specific language that is mutually
+// intelligible or Und if there is no such language. This may not be the same as
+// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
+// is "zh-Hant", and the parent of "zh-Hant" is "und".
 func (t Tag) Parent() Tag {
-	if t.str != "" {
-		// Strip the variants and extensions.
-		t, _ = Raw.Compose(t.Raw())
-		if t.region == 0 && t.script != 0 && t.lang != 0 {
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script == t.script {
-				return Tag{lang: t.lang}
-			}
-		}
-		return t
-	}
-	if t.lang != 0 {
-		if t.region != 0 {
-			maxScript := t.script
-			if maxScript == 0 {
-				max, _ := addTags(t)
-				maxScript = max.script
-			}
-
-			for i := range parents {
-				if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
-					for _, r := range parents[i].fromRegion {
-						if regionID(r) == t.region {
-							return Tag{
-								lang:   t.lang,
-								script: scriptID(parents[i].script),
-								region: regionID(parents[i].toRegion),
-							}
-						}
-					}
-				}
-			}
-
-			// Strip the script if it is the default one.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != maxScript {
-				return Tag{lang: t.lang, script: maxScript}
-			}
-			return Tag{lang: t.lang}
-		} else if t.script != 0 {
-			// The parent for an base-script pair with a non-default script is
-			// "und" instead of the base language.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != t.script {
-				return und
-			}
-			return Tag{lang: t.lang}
-		}
-	}
-	return und
+	return Tag(compact.Tag(t).Parent())
 }
 
 // returns token t and the rest of the string.
@@ -487,17 +367,8 @@ func (e Extension) String() string {
 
 // ParseExtension parses s as an extension and returns it on success.
 func ParseExtension(s string) (e Extension, err error) {
-	scan := makeScannerString(s)
-	var end int
-	if n := len(scan.token); n != 1 {
-		return Extension{}, errSyntax
-	}
-	scan.toLower(0, len(scan.b))
-	end = parseExtension(&scan)
-	if end != len(s) {
-		return Extension{}, errSyntax
-	}
-	return Extension{string(scan.b)}, nil
+	ext, err := language.ParseExtension(s)
+	return Extension{ext}, err
 }
 
 // Type returns the one-byte extension type of e. It returns 0 for the zero
@@ -518,22 +389,20 @@ func (e Extension) Tokens() []string {
 // false for ok if t does not have the requested extension. The returned
 // extension will be invalid in this case.
 func (t Tag) Extension(x byte) (ext Extension, ok bool) {
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		if ext[0] == x {
-			return Extension{ext}, true
-		}
+	if !compact.Tag(t).MayHaveExtensions() {
+		return Extension{}, false
 	}
-	return Extension{}, false
+	e, ok := t.tag().Extension(x)
+	return Extension{e}, ok
 }
 
 // Extensions returns all extensions of t.
 func (t Tag) Extensions() []Extension {
+	if !compact.Tag(t).MayHaveExtensions() {
+		return nil
+	}
 	e := []Extension{}
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
+	for _, ext := range t.tag().Extensions() {
 		e = append(e, Extension{ext})
 	}
 	return e
@@ -541,259 +410,105 @@ func (t Tag) Extensions() []Extension {
 
 // TypeForKey returns the type associated with the given key, where key and type
 // are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // TypeForKey will traverse the inheritance chain to get the correct value.
 func (t Tag) TypeForKey(key string) string {
-	if start, end, _ := t.findTypeForKey(key); end != start {
-		return t.str[start:end]
+	if !compact.Tag(t).MayHaveExtensions() {
+		if key != "rg" && key != "va" {
+			return ""
+		}
 	}
-	return ""
+	return t.tag().TypeForKey(key)
 }
 
-var (
-	errPrivateUse       = errors.New("cannot set a key on a private use tag")
-	errInvalidArguments = errors.New("invalid key or type")
-)
-
 // SetTypeForKey returns a new Tag with the key set to type, where key and type
 // are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // An empty value removes an existing pair with the same key.
 func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	if t.private() {
-		return t, errPrivateUse
-	}
-	if len(key) != 2 {
-		return t, errInvalidArguments
-	}
-
-	// Remove the setting if value is "".
-	if value == "" {
-		start, end, _ := t.findTypeForKey(key)
-		if start != end {
-			// Remove key tag and leading '-'.
-			start -= 4
-
-			// Remove a possible empty extension.
-			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
-				start -= 2
-			}
-			if start == int(t.pVariant) && end == len(t.str) {
-				t.str = ""
-				t.pVariant, t.pExt = 0, 0
-			} else {
-				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
-			}
-		}
-		return t, nil
-	}
-
-	if len(value) < 3 || len(value) > 8 {
-		return t, errInvalidArguments
-	}
-
-	var (
-		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
-		uStart int // start of the -u extension.
-	)
-
-	// Generate the tag string if needed.
-	if t.str == "" {
-		uStart = t.genCoreBytes(buf[:])
-		buf[uStart] = '-'
-		uStart++
-	}
-
-	// Create new key-type pair and parse it to verify.
-	b := buf[uStart:]
-	copy(b, "u-")
-	copy(b[2:], key)
-	b[4] = '-'
-	b = b[:5+copy(b[5:], value)]
-	scan := makeScanner(b)
-	if parseExtensions(&scan); scan.err != nil {
-		return t, scan.err
-	}
-
-	// Assemble the replacement string.
-	if t.str == "" {
-		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
-		t.str = string(buf[:uStart+len(b)])
-	} else {
-		s := t.str
-		start, end, hasExt := t.findTypeForKey(key)
-		if start == end {
-			if hasExt {
-				b = b[2:]
-			}
-			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
-		} else {
-			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
-		}
-	}
-	return t, nil
+	tt, err := t.tag().SetTypeForKey(key, value)
+	return makeTag(tt), err
 }
 
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
-	p := int(t.pExt)
-	if len(key) != 2 || p == len(t.str) || p == 0 {
-		return p, p, false
-	}
-	s := t.str
-
-	// Find the correct extension.
-	for p++; s[p] != 'u'; p++ {
-		if s[p] > 'u' {
-			p--
-			return p, p, false
-		}
-		if p = nextExtension(s, p); p == len(s) {
-			return len(s), len(s), false
-		}
-	}
-	// Proceed to the hyphen following the extension name.
-	p++
-
-	// curKey is the key currently being processed.
-	curKey := ""
-
-	// Iterate over keys until we get the end of a section.
-	for {
-		// p points to the hyphen preceding the current token.
-		if p3 := p + 3; s[p3] == '-' {
-			// Found a key.
-			// Check whether we just processed the key that was requested.
-			if curKey == key {
-				return start, p, true
-			}
-			// Set to the next key and continue scanning type tokens.
-			curKey = s[p+1 : p3]
-			if curKey > key {
-				return p, p, true
-			}
-			// Start of the type token sequence.
-			start = p + 4
-			// A type is at least 3 characters long.
-			p += 7 // 4 + 3
-		} else {
-			// Attribute or type, which is at least 3 characters long.
-			p += 4
-		}
-		// p points past the third character of a type or attribute.
-		max := p + 5 // maximum length of token plus hyphen.
-		if len(s) < max {
-			max = len(s)
-		}
-		for ; p < max && s[p] != '-'; p++ {
-		}
-		// Bail if we have exhausted all tokens or if the next token starts
-		// a new extension.
-		if p == len(s) || s[p+2] == '-' {
-			if curKey == key {
-				return start, p, true
-			}
-			return p, p, true
-		}
-	}
-}
+// NumCompactTags is the number of compact tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = compact.NumCompactTags
 
 // CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository. The index will change over time
-// and should not be stored in persistent storage. Extensions, except for the
-// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
-// compact tag exists, where 0 is the index for the root language (Und).
-func CompactIndex(t Tag) (index int, ok bool) {
-	// TODO: perhaps give more frequent tags a lower index.
-	// TODO: we could make the indexes stable. This will excluded some
-	//       possibilities for optimization, so don't do this quite yet.
-	b, s, r := t.Raw()
-	if len(t.str) > 0 {
-		if strings.HasPrefix(t.str, "x-") {
-			// We have no entries for user-defined tags.
-			return 0, false
-		}
-		if uint16(t.pVariant) != t.pExt {
-			// There are no tags with variants and an u-va type.
-			if t.TypeForKey("va") != "" {
-				return 0, false
-			}
-			t, _ = Raw.Compose(b, s, r, t.Variants())
-		} else if _, ok := t.Extension('u'); ok {
-			// Strip all but the 'va' entry.
-			variant := t.TypeForKey("va")
-			t, _ = Raw.Compose(b, s, r)
-			t, _ = t.SetTypeForKey("va", variant)
-		}
-		if len(t.str) > 0 {
-			// We have some variants.
-			for i, s := range specialTags {
-				if s == t {
-					return i + 1, true
-				}
-			}
-			return 0, false
-		}
-	}
-	// No variants specified: just compare core components.
-	// The key has the form lllssrrr, where l, s, and r are nibbles for
-	// respectively the langID, scriptID, and regionID.
-	key := uint32(b.langID) << (8 + 12)
-	key |= uint32(s.scriptID) << 12
-	key |= uint32(r.regionID)
-	x, ok := coreTags[key]
-	return int(x), ok
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func CompactIndex(t Tag) (index int, exact bool) {
+	id, exact := compact.LanguageID(compact.Tag(t))
+	return int(id), exact
 }
 
+var root = language.Tag{}
+
 // Base is an ISO 639 language code, used for encoding the base language
 // of a language tag.
 type Base struct {
-	langID
+	langID language.Language
 }
 
 // ParseBase parses a 2- or 3-letter ISO 639 code.
 // It returns a ValueError if s is a well-formed but unknown language identifier
 // or another error if another error occurred.
 func ParseBase(s string) (Base, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Base{}, errSyntax
-	}
-	var buf [3]byte
-	l, err := getLangID(buf[:copy(buf[:], s)])
+	l, err := language.ParseBase(s)
 	return Base{l}, err
 }
 
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+	return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+	return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+	return b.langID.IsPrivateUse()
+}
+
 // Script is a 4-letter ISO 15924 code for representing scripts.
 // It is idiomatically represented in title case.
 type Script struct {
-	scriptID
+	scriptID language.Script
 }
 
 // ParseScript parses a 4-letter ISO 15924 code.
 // It returns a ValueError if s is a well-formed but unknown script identifier
 // or another error if another error occurred.
 func ParseScript(s string) (Script, error) {
-	if len(s) != 4 {
-		return Script{}, errSyntax
-	}
-	var buf [4]byte
-	sc, err := getScriptID(script, buf[:copy(buf[:], s)])
+	sc, err := language.ParseScript(s)
 	return Script{sc}, err
 }
 
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+	return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+	return s.scriptID.IsPrivateUse()
+}
+
 // Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
 type Region struct {
-	regionID
+	regionID language.Region
 }
 
 // EncodeM49 returns the Region for the given UN M.49 code.
 // It returns an error if r is not a valid code.
 func EncodeM49(r int) (Region, error) {
-	rid, err := getRegionM49(r)
+	rid, err := language.EncodeM49(r)
 	return Region{rid}, err
 }
 
@@ -801,62 +516,54 @@ func EncodeM49(r int) (Region, error) {
 // It returns a ValueError if s is a well-formed but unknown region identifier
 // or another error if another error occurred.
 func ParseRegion(s string) (Region, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Region{}, errSyntax
-	}
-	var buf [3]byte
-	r, err := getRegionID(buf[:copy(buf[:], s)])
+	r, err := language.ParseRegion(s)
 	return Region{r}, err
 }
 
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+	return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+	return r.regionID.ISO3()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+	return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+	return r.regionID.IsPrivateUse()
+}
+
 // IsCountry returns whether this region is a country or autonomous area. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsCountry() bool {
-	if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
-		return false
-	}
-	return true
+	return r.regionID.IsCountry()
 }
 
 // IsGroup returns whether this region defines a collection of regions. This
 // includes non-standard definitions from CLDR.
 func (r Region) IsGroup() bool {
-	if r.regionID == 0 {
-		return false
-	}
-	return int(regionInclusion[r.regionID]) < len(regionContainment)
+	return r.regionID.IsGroup()
 }
 
 // Contains returns whether Region c is contained by Region r. It returns true
 // if c == r.
 func (r Region) Contains(c Region) bool {
-	return r.regionID.contains(c.regionID)
+	return r.regionID.Contains(c.regionID)
 }
 
-func (r regionID) contains(c regionID) bool {
-	if r == c {
-		return true
-	}
-	g := regionInclusion[r]
-	if g >= nRegionGroups {
-		return false
-	}
-	m := regionContainment[g]
-
-	d := regionInclusion[c]
-	b := regionInclusionBits[d]
-
-	// A contained country may belong to multiple disjoint groups. Matching any
-	// of these indicates containment. If the contained region is a group, it
-	// must strictly be a subset.
-	if d >= nRegionGroups {
-		return b&m != 0
-	}
-	return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
 // TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
 // In all other cases it returns either the region itself or an error.
 //
@@ -865,25 +572,15 @@ var errNoTLD = errors.New("language: region is not a valid ccTLD")
 // region will already be canonicalized it was obtained from a Tag that was
 // obtained using any of the default methods.
 func (r Region) TLD() (Region, error) {
-	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
-	// difference between ISO 3166-1 and IANA ccTLD.
-	if r.regionID == _GB {
-		r = Region{_UK}
-	}
-	if (r.typ() & ccTLD) == 0 {
-		return Region{}, errNoTLD
-	}
-	return r, nil
+	tld, err := r.regionID.TLD()
+	return Region{tld}, err
 }
 
 // Canonicalize returns the region or a possible replacement if the region is
 // deprecated. It will not return a replacement for deprecated regions that
 // are split into multiple regions.
 func (r Region) Canonicalize() Region {
-	if cr := normRegion(r.regionID); cr != 0 {
-		return Region{cr}
-	}
-	return r
+	return Region{r.regionID.Canonicalize()}
 }
 
 // Variant represents a registered variant of a language as defined by BCP 47.
@@ -894,11 +591,8 @@ type Variant struct {
 // ParseVariant parses and returns a Variant. An error is returned if s is not
 // a valid variant.
 func ParseVariant(s string) (Variant, error) {
-	s = strings.ToLower(s)
-	if _, ok := variantIndex[s]; ok {
-		return Variant{s}, nil
-	}
-	return Variant{}, mkErrInvalid([]byte(s))
+	v, err := language.ParseVariant(s)
+	return Variant{v.String()}, err
 }
 
 // String returns the string representation of the variant.
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
index 15b74d1..f734921 100644
--- a/vendor/golang.org/x/text/language/match.go
+++ b/vendor/golang.org/x/text/language/match.go
@@ -4,7 +4,12 @@
 
 package language
 
-import "errors"
+import (
+	"errors"
+	"strings"
+
+	"golang.org/x/text/internal/language"
+)
 
 // A MatchOption configures a Matcher.
 type MatchOption func(*matcher)
@@ -74,12 +79,13 @@ func NewMatcher(t []Tag, options ...MatchOption) Matcher {
 }
 
 func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+	var tt language.Tag
 	match, w, c := m.getBest(want...)
 	if match != nil {
-		t, index = match.tag, match.index
+		tt, index = match.tag, match.index
 	} else {
 		// TODO: this should be an option
-		t = m.default_.tag
+		tt = m.default_.tag
 		if m.preferSameScript {
 		outer:
 			for _, w := range want {
@@ -91,7 +97,7 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
 				}
 				for i, h := range m.supported {
 					if script.scriptID == h.maxScript {
-						t, index = h.tag, i
+						tt, index = h.tag, i
 						break outer
 					}
 				}
@@ -99,238 +105,45 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
 		}
 		// TODO: select first language tag based on script.
 	}
-	if w.region != 0 && t.region != 0 && t.region.contains(w.region) {
-		t, _ = Raw.Compose(t, Region{w.region})
+	if w.RegionID != tt.RegionID && w.RegionID != 0 {
+		if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+			tt.RegionID = w.RegionID
+			tt.RemakeString()
+		} else if r := w.RegionID.String(); len(r) == 2 {
+			// TODO: also filter macro and deprecated.
+			tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
+		}
 	}
 	// Copy options from the user-provided tag into the result tag. This is hard
 	// to do after the fact, so we do it here.
 	// TODO: add in alternative variants to -u-va-.
 	// TODO: add preferred region to -u-rg-.
 	if e := w.Extensions(); len(e) > 0 {
-		t, _ = Raw.Compose(t, e)
-	}
-	return t, index, c
-}
-
-type scriptRegionFlags uint8
-
-const (
-	isList = 1 << iota
-	scriptInFrom
-	regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id langID) {
-	if t.lang == 0 {
-		t.lang = id
-	}
-}
-
-func (t *Tag) setUndefinedScript(id scriptID) {
-	if t.script == 0 {
-		t.script = id
-	}
-}
-
-func (t *Tag) setUndefinedRegion(id regionID) {
-	if t.region == 0 || t.region.contains(id) {
-		t.region = id
+		b := language.Builder{}
+		b.SetTag(tt)
+		for _, e := range e {
+			b.AddExt(e)
+		}
+		tt = b.Make()
 	}
+	return makeTag(tt), index, c
 }
 
 // ErrMissingLikelyTagsData indicates no information was available
 // to compute likely values of missing tags.
 var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
 
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
-	id, err := addTags(t)
-	if err != nil {
-		return t, err
-	} else if id.equalTags(t) {
-		return t, nil
-	}
-	id.remakeString()
-	return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
-	if i := regionInclusion[t.region]; i < nRegionGroups {
-		x := likelyRegionGroup[i]
-		if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
-			t.region = regionID(x.region)
-		}
-		return true
-	}
-	return false
-}
-
-func addTags(t Tag) (Tag, error) {
-	// We leave private use identifiers alone.
-	if t.private() {
-		return t, nil
-	}
-	if t.script != 0 && t.region != 0 {
-		if t.lang != 0 {
-			// already fully specified
-			specializeRegion(&t)
-			return t, nil
-		}
-		// Search matches for und-script-region. Note that for these cases
-		// region will never be a group so there is no need to check for this.
-		list := likelyRegion[t.region : t.region+1]
-		if x := list[0]; x.flags&isList != 0 {
-			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
-		}
-		for _, x := range list {
-			// Deviating from the spec. See match_test.go for details.
-			if scriptID(x.script) == t.script {
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-	}
-	if t.lang != 0 {
-		// Search matches for lang-script and lang-region, where lang != und.
-		if t.lang < langNoIndexOffset {
-			x := likelyLang[t.lang]
-			if x.flags&isList != 0 {
-				list := likelyLangList[x.region : x.region+uint16(x.script)]
-				if t.script != 0 {
-					for _, x := range list {
-						if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
-							t.setUndefinedRegion(regionID(x.region))
-							return t, nil
-						}
-					}
-				} else if t.region != 0 {
-					count := 0
-					goodScript := true
-					tt := t
-					for _, x := range list {
-						// We visit all entries for which the script was not
-						// defined, including the ones where the region was not
-						// defined. This allows for proper disambiguation within
-						// regions.
-						if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
-							tt.region = regionID(x.region)
-							tt.setUndefinedScript(scriptID(x.script))
-							goodScript = goodScript && tt.script == scriptID(x.script)
-							count++
-						}
-					}
-					if count == 1 {
-						return tt, nil
-					}
-					// Even if we fail to find a unique Region, we might have
-					// an unambiguous script.
-					if goodScript {
-						t.script = tt.script
-					}
-				}
-			}
-		}
-	} else {
-		// Search matches for und-script.
-		if t.script != 0 {
-			x := likelyScript[t.script]
-			if x.region != 0 {
-				t.setUndefinedRegion(regionID(x.region))
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-		// Search matches for und-region. If und-script-region exists, it would
-		// have been found earlier.
-		if t.region != 0 {
-			if i := regionInclusion[t.region]; i < nRegionGroups {
-				x := likelyRegionGroup[i]
-				if x.region != 0 {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					t.region = regionID(x.region)
-				}
-			} else {
-				x := likelyRegion[t.region]
-				if x.flags&isList != 0 {
-					x = likelyRegionList[x.lang]
-				}
-				if x.script != 0 && x.flags != scriptInFrom {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					return t, nil
-				}
-			}
-		}
-	}
-
-	// Search matches for lang.
-	if t.lang < langNoIndexOffset {
-		x := likelyLang[t.lang]
-		if x.flags&isList != 0 {
-			x = likelyLangList[x.region]
-		}
-		if x.region != 0 {
-			t.setUndefinedScript(scriptID(x.script))
-			t.setUndefinedRegion(regionID(x.region))
-		}
-		specializeRegion(&t)
-		if t.lang == 0 {
-			t.lang = _en // default language
-		}
-		return t, nil
-	}
-	return t, ErrMissingLikelyTagsData
-}
-
-func (t *Tag) setTagsFrom(id Tag) {
-	t.lang = id.lang
-	t.script = id.script
-	t.region = id.region
-}
-
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
-	t, err := minimizeTags(t)
-	if err != nil {
-		return t, err
-	}
-	t.remakeString()
-	return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
-	if t.equalTags(und) {
-		return t, nil
-	}
-	max, err := addTags(t)
-	if err != nil {
-		return t, err
-	}
-	for _, id := range [...]Tag{
-		{lang: t.lang},
-		{lang: t.lang, region: t.region},
-		{lang: t.lang, script: t.script},
-	} {
-		if x, err := addTags(id); err == nil && max.equalTags(x) {
-			t.setTagsFrom(id)
-			break
-		}
-	}
-	return t, nil
-}
+// func (t *Tag) setTagsFrom(id Tag) {
+// 	t.LangID = id.LangID
+// 	t.ScriptID = id.ScriptID
+// 	t.RegionID = id.RegionID
+// }
 
 // Tag Matching
 // CLDR defines an algorithm for finding the best match between two sets of language
 // tags. The basic algorithm defines how to score a possible match and then find
 // the match with the best score
-// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
+// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
 // Using scoring has several disadvantages. The scoring obfuscates the importance of
 // the various factors considered, making the algorithm harder to understand. Using
 // scoring also requires the full score to be computed for each pair of tags.
@@ -441,7 +254,7 @@ func minimizeTags(t Tag) (Tag, error) {
 type matcher struct {
 	default_         *haveTag
 	supported        []*haveTag
-	index            map[langID]*matchHeader
+	index            map[language.Language]*matchHeader
 	passSettings     bool
 	preferSameScript bool
 }
@@ -456,7 +269,7 @@ type matchHeader struct {
 // haveTag holds a supported Tag and its maximized script and region. The maximized
 // or canonicalized language is not stored as it is not needed during matching.
 type haveTag struct {
-	tag Tag
+	tag language.Tag
 
 	// index of this tag in the original list of supported tags.
 	index int
@@ -466,37 +279,37 @@ type haveTag struct {
 	conf Confidence
 
 	// Maximized region and script.
-	maxRegion regionID
-	maxScript scriptID
+	maxRegion language.Region
+	maxScript language.Script
 
 	// altScript may be checked as an alternative match to maxScript. If altScript
 	// matches, the confidence level for this match is Low. Theoretically there
 	// could be multiple alternative scripts. This does not occur in practice.
-	altScript scriptID
+	altScript language.Script
 
 	// nextMax is the index of the next haveTag with the same maximized tags.
 	nextMax uint16
 }
 
-func makeHaveTag(tag Tag, index int) (haveTag, langID) {
+func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
 	max := tag
-	if tag.lang != 0 || tag.region != 0 || tag.script != 0 {
-		max, _ = max.canonicalize(All)
-		max, _ = addTags(max)
-		max.remakeString()
+	if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+		max, _ = canonicalize(All, max)
+		max, _ = max.Maximize()
+		max.RemakeString()
 	}
-	return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
+	return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
 }
 
 // altScript returns an alternative script that may match the given script with
 // a low confidence.  At the moment, the langMatch data allows for at most one
 // script to map to another and we rely on this to keep the code simple.
-func altScript(l langID, s scriptID) scriptID {
+func altScript(l language.Language, s language.Script) language.Script {
 	for _, alt := range matchScript {
 		// TODO: also match cases where language is not the same.
-		if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) &&
-			scriptID(alt.haveScript) == s {
-			return scriptID(alt.wantScript)
+		if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
+			language.Script(alt.haveScript) == s {
+			return language.Script(alt.wantScript)
 		}
 	}
 	return 0
@@ -508,7 +321,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) {
 	h.original = h.original || exact
 	// Don't add new exact matches.
 	for _, v := range h.haveTags {
-		if v.tag.equalsRest(n.tag) {
+		if equalsRest(v.tag, n.tag) {
 			return
 		}
 	}
@@ -517,7 +330,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) {
 	for i, v := range h.haveTags {
 		if v.maxScript == n.maxScript &&
 			v.maxRegion == n.maxRegion &&
-			v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
+			v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
 			for h.haveTags[i].nextMax != 0 {
 				i = int(h.haveTags[i].nextMax)
 			}
@@ -530,7 +343,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) {
 
 // header returns the matchHeader for the given language. It creates one if
 // it doesn't already exist.
-func (m *matcher) header(l langID) *matchHeader {
+func (m *matcher) header(l language.Language) *matchHeader {
 	if h := m.index[l]; h != nil {
 		return h
 	}
@@ -554,7 +367,7 @@ func toConf(d uint8) Confidence {
 // for a given tag.
 func newMatcher(supported []Tag, options []MatchOption) *matcher {
 	m := &matcher{
-		index:            make(map[langID]*matchHeader),
+		index:            make(map[language.Language]*matchHeader),
 		preferSameScript: true,
 	}
 	for _, o := range options {
@@ -567,16 +380,18 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher {
 	// Add supported languages to the index. Add exact matches first to give
 	// them precedence.
 	for i, tag := range supported {
-		pair, _ := makeHaveTag(tag, i)
-		m.header(tag.lang).addIfNew(pair, true)
+		tt := tag.tag()
+		pair, _ := makeHaveTag(tt, i)
+		m.header(tt.LangID).addIfNew(pair, true)
 		m.supported = append(m.supported, &pair)
 	}
-	m.default_ = m.header(supported[0].lang).haveTags[0]
+	m.default_ = m.header(supported[0].lang()).haveTags[0]
 	// Keep these in two different loops to support the case that two equivalent
 	// languages are distinguished, such as iw and he.
 	for i, tag := range supported {
-		pair, max := makeHaveTag(tag, i)
-		if max != tag.lang {
+		tt := tag.tag()
+		pair, max := makeHaveTag(tt, i)
+		if max != tt.LangID {
 			m.header(max).addIfNew(pair, true)
 		}
 	}
@@ -585,11 +400,11 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher {
 	// update will only add entries to original indexes, thus not computing any
 	// transitive relations.
 	update := func(want, have uint16, conf Confidence) {
-		if hh := m.index[langID(have)]; hh != nil {
+		if hh := m.index[language.Language(have)]; hh != nil {
 			if !hh.original {
 				return
 			}
-			hw := m.header(langID(want))
+			hw := m.header(language.Language(want))
 			for _, ht := range hh.haveTags {
 				v := *ht
 				if conf < v.conf {
@@ -597,7 +412,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher {
 				}
 				v.nextMax = 0 // this value needs to be recomputed
 				if v.altScript != 0 {
-					v.altScript = altScript(langID(want), v.maxScript)
+					v.altScript = altScript(language.Language(want), v.maxScript)
 				}
 				hw.addIfNew(v, conf == Exact && hh.original)
 			}
@@ -618,66 +433,67 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher {
 	// First we match deprecated equivalents. If they are perfect equivalents
 	// (their canonicalization simply substitutes a different language code, but
 	// nothing else), the match confidence is Exact, otherwise it is High.
-	for i, lm := range langAliasMap {
+	for i, lm := range language.AliasMap {
 		// If deprecated codes match and there is no fiddling with the script or
 		// or region, we consider it an exact match.
 		conf := Exact
-		if langAliasTypes[i] != langMacro {
-			if !isExactEquivalent(langID(lm.from)) {
+		if language.AliasTypes[i] != language.Macro {
+			if !isExactEquivalent(language.Language(lm.From)) {
 				conf = High
 			}
-			update(lm.to, lm.from, conf)
+			update(lm.To, lm.From, conf)
 		}
-		update(lm.from, lm.to, conf)
+		update(lm.From, lm.To, conf)
 	}
 	return m
 }
 
 // getBest gets the best matching tag in m for any of the given tags, taking into
 // account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
 	best := bestMatch{}
-	for i, w := range want {
-		var max Tag
+	for i, ww := range want {
+		w := ww.tag()
+		var max language.Tag
 		// Check for exact match first.
-		h := m.index[w.lang]
-		if w.lang != 0 {
+		h := m.index[w.LangID]
+		if w.LangID != 0 {
 			if h == nil {
 				continue
 			}
 			// Base language is defined.
-			max, _ = w.canonicalize(Legacy | Deprecated | Macro)
+			max, _ = canonicalize(Legacy|Deprecated|Macro, w)
 			// A region that is added through canonicalization is stronger than
 			// a maximized region: set it in the original (e.g. mo -> ro-MD).
-			if w.region != max.region {
-				w.region = max.region
+			if w.RegionID != max.RegionID {
+				w.RegionID = max.RegionID
 			}
 			// TODO: should we do the same for scripts?
 			// See test case: en, sr, nl ; sh ; sr
-			max, _ = addTags(max)
+			max, _ = max.Maximize()
 		} else {
 			// Base language is not defined.
 			if h != nil {
 				for i := range h.haveTags {
 					have := h.haveTags[i]
-					if have.tag.equalsRest(w) {
+					if equalsRest(have.tag, w) {
 						return have, w, Exact
 					}
 				}
 			}
-			if w.script == 0 && w.region == 0 {
+			if w.ScriptID == 0 && w.RegionID == 0 {
 				// We skip all tags matching und for approximate matching, including
 				// private tags.
 				continue
 			}
-			max, _ = addTags(w)
-			if h = m.index[max.lang]; h == nil {
+			max, _ = w.Maximize()
+			if h = m.index[max.LangID]; h == nil {
 				continue
 			}
 		}
 		pin := true
 		for _, t := range want[i+1:] {
-			if w.lang == t.lang {
+			if w.LangID == t.lang() {
 				pin = false
 				break
 			}
@@ -685,11 +501,11 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
 		// Check for match based on maximized tag.
 		for i := range h.haveTags {
 			have := h.haveTags[i]
-			best.update(have, w, max.script, max.region, pin)
+			best.update(have, w, max.ScriptID, max.RegionID, pin)
 			if best.conf == Exact {
 				for have.nextMax != 0 {
 					have = h.haveTags[have.nextMax]
-					best.update(have, w, max.script, max.region, pin)
+					best.update(have, w, max.ScriptID, max.RegionID, pin)
 				}
 				return best.have, best.want, best.conf
 			}
@@ -697,9 +513,9 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
 	}
 	if best.conf <= No {
 		if len(want) != 0 {
-			return nil, want[0], No
+			return nil, want[0].tag(), No
 		}
-		return nil, Tag{}, No
+		return nil, language.Tag{}, No
 	}
 	return best.have, best.want, best.conf
 }
@@ -707,9 +523,9 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
 // bestMatch accumulates the best match so far.
 type bestMatch struct {
 	have            *haveTag
-	want            Tag
+	want            language.Tag
 	conf            Confidence
-	pinnedRegion    regionID
+	pinnedRegion    language.Region
 	pinLanguage     bool
 	sameRegionGroup bool
 	// Cached results from applying tie-breaking rules.
@@ -734,19 +550,19 @@ type bestMatch struct {
 // still prefer a second language over a dialect of the preferred language by
 // explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
 // be false.
-func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) {
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
 	// Bail if the maximum attainable confidence is below that of the current best match.
 	c := have.conf
 	if c < m.conf {
 		return
 	}
 	// Don't change the language once we already have found an exact match.
-	if m.pinLanguage && tag.lang != m.want.lang {
+	if m.pinLanguage && tag.LangID != m.want.LangID {
 		return
 	}
 	// Pin the region group if we are comparing tags for the same language.
-	if tag.lang == m.want.lang && m.sameRegionGroup {
-		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang)
+	if tag.LangID == m.want.LangID && m.sameRegionGroup {
+		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
 		if !sameGroup {
 			return
 		}
@@ -756,7 +572,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 		// don't pin anything, otherwise pin the language.
 		m.pinLanguage = pin
 	}
-	if have.tag.equalsRest(tag) {
+	if equalsRest(have.tag, tag) {
 	} else if have.maxScript != maxScript {
 		// There is usually very little comprehension between different scripts.
 		// In a few cases there may still be Low comprehension. This possibility
@@ -786,7 +602,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 
 	// Tie-breaker rules:
 	// We prefer if the pre-maximized language was specified and identical.
-	origLang := have.tag.lang == tag.lang && tag.lang != 0
+	origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
 	if !beaten && m.origLang != origLang {
 		if m.origLang {
 			return
@@ -795,7 +611,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 	}
 
 	// We prefer if the pre-maximized region was specified and identical.
-	origReg := have.tag.region == tag.region && tag.region != 0
+	origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
 	if !beaten && m.origReg != origReg {
 		if m.origReg {
 			return
@@ -803,7 +619,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 		beaten = true
 	}
 
-	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang)
+	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
 	if !beaten && m.regGroupDist != regGroupDist {
 		if regGroupDist > m.regGroupDist {
 			return
@@ -811,7 +627,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 		beaten = true
 	}
 
-	paradigmReg := isParadigmLocale(tag.lang, have.maxRegion)
+	paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
 	if !beaten && m.paradigmReg != paradigmReg {
 		if !paradigmReg {
 			return
@@ -820,7 +636,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 	}
 
 	// Next we prefer if the pre-maximized script was specified and identical.
-	origScript := have.tag.script == tag.script && tag.script != 0
+	origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
 	if !beaten && m.origScript != origScript {
 		if m.origScript {
 			return
@@ -843,9 +659,9 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion
 	}
 }
 
-func isParadigmLocale(lang langID, r regionID) bool {
+func isParadigmLocale(lang language.Language, r language.Region) bool {
 	for _, e := range paradigmLocales {
-		if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) {
+		if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
 			return true
 		}
 	}
@@ -854,13 +670,13 @@ func isParadigmLocale(lang langID, r regionID) bool {
 
 // regionGroupDist computes the distance between two regions based on their
 // CLDR grouping.
-func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) {
+func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
 	const defaultDistance = 4
 
 	aGroup := uint(regionToGroups[a]) << 1
 	bGroup := uint(regionToGroups[b]) << 1
 	for _, ri := range matchRegion {
-		if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) {
+		if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
 			group := uint(1 << (ri.group &^ 0x80))
 			if 0x80&ri.group == 0 {
 				if aGroup&bGroup&group != 0 { // Both regions are in the group.
@@ -876,31 +692,16 @@ func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, s
 	return defaultDistance, true
 }
 
-func (t Tag) variants() string {
-	if t.pVariant == 0 {
-		return ""
-	}
-	return t.str[t.pVariant:t.pExt]
-}
-
-// variantOrPrivateTagStr returns variants or private use tags.
-func (t Tag) variantOrPrivateTagStr() string {
-	if t.pExt > 0 {
-		return t.str[t.pVariant:t.pExt]
-	}
-	return t.str[t.pVariant:]
-}
-
 // equalsRest compares everything except the language.
-func (a Tag) equalsRest(b Tag) bool {
+func equalsRest(a, b language.Tag) bool {
 	// TODO: don't include extensions in this comparison. To do this efficiently,
 	// though, we should handle private tags separately.
-	return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
+	return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
 }
 
 // isExactEquivalent returns true if canonicalizing the language will not alter
 // the script or region of a tag.
-func isExactEquivalent(l langID) bool {
+func isExactEquivalent(l language.Language) bool {
 	for _, o := range notEquivalent {
 		if o == l {
 			return false
@@ -909,25 +710,26 @@ func isExactEquivalent(l langID) bool {
 	return true
 }
 
-var notEquivalent []langID
+var notEquivalent []language.Language
 
 func init() {
 	// Create a list of all languages for which canonicalization may alter the
 	// script or region.
-	for _, lm := range langAliasMap {
-		tag := Tag{lang: langID(lm.from)}
-		if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
-			notEquivalent = append(notEquivalent, langID(lm.from))
+	for _, lm := range language.AliasMap {
+		tag := language.Tag{LangID: language.Language(lm.From)}
+		if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+			notEquivalent = append(notEquivalent, language.Language(lm.From))
 		}
 	}
 	// Maximize undefined regions of paradigm locales.
 	for i, v := range paradigmLocales {
-		max, _ := addTags(Tag{lang: langID(v[0])})
+		t := language.Tag{LangID: language.Language(v[0])}
+		max, _ := t.Maximize()
 		if v[1] == 0 {
-			paradigmLocales[i][1] = uint16(max.region)
+			paradigmLocales[i][1] = uint16(max.RegionID)
 		}
 		if v[2] == 0 {
-			paradigmLocales[i][2] = uint16(max.region)
+			paradigmLocales[i][2] = uint16(max.RegionID)
 		}
 	}
 }
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
index fca2d30..11acfd8 100644
--- a/vendor/golang.org/x/text/language/parse.go
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -5,216 +5,21 @@
 package language
 
 import (
-	"bytes"
 	"errors"
-	"fmt"
-	"sort"
 	"strconv"
 	"strings"
 
-	"golang.org/x/text/internal/tag"
+	"golang.org/x/text/internal/language"
 )
 
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
-	return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
-	for _, c := range s {
-		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
-			return false
-		}
-	}
-	return true
-}
-
-// errSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var errSyntax = errors.New("language: tag is not well-formed")
-
 // ValueError is returned by any of the parsing functions when the
 // input is well-formed but the respective subtag is not recognized
 // as a valid value.
-type ValueError struct {
-	v [8]byte
-}
-
-func mkErrInvalid(s []byte) error {
-	var e ValueError
-	copy(e.v[:], s)
-	return e
-}
-
-func (e ValueError) tag() []byte {
-	n := bytes.IndexByte(e.v[:], 0)
-	if n == -1 {
-		n = 8
-	}
-	return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
-	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
-	return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
-	b     []byte
-	bytes [max99thPercentileSize]byte
-	token []byte
-	start int // start position of the current token
-	end   int // end position of the current token
-	next  int // next point for scan
-	err   error
-	done  bool
-}
-
-func makeScannerString(s string) scanner {
-	scan := scanner{}
-	if len(s) <= len(scan.bytes) {
-		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
-	} else {
-		scan.b = []byte(s)
-	}
-	scan.init()
-	return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
-	scan := scanner{b: b}
-	scan.init()
-	return scan
-}
-
-func (s *scanner) init() {
-	for i, c := range s.b {
-		if c == '_' {
-			s.b[i] = '-'
-		}
-	}
-	s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
-	for i := start; i < end; i++ {
-		c := s.b[i]
-		if 'A' <= c && c <= 'Z' {
-			s.b[i] += 'a' - 'A'
-		}
-	}
-}
+type ValueError interface {
+	error
 
-func (s *scanner) setError(e error) {
-	if s.err == nil || (e == errSyntax && s.err != errSyntax) {
-		s.err = e
-	}
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
-	s.start = oldStart
-	if end := oldStart + newSize; end != oldEnd {
-		diff := end - oldEnd
-		if end < cap(s.b) {
-			b := make([]byte, len(s.b)+diff)
-			copy(b, s.b[:oldStart])
-			copy(b[end:], s.b[oldEnd:])
-			s.b = b
-		} else {
-			s.b = append(s.b[end:], s.b[oldEnd:]...)
-		}
-		s.next = end + (s.next - s.end)
-		s.end = end
-	}
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
-	s.resizeRange(s.start, s.end, len(repl))
-	copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
-	s.setError(e)
-	if s.start == 0 {
-		s.b = s.b[:+copy(s.b, s.b[s.next:])]
-		s.end = 0
-	} else {
-		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
-		s.end = s.start - 1
-	}
-	s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
-	s.setError(errSyntax)
-	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
-	diff := end - start
-	s.next -= diff
-	s.start -= diff
-	s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string.  Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
-	end = s.end
-	s.token = nil
-	for s.start = s.next; s.next < len(s.b); {
-		i := bytes.IndexByte(s.b[s.next:], '-')
-		if i == -1 {
-			s.end = len(s.b)
-			s.next = len(s.b)
-			i = s.end - s.start
-		} else {
-			s.end = s.next + i
-			s.next = s.end + 1
-		}
-		token := s.b[s.start:s.end]
-		if i < 1 || i > 8 || !isAlphaNum(token) {
-			s.gobble(errSyntax)
-			continue
-		}
-		s.token = token
-		return end
-	}
-	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
-		s.setError(errSyntax)
-		s.b = s.b[:len(s.b)-1]
-	}
-	s.done = true
-	return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
-	end = s.end
-	s.scan()
-	for ; len(s.token) >= min; s.scan() {
-		end = s.end
-	}
-	return end
+	// Subtag returns the subtag for which the error occurred.
+	Subtag() string
 }
 
 // Parse parses the given BCP 47 string and returns a valid Tag. If parsing
@@ -223,7 +28,7 @@ func (s *scanner) acceptMinSize(min int) (end int) {
 // ValueError. The Tag returned in this case is just stripped of the unknown
 // value. All other values are preserved. It accepts tags in the BCP 47 format
 // and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
 // The resulting tag is canonicalized using the default canonicalization type.
 func Parse(s string) (t Tag, err error) {
 	return Default.Parse(s)
@@ -235,327 +40,18 @@ func Parse(s string) (t Tag, err error) {
 // ValueError. The Tag returned in this case is just stripped of the unknown
 // value. All other values are preserved. It accepts tags in the BCP 47 format
 // and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the the canonicalization type c.
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the canonicalization type c.
 func (c CanonType) Parse(s string) (t Tag, err error) {
-	// TODO: consider supporting old-style locale key-value pairs.
-	if s == "" {
-		return und, errSyntax
-	}
-	if len(s) <= maxAltTaglen {
-		b := [maxAltTaglen]byte{}
-		for i, c := range s {
-			// Generating invalid UTF-8 is okay as it won't match.
-			if 'A' <= c && c <= 'Z' {
-				c += 'a' - 'A'
-			} else if c == '_' {
-				c = '-'
-			}
-			b[i] = byte(c)
-		}
-		if t, ok := grandfathered(b); ok {
-			return t, nil
-		}
+	tt, err := language.Parse(s)
+	if err != nil {
+		return makeTag(tt), err
 	}
-	scan := makeScannerString(s)
-	t, err = parse(&scan, s)
-	t, changed := t.canonicalize(c)
+	tt, changed := canonicalize(c, tt)
 	if changed {
-		t.remakeString()
-	}
-	return t, err
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
-	t = und
-	var end int
-	if n := len(scan.token); n <= 1 {
-		scan.toLower(0, len(scan.b))
-		if n == 0 || scan.token[0] != 'x' {
-			return t, errSyntax
-		}
-		end = parseExtensions(scan)
-	} else if n >= 4 {
-		return und, errSyntax
-	} else { // the usual case
-		t, end = parseTag(scan)
-		if n := len(scan.token); n == 1 {
-			t.pExt = uint16(end)
-			end = parseExtensions(scan)
-		} else if end < len(scan.b) {
-			scan.setError(errSyntax)
-			scan.b = scan.b[:end]
-		}
-	}
-	if int(t.pVariant) < len(scan.b) {
-		if end < len(s) {
-			s = s[:end]
-		}
-		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
-			t.str = s
-		} else {
-			t.str = string(scan.b)
-		}
-	} else {
-		t.pVariant, t.pExt = 0, 0
-	}
-	return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
-	var e error
-	// TODO: set an error if an unknown lang, script or region is encountered.
-	t.lang, e = getLangID(scan.token)
-	scan.setError(e)
-	scan.replace(t.lang.String())
-	langStart := scan.start
-	end = scan.scan()
-	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
-		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
-		// to a tag of the form <extlang>.
-		lang, e := getLangID(scan.token)
-		if lang != 0 {
-			t.lang = lang
-			copy(scan.b[langStart:], lang.String())
-			scan.b[langStart+3] = '-'
-			scan.start = langStart + 4
-		}
-		scan.gobble(e)
-		end = scan.scan()
-	}
-	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
-		t.script, e = getScriptID(script, scan.token)
-		if t.script == 0 {
-			scan.gobble(e)
-		}
-		end = scan.scan()
-	}
-	if n := len(scan.token); n >= 2 && n <= 3 {
-		t.region, e = getRegionID(scan.token)
-		if t.region == 0 {
-			scan.gobble(e)
-		} else {
-			scan.replace(t.region.String())
-		}
-		end = scan.scan()
-	}
-	scan.toLower(scan.start, len(scan.b))
-	t.pVariant = byte(end)
-	end = parseVariants(scan, end, t)
-	t.pExt = uint16(end)
-	return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
-	start := scan.start
-	varIDBuf := [4]uint8{}
-	variantBuf := [4][]byte{}
-	varID := varIDBuf[:0]
-	variant := variantBuf[:0]
-	last := -1
-	needSort := false
-	for ; len(scan.token) >= 4; scan.scan() {
-		// TODO: measure the impact of needing this conversion and redesign
-		// the data structure if there is an issue.
-		v, ok := variantIndex[string(scan.token)]
-		if !ok {
-			// unknown variant
-			// TODO: allow user-defined variants?
-			scan.gobble(mkErrInvalid(scan.token))
-			continue
-		}
-		varID = append(varID, v)
-		variant = append(variant, scan.token)
-		if !needSort {
-			if last < int(v) {
-				last = int(v)
-			} else {
-				needSort = true
-				// There is no legal combinations of more than 7 variants
-				// (and this is by no means a useful sequence).
-				const maxVariants = 8
-				if len(varID) > maxVariants {
-					break
-				}
-			}
-		}
-		end = scan.end
-	}
-	if needSort {
-		sort.Sort(variantsSort{varID, variant})
-		k, l := 0, -1
-		for i, v := range varID {
-			w := int(v)
-			if l == w {
-				// Remove duplicates.
-				continue
-			}
-			varID[k] = varID[i]
-			variant[k] = variant[i]
-			k++
-			l = w
-		}
-		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
-			end = start - 1
-		} else {
-			scan.resizeRange(start, end, len(str))
-			copy(scan.b[scan.start:], str)
-			end = scan.end
-		}
-	}
-	return end
-}
-
-type variantsSort struct {
-	i []uint8
-	v [][]byte
-}
-
-func (s variantsSort) Len() int {
-	return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
-	s.i[i], s.i[j] = s.i[j], s.i[i]
-	s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
-	return s.i[i] < s.i[j]
-}
-
-type bytesSort [][]byte
-
-func (b bytesSort) Len() int {
-	return len(b)
-}
-
-func (b bytesSort) Swap(i, j int) {
-	b[i], b[j] = b[j], b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
-	return bytes.Compare(b[i], b[j]) == -1
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
-	start := scan.start
-	exts := [][]byte{}
-	private := []byte{}
-	end := scan.end
-	for len(scan.token) == 1 {
-		extStart := scan.start
-		ext := scan.token[0]
-		end = parseExtension(scan)
-		extension := scan.b[extStart:end]
-		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
-			scan.setError(errSyntax)
-			end = extStart
-			continue
-		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
-			scan.b = scan.b[:end]
-			return end
-		} else if ext == 'x' {
-			private = extension
-			break
-		}
-		exts = append(exts, extension)
+		tt.RemakeString()
 	}
-	sort.Sort(bytesSort(exts))
-	if len(private) > 0 {
-		exts = append(exts, private)
-	}
-	scan.b = scan.b[:start]
-	if len(exts) > 0 {
-		scan.b = append(scan.b, bytes.Join(exts, separator)...)
-	} else if start > 0 {
-		// Strip trailing '-'.
-		scan.b = scan.b[:start-1]
-	}
-	return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
-	start, end := scan.start, scan.end
-	switch scan.token[0] {
-	case 'u':
-		attrStart := end
-		scan.scan()
-		for last := []byte{}; len(scan.token) > 2; scan.scan() {
-			if bytes.Compare(scan.token, last) != -1 {
-				// Attributes are unsorted. Start over from scratch.
-				p := attrStart + 1
-				scan.next = p
-				attrs := [][]byte{}
-				for scan.scan(); len(scan.token) > 2; scan.scan() {
-					attrs = append(attrs, scan.token)
-					end = scan.end
-				}
-				sort.Sort(bytesSort(attrs))
-				copy(scan.b[p:], bytes.Join(attrs, separator))
-				break
-			}
-			last = scan.token
-			end = scan.end
-		}
-		var last, key []byte
-		for attrEnd := end; len(scan.token) == 2; last = key {
-			key = scan.token
-			keyEnd := scan.end
-			end = scan.acceptMinSize(3)
-			// TODO: check key value validity
-			if keyEnd == end || bytes.Compare(key, last) != 1 {
-				// We have an invalid key or the keys are not sorted.
-				// Start scanning keys from scratch and reorder.
-				p := attrEnd + 1
-				scan.next = p
-				keys := [][]byte{}
-				for scan.scan(); len(scan.token) == 2; {
-					keyStart, keyEnd := scan.start, scan.end
-					end = scan.acceptMinSize(3)
-					if keyEnd != end {
-						keys = append(keys, scan.b[keyStart:end])
-					} else {
-						scan.setError(errSyntax)
-						end = keyStart
-					}
-				}
-				sort.Sort(bytesSort(keys))
-				reordered := bytes.Join(keys, separator)
-				if e := p + len(reordered); e < end {
-					scan.deleteRange(e, end)
-					end = e
-				}
-				copy(scan.b[p:], bytes.Join(keys, separator))
-				break
-			}
-		}
-	case 't':
-		scan.scan()
-		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
-			_, end = parseTag(scan)
-			scan.toLower(start, end)
-		}
-		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
-			end = scan.acceptMinSize(3)
-		}
-	case 'x':
-		end = scan.acceptMinSize(1)
-	default:
-		end = scan.acceptMinSize(2)
-	}
-	return end
+	return makeTag(tt), err
 }
 
 // Compose creates a Tag from individual parts, which may be of type Tag, Base,
@@ -563,10 +59,11 @@ func parseExtension(scan *scanner) int {
 // Base, Script or Region or slice of type Variant or Extension is passed more
 // than once, the latter will overwrite the former. Variants and Extensions are
 // accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using the Default CanonType. If one or more errors are
-// encountered, one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using the Default CanonType. If one or
+// more errors are encountered, one of the errors is returned.
 func Compose(part ...interface{}) (t Tag, err error) {
 	return Default.Compose(part...)
 }
@@ -576,191 +73,63 @@ func Compose(part ...interface{}) (t Tag, err error) {
 // Base, Script or Region or slice of type Variant or Extension is passed more
 // than once, the latter will overwrite the former. Variants and Extensions are
 // accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using CanonType c. If one or more errors are encountered,
-// one of the errors is returned.
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using CanonType c. If one or more errors
+// are encountered, one of the errors is returned.
 func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
-	var b builder
-	if err = b.update(part...); err != nil {
+	var b language.Builder
+	if err = update(&b, part...); err != nil {
 		return und, err
 	}
-	t, _ = b.tag.canonicalize(c)
-
-	if len(b.ext) > 0 || len(b.variant) > 0 {
-		sort.Sort(sortVariant(b.variant))
-		sort.Strings(b.ext)
-		if b.private != "" {
-			b.ext = append(b.ext, b.private)
-		}
-		n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
-		buf := make([]byte, n)
-		p := t.genCoreBytes(buf)
-		t.pVariant = byte(p)
-		p += appendTokens(buf[p:], b.variant...)
-		t.pExt = uint16(p)
-		p += appendTokens(buf[p:], b.ext...)
-		t.str = string(buf[:p])
-	} else if b.private != "" {
-		t.str = b.private
-		t.remakeString()
-	}
-	return
-}
-
-type builder struct {
-	tag Tag
-
-	private string // the x extension
-	ext     []string
-	variant []string
-
-	err error
-}
-
-func (b *builder) addExt(e string) {
-	if e == "" {
-	} else if e[0] == 'x' {
-		b.private = e
-	} else {
-		b.ext = append(b.ext, e)
-	}
+	b.Tag, _ = canonicalize(c, b.Tag)
+	return makeTag(b.Make()), err
 }
 
 var errInvalidArgument = errors.New("invalid Extension or Variant")
 
-func (b *builder) update(part ...interface{}) (err error) {
-	replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
-		if s == "" {
-			b.err = errInvalidArgument
-			return true
-		}
-		for i, v := range *l {
-			if eq(v, s) {
-				(*l)[i] = s
-				return true
-			}
-		}
-		return false
-	}
+func update(b *language.Builder, part ...interface{}) (err error) {
 	for _, x := range part {
 		switch v := x.(type) {
 		case Tag:
-			b.tag.lang = v.lang
-			b.tag.region = v.region
-			b.tag.script = v.script
-			if v.str != "" {
-				b.variant = nil
-				for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
-					x, s = nextToken(s)
-					b.variant = append(b.variant, x)
-				}
-				b.ext, b.private = nil, ""
-				for i, e := int(v.pExt), ""; i < len(v.str); {
-					i, e = getExtension(v.str, i)
-					b.addExt(e)
-				}
-			}
+			b.SetTag(v.tag())
 		case Base:
-			b.tag.lang = v.langID
+			b.Tag.LangID = v.langID
 		case Script:
-			b.tag.script = v.scriptID
+			b.Tag.ScriptID = v.scriptID
 		case Region:
-			b.tag.region = v.regionID
+			b.Tag.RegionID = v.regionID
 		case Variant:
-			if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
-				b.variant = append(b.variant, v.variant)
+			if v.variant == "" {
+				err = errInvalidArgument
+				break
 			}
+			b.AddVariant(v.variant)
 		case Extension:
-			if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
-				b.addExt(v.s)
+			if v.s == "" {
+				err = errInvalidArgument
+				break
 			}
+			b.SetExt(v.s)
 		case []Variant:
-			b.variant = nil
-			for _, x := range v {
-				b.update(x)
+			b.ClearVariants()
+			for _, v := range v {
+				b.AddVariant(v.variant)
 			}
 		case []Extension:
-			b.ext, b.private = nil, ""
+			b.ClearExtensions()
 			for _, e := range v {
-				b.update(e)
+				b.SetExt(e.s)
 			}
 		// TODO: support parsing of raw strings based on morphology or just extensions?
 		case error:
-			err = v
-		}
-	}
-	return
-}
-
-func tokenLen(token ...string) (n int) {
-	for _, t := range token {
-		n += len(t) + 1
-	}
-	return
-}
-
-func appendTokens(b []byte, token ...string) int {
-	p := 0
-	for _, t := range token {
-		b[p] = '-'
-		copy(b[p+1:], t)
-		p += 1 + len(t)
-	}
-	return p
-}
-
-type sortVariant []string
-
-func (s sortVariant) Len() int {
-	return len(s)
-}
-
-func (s sortVariant) Swap(i, j int) {
-	s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariant) Less(i, j int) bool {
-	return variantIndex[s[i]] < variantIndex[s[j]]
-}
-
-func findExt(list []string, x byte) int {
-	for i, e := range list {
-		if e[0] == x {
-			return i
-		}
-	}
-	return -1
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
-	if s[p] == '-' {
-		p++
-	}
-	if s[p] == 'x' {
-		return len(s), s[p:]
-	}
-	end = nextExtension(s, p)
-	return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
-	for n := len(s) - 3; p < n; {
-		if s[p] == '-' {
-			if s[p+2] == '-' {
-				return p
+			if v != nil {
+				err = v
 			}
-			p += 3
-		} else {
-			p++
 		}
 	}
-	return len(s)
+	return
 }
 
 var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
@@ -788,7 +157,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
 			if !ok {
 				return nil, nil, err
 			}
-			t = Tag{lang: id}
+			t = makeTag(language.Tag{LangID: id})
 		}
 
 		// Scan the optional weight.
@@ -830,9 +199,9 @@ func split(s string, c byte) (head, tail string) {
 	return strings.TrimSpace(s), ""
 }
 
-// Add hack mapping to deal with a small number of cases that that occur
+// Add hack mapping to deal with a small number of cases that occur
 // in Accept-Language (with reasonable frequency).
-var acceptFallback = map[string]langID{
+var acceptFallback = map[string]language.Language{
 	"english": _en,
 	"deutsch": _de,
 	"italian": _it,
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
index b738d45..e228077 100644
--- a/vendor/golang.org/x/text/language/tables.go
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -2,997 +2,22 @@
 
 package language
 
-import "golang.org/x/text/internal/tag"
-
 // CLDRVersion is the CLDR version from which the tables in this package are derived.
 const CLDRVersion = "32"
 
-const numLanguages = 8665
-
-const numScripts = 242
-
-const numRegions = 357
-
-type fromTo struct {
-	from uint16
-	to   uint16
-}
-
-const nonCanonicalUnd = 1201
 const (
-	_af  = 22
-	_am  = 39
-	_ar  = 58
-	_az  = 88
-	_bg  = 126
-	_bn  = 165
-	_ca  = 215
-	_cs  = 250
-	_da  = 257
 	_de  = 269
-	_el  = 310
 	_en  = 313
-	_es  = 318
-	_et  = 320
-	_fa  = 328
-	_fi  = 337
-	_fil = 339
 	_fr  = 350
-	_gu  = 420
-	_he  = 444
-	_hi  = 446
-	_hr  = 465
-	_hu  = 469
-	_hy  = 471
-	_id  = 481
-	_is  = 504
 	_it  = 505
-	_ja  = 512
-	_ka  = 528
-	_kk  = 578
-	_km  = 586
-	_kn  = 593
-	_ko  = 596
-	_ky  = 650
-	_lo  = 696
-	_lt  = 704
-	_lv  = 711
-	_mk  = 767
-	_ml  = 772
-	_mn  = 779
 	_mo  = 784
-	_mr  = 795
-	_ms  = 799
-	_mul = 806
-	_my  = 817
-	_nb  = 839
-	_ne  = 849
-	_nl  = 871
 	_no  = 879
-	_pa  = 925
-	_pl  = 947
+	_nb  = 839
 	_pt  = 960
-	_ro  = 988
-	_ru  = 994
 	_sh  = 1031
-	_si  = 1036
-	_sk  = 1042
-	_sl  = 1046
-	_sq  = 1073
-	_sr  = 1074
-	_sv  = 1092
-	_sw  = 1093
-	_ta  = 1104
-	_te  = 1121
-	_th  = 1131
-	_tl  = 1146
-	_tn  = 1152
-	_tr  = 1162
-	_uk  = 1198
-	_ur  = 1204
-	_uz  = 1212
-	_vi  = 1219
-	_zh  = 1321
-	_zu  = 1327
-	_jbo = 515
-	_ami = 1650
-	_bnn = 2357
-	_hak = 438
-	_tlh = 14467
-	_lb  = 661
-	_nv  = 899
-	_pwn = 12055
-	_tao = 14188
-	_tay = 14198
-	_tsu = 14662
-	_nn  = 874
-	_sfb = 13629
-	_vgt = 15701
-	_sgg = 13660
-	_cmn = 3007
-	_nan = 835
-	_hsn = 467
-)
-
-const langPrivateStart = 0x2f72
-
-const langPrivateEnd = 0x3179
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-//     - if the first letter of the 2- and 3-letter ISO codes are the same:
-//       the second and third letter of the 3-letter ISO code.
-//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5324 bytes
-	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
-	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
-	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
-	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
-	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
-	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
-	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
-	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
-	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
-	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
-	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
-	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
-	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
-	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
-	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
-	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
-	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
-	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
-	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
-	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
-	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
-	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
-	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
-	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
-	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
-	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
-	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
-	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
-	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
-	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
-	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
-	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
-	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
-	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
-	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
-	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
-	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
-	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
-	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
-	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
-	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
-	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
-	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
-	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
-	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
-	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
-	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
-	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
-	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
-	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
-	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
-	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
-	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
-	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
-	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
-	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
-	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
-	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
-	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
-	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
-	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
-	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
-	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
-	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
-	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
-	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
-	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
-	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
-	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
-	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
-	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
-	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
-	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
-	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
-	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
-	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
-	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
-	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
-	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
-	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
-	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
-	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
-	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
-	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
-	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
-	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
-	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
-	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
-	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
-	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
-	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
-	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
-	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
-	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
-	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
-	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
-	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
-	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
-	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
-	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
-	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
-	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
-	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
-	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
-	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
-	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
-	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
-	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
-	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
-	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
-	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
-	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
-	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
-	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
-	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
-	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
-	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
-	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
-	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
-	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
-	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
-	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
-	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
-	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1330
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
-	// Entry 0 - 3F
-	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
-	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
-	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
-	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
-	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
-	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
-	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
-	// Entry 40 - 7F
-	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
-	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
-	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
-	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
-	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
-	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
-	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
-	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
-	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
-	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
-	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
-	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
-	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
-	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
-	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
-	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
-	// Entry C0 - FF
-	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
-	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
-	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
-	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
-	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
-	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
-	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
-	// Entry 100 - 13F
-	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
-	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
-	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
-	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
-	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
-	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
-	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
-	// Entry 140 - 17F
-	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
-	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
-	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
-	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
-	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
-	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
-	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
-	// Entry 180 - 1BF
-	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
-	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
-	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
-	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
-	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
-	// Entry 200 - 23F
-	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
-	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
-	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
-	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
-	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
-	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
-	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
-	// Entry 240 - 27F
-	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
-	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
-	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
-	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
-	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
-	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
-	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
-	// Entry 280 - 2BF
-	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
-	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
-	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
-	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
-	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
-	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
-	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
-	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
-	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
-	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
-	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
-	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
-	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
-	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
-	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
-	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
-	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
-	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
-	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
-	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
-	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
-	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
-	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
-	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
-	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
-	// Entry 380 - 3BF
-	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
-	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
-	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
-	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
-	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
-	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
-	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
-	// Entry 3C0 - 3FF
-	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
-	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
-	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
-	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
-	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
-	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
-	// Entry 400 - 43F
-	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
-	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
-	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
-	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
-	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
-	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
-	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
-	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
-	// Entry 440 - 47F
-	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
-	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
-	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
-	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
-	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
-	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
-	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
-	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
-	// Entry 480 - 4BF
-	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
-	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
-	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
-	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
-	// Entry 4C0 - 4FF
-	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
-	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
-	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
-	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
-	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
-	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
-	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
-	// Entry 500 - 53F
-	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
-	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
-	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
-	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
-	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
-	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
-	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
-	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	// Entry 580 - 5BF
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
-	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
-	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
-	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
-	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
-	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
-	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
-	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
-	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
-	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
-	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
-	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
-	// Entry 600 - 63F
-	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
-	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
-	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
-	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
-	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
-	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
-	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
-	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
-	// Entry 640 - 67F
-	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
-	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
-	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
-	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
-	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
-	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
-	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
-	// Entry 680 - 6BF
-	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
-	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
-	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
-	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
-	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
-	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
-	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
-	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
-	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
-	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
-	// Entry 700 - 73F
-	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
-	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
-	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
-	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 740 - 77F
-	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
-	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
-	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
-	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
-	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
-	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
-	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
-	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
-	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
-	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
-	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
-	// Entry 7C0 - 7FF
-	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
-	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
-	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
-	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
-	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
-	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
-	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
-	// Entry 800 - 83F
-	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
-	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
-	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
-	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
-	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
-	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
-	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
-	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
-	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
-	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
-	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
-	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
-	// Entry 880 - 8BF
-	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
-	0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
-	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
-}
-
-// langAliasMap maps langIDs to their suggested replacements.
-// Size: 656 bytes, 164 elements
-var langAliasMap = [164]fromTo{
-	0:   {from: 0x82, to: 0x88},
-	1:   {from: 0x187, to: 0x1ae},
-	2:   {from: 0x1f3, to: 0x1e1},
-	3:   {from: 0x1fb, to: 0x1bc},
-	4:   {from: 0x208, to: 0x512},
-	5:   {from: 0x20f, to: 0x20e},
-	6:   {from: 0x310, to: 0x3dc},
-	7:   {from: 0x347, to: 0x36f},
-	8:   {from: 0x407, to: 0x432},
-	9:   {from: 0x47a, to: 0x153},
-	10:  {from: 0x490, to: 0x451},
-	11:  {from: 0x4a2, to: 0x21},
-	12:  {from: 0x53e, to: 0x544},
-	13:  {from: 0x58f, to: 0x12d},
-	14:  {from: 0x630, to: 0x1eb1},
-	15:  {from: 0x651, to: 0x431},
-	16:  {from: 0x662, to: 0x431},
-	17:  {from: 0x6ed, to: 0x3a},
-	18:  {from: 0x6f8, to: 0x1d7},
-	19:  {from: 0x73e, to: 0x21a1},
-	20:  {from: 0x7b3, to: 0x56},
-	21:  {from: 0x7b9, to: 0x299b},
-	22:  {from: 0x7c5, to: 0x58},
-	23:  {from: 0x7e6, to: 0x145},
-	24:  {from: 0x80c, to: 0x5a},
-	25:  {from: 0x815, to: 0x8d},
-	26:  {from: 0x87e, to: 0x810},
-	27:  {from: 0x8c3, to: 0xee3},
-	28:  {from: 0x9ef, to: 0x331},
-	29:  {from: 0xa36, to: 0x2c5},
-	30:  {from: 0xa3d, to: 0xbf},
-	31:  {from: 0xabe, to: 0x3322},
-	32:  {from: 0xb38, to: 0x529},
-	33:  {from: 0xb75, to: 0x265a},
-	34:  {from: 0xb7e, to: 0xbc3},
-	35:  {from: 0xb9b, to: 0x44e},
-	36:  {from: 0xbbc, to: 0x4229},
-	37:  {from: 0xbbf, to: 0x529},
-	38:  {from: 0xbfe, to: 0x2da7},
-	39:  {from: 0xc2e, to: 0x3181},
-	40:  {from: 0xcb9, to: 0xf3},
-	41:  {from: 0xd08, to: 0xfa},
-	42:  {from: 0xdc8, to: 0x11a},
-	43:  {from: 0xdd7, to: 0x32d},
-	44:  {from: 0xdf8, to: 0xdfb},
-	45:  {from: 0xdfe, to: 0x531},
-	46:  {from: 0xedf, to: 0x205a},
-	47:  {from: 0xeee, to: 0x2e9a},
-	48:  {from: 0xf39, to: 0x367},
-	49:  {from: 0x10d0, to: 0x140},
-	50:  {from: 0x1104, to: 0x2d0},
-	51:  {from: 0x11a0, to: 0x1ec},
-	52:  {from: 0x1279, to: 0x21},
-	53:  {from: 0x1424, to: 0x15e},
-	54:  {from: 0x1470, to: 0x14e},
-	55:  {from: 0x151f, to: 0xd9b},
-	56:  {from: 0x1523, to: 0x390},
-	57:  {from: 0x1532, to: 0x19f},
-	58:  {from: 0x1580, to: 0x210},
-	59:  {from: 0x1583, to: 0x10d},
-	60:  {from: 0x15a3, to: 0x3caf},
-	61:  {from: 0x166a, to: 0x19b},
-	62:  {from: 0x16c8, to: 0x136},
-	63:  {from: 0x1700, to: 0x29f8},
-	64:  {from: 0x1718, to: 0x194},
-	65:  {from: 0x1727, to: 0xf3f},
-	66:  {from: 0x177a, to: 0x178},
-	67:  {from: 0x1809, to: 0x17b6},
-	68:  {from: 0x1816, to: 0x18f3},
-	69:  {from: 0x188a, to: 0x436},
-	70:  {from: 0x1979, to: 0x1d01},
-	71:  {from: 0x1a74, to: 0x2bb0},
-	72:  {from: 0x1a8a, to: 0x1f8},
-	73:  {from: 0x1b5a, to: 0x1fa},
-	74:  {from: 0x1b86, to: 0x1515},
-	75:  {from: 0x1d64, to: 0x2c9b},
-	76:  {from: 0x2038, to: 0x37b1},
-	77:  {from: 0x203d, to: 0x20dd},
-	78:  {from: 0x205a, to: 0x30b},
-	79:  {from: 0x20e3, to: 0x274},
-	80:  {from: 0x20ee, to: 0x263},
-	81:  {from: 0x20f2, to: 0x22d},
-	82:  {from: 0x20f9, to: 0x256},
-	83:  {from: 0x210f, to: 0x21eb},
-	84:  {from: 0x2135, to: 0x27d},
-	85:  {from: 0x2160, to: 0x913},
-	86:  {from: 0x2199, to: 0x121},
-	87:  {from: 0x21ce, to: 0x1561},
-	88:  {from: 0x21e6, to: 0x504},
-	89:  {from: 0x21f4, to: 0x49f},
-	90:  {from: 0x222d, to: 0x121},
-	91:  {from: 0x2237, to: 0x121},
-	92:  {from: 0x2262, to: 0x92a},
-	93:  {from: 0x2316, to: 0x3226},
-	94:  {from: 0x2382, to: 0x3365},
-	95:  {from: 0x2472, to: 0x2c7},
-	96:  {from: 0x24e4, to: 0x2ff},
-	97:  {from: 0x24f0, to: 0x2fa},
-	98:  {from: 0x24fa, to: 0x31f},
-	99:  {from: 0x2550, to: 0xb5b},
-	100: {from: 0x25a9, to: 0xe2},
-	101: {from: 0x263e, to: 0x2d0},
-	102: {from: 0x26c9, to: 0x26b4},
-	103: {from: 0x26f9, to: 0x3c8},
-	104: {from: 0x2727, to: 0x3caf},
-	105: {from: 0x2765, to: 0x26b4},
-	106: {from: 0x2789, to: 0x4358},
-	107: {from: 0x28ef, to: 0x2837},
-	108: {from: 0x2914, to: 0x351},
-	109: {from: 0x2986, to: 0x2da7},
-	110: {from: 0x2b1a, to: 0x38d},
-	111: {from: 0x2bfc, to: 0x395},
-	112: {from: 0x2c3f, to: 0x3caf},
-	113: {from: 0x2cfc, to: 0x3be},
-	114: {from: 0x2d13, to: 0x597},
-	115: {from: 0x2d47, to: 0x148},
-	116: {from: 0x2d48, to: 0x148},
-	117: {from: 0x2dff, to: 0x2f1},
-	118: {from: 0x2e08, to: 0x19cc},
-	119: {from: 0x2e1a, to: 0x2d95},
-	120: {from: 0x2e21, to: 0x292},
-	121: {from: 0x2e54, to: 0x7d},
-	122: {from: 0x2e65, to: 0x2282},
-	123: {from: 0x2ea0, to: 0x2e9b},
-	124: {from: 0x2eef, to: 0x2ed7},
-	125: {from: 0x3193, to: 0x3c4},
-	126: {from: 0x3366, to: 0x338e},
-	127: {from: 0x342a, to: 0x3dc},
-	128: {from: 0x34ee, to: 0x18d0},
-	129: {from: 0x35c8, to: 0x2c9b},
-	130: {from: 0x35e6, to: 0x412},
-	131: {from: 0x3658, to: 0x246},
-	132: {from: 0x3676, to: 0x3f4},
-	133: {from: 0x36fd, to: 0x445},
-	134: {from: 0x37c0, to: 0x121},
-	135: {from: 0x3816, to: 0x38f2},
-	136: {from: 0x382b, to: 0x2c9b},
-	137: {from: 0x382f, to: 0xa9},
-	138: {from: 0x3832, to: 0x3228},
-	139: {from: 0x386c, to: 0x39a6},
-	140: {from: 0x3892, to: 0x3fc0},
-	141: {from: 0x38a5, to: 0x39d7},
-	142: {from: 0x38b4, to: 0x1fa4},
-	143: {from: 0x38b5, to: 0x2e9a},
-	144: {from: 0x395c, to: 0x47e},
-	145: {from: 0x3b4e, to: 0xd91},
-	146: {from: 0x3b78, to: 0x137},
-	147: {from: 0x3c99, to: 0x4bc},
-	148: {from: 0x3fbd, to: 0x100},
-	149: {from: 0x4208, to: 0xa91},
-	150: {from: 0x42be, to: 0x573},
-	151: {from: 0x42f9, to: 0x3f60},
-	152: {from: 0x4378, to: 0x25a},
-	153: {from: 0x43cb, to: 0x36cb},
-	154: {from: 0x43cd, to: 0x10f},
-	155: {from: 0x44af, to: 0x3322},
-	156: {from: 0x44e3, to: 0x512},
-	157: {from: 0x45ca, to: 0x2409},
-	158: {from: 0x45dd, to: 0x26dc},
-	159: {from: 0x4610, to: 0x48ae},
-	160: {from: 0x46ae, to: 0x46a0},
-	161: {from: 0x473e, to: 0x4745},
-	162: {from: 0x4916, to: 0x31f},
-	163: {from: 0x49a7, to: 0x523},
-}
-
-// Size: 164 bytes, 164 elements
-var langAliasTypes = [164]langAliasType{
-	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
-	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
-	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
-	// Entry 40 - 7F
-	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
-	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
-	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
-	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
-	// Entry 80 - BF
-	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
-	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
-	0, 1, 1, 1,
-}
-
-const (
-	_Latn = 87
-	_Hani = 54
-	_Hans = 56
-	_Hant = 57
-	_Qaaa = 139
-	_Qaai = 147
-	_Qabx = 188
-	_Zinh = 236
-	_Zyyy = 241
-	_Zzzz = 242
+	_mul = 806
+	_und = 0
 )
-
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 976 bytes
-	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
-	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
-	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
-	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
-	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
-	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
-	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
-	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
-	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
-	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
-	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
-	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
-	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
-	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists.  If a script is given, it should be suppressed from the language tag.
-// Size: 1330 bytes, 1330 elements
-var suppressScript = [1330]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 40 - 7F
-	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry C0 - FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
-	// Entry 140 - 17F
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
-	// Entry 200 - 23F
-	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 240 - 27F
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 2C0 - 2FF
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
-	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
-	// Entry 3C0 - 3FF
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 400 - 43F
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 480 - 4BF
-	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 4C0 - 4FF
-	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 500 - 53F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00,
-}
-
 const (
 	_001 = 1
 	_419 = 31
@@ -1009,2290 +34,20 @@ const (
 	_XC  = 325
 	_XK  = 333
 )
+const (
+	_Latn = 87
+	_Hani = 54
+	_Hans = 56
+	_Hant = 57
+	_Qaaa = 139
+	_Qaai = 147
+	_Qabx = 188
+	_Zinh = 236
+	_Zyyy = 241
+	_Zzzz = 242
+)
 
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 32
-
-// regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 40 - 7F
-	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 80 - BF
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry C0 - FF
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	// Entry 100 - 13F
-	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 140 - 17F
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
-//                 letters form the 3-letter ISO code.
-//     - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
-	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
-	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
-	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
-	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
-	0x0121, 0x015f, 0x00dc,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]fromTo{
-	0:  {from: 0x44, to: 0xc4},
-	1:  {from: 0x58, to: 0xa7},
-	2:  {from: 0x5f, to: 0x60},
-	3:  {from: 0x66, to: 0x3b},
-	4:  {from: 0x79, to: 0x78},
-	5:  {from: 0x93, to: 0x37},
-	6:  {from: 0xa3, to: 0x133},
-	7:  {from: 0xc1, to: 0x133},
-	8:  {from: 0xd7, to: 0x13f},
-	9:  {from: 0xdc, to: 0x2b},
-	10: {from: 0xef, to: 0x133},
-	11: {from: 0xf2, to: 0xe2},
-	12: {from: 0xfc, to: 0x70},
-	13: {from: 0x103, to: 0x164},
-	14: {from: 0x12a, to: 0x126},
-	15: {from: 0x132, to: 0x7b},
-	16: {from: 0x13a, to: 0x13e},
-	17: {from: 0x141, to: 0x133},
-	18: {from: 0x15d, to: 0x15e},
-	19: {from: 0x163, to: 0x4b},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
-	// Entry 0 - 3F
-	0, 1, 2, 3, 5, 9, 11, 13,
-	14, 15, 17, 18, 19, 21, 29, 30,
-	34, 35, 39, 53, 54, 57, 61, 142,
-	143, 145, 150, 151, 154, 155, 202, 419,
-	958, 0, 20, 784, 4, 28, 660, 8,
-	51, 530, 24, 10, 32, 16, 40, 36,
-	533, 248, 31, 70, 52, 50, 56, 854,
-	100, 48, 108, 204, 652, 60, 96, 68,
-	// Entry 40 - 7F
-	535, 76, 44, 64, 104, 74, 72, 112,
-	84, 124, 166, 180, 140, 178, 756, 384,
-	184, 152, 120, 156, 170, 0, 188, 891,
-	296, 192, 132, 531, 162, 196, 203, 278,
-	276, 0, 262, 208, 212, 214, 204, 12,
-	0, 218, 233, 818, 732, 232, 724, 231,
-	967, 0, 246, 242, 238, 583, 234, 0,
-	250, 249, 266, 826, 308, 268, 254, 831,
-	// Entry 80 - BF
-	288, 292, 304, 270, 324, 312, 226, 300,
-	239, 320, 316, 624, 328, 344, 334, 340,
-	191, 332, 348, 854, 0, 360, 372, 376,
-	833, 356, 86, 368, 364, 352, 380, 832,
-	388, 400, 392, 581, 404, 417, 116, 296,
-	174, 659, 408, 410, 414, 136, 398, 418,
-	422, 662, 438, 144, 430, 426, 440, 442,
-	428, 434, 504, 492, 498, 499, 663, 450,
-	// Entry C0 - FF
-	584, 581, 807, 466, 104, 496, 446, 580,
-	474, 478, 500, 470, 480, 462, 454, 484,
-	458, 508, 516, 540, 562, 574, 566, 548,
-	558, 528, 578, 524, 10, 520, 536, 570,
-	554, 512, 591, 0, 604, 258, 598, 608,
-	586, 616, 666, 612, 630, 275, 620, 581,
-	585, 600, 591, 634, 959, 960, 961, 962,
-	963, 964, 965, 966, 967, 968, 969, 970,
-	// Entry 100 - 13F
-	971, 972, 638, 716, 642, 688, 643, 646,
-	682, 90, 690, 729, 752, 702, 654, 705,
-	744, 703, 694, 674, 686, 706, 740, 728,
-	678, 810, 222, 534, 760, 748, 0, 796,
-	148, 260, 768, 764, 762, 772, 626, 795,
-	788, 776, 626, 792, 780, 798, 158, 834,
-	804, 800, 826, 581, 0, 840, 858, 860,
-	336, 670, 704, 862, 92, 850, 704, 548,
-	// Entry 140 - 17F
-	876, 581, 882, 973, 974, 975, 976, 977,
-	978, 979, 980, 981, 982, 983, 984, 985,
-	986, 987, 988, 989, 990, 991, 992, 993,
-	994, 995, 996, 997, 998, 720, 887, 175,
-	891, 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
-	0, 59, 108, 143, 181, 220, 259, 291,
-	333,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 666 bytes, 333 elements
-var fromM49 = [333]uint16{
-	// Entry 0 - 3F
-	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
-	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
-	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
-	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
-	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
-	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
-	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
-	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
-	// Entry 40 - 7F
-	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
-	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
-	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
-	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
-	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
-	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
-	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
-	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
-	// Entry 80 - BF
-	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
-	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
-	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
-	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
-	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
-	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
-	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
-	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
-	// Entry C0 - FF
-	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
-	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
-	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
-	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
-	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
-	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
-	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
-	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
-	// Entry 100 - 13F
-	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
-	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
-	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
-	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
-	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
-	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
-	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
-	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
-	// Entry 140 - 17F
-	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
-	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
-}
-
-// Size: 1615 bytes
-var variantIndex = map[string]uint8{
-	"1606nict": 0x0,
-	"1694acad": 0x1,
-	"1901":     0x2,
-	"1959acad": 0x3,
-	"1994":     0x4d,
-	"1996":     0x4,
-	"abl1943":  0x5,
-	"akuapem":  0x6,
-	"alalc97":  0x4f,
-	"aluku":    0x7,
-	"ao1990":   0x8,
-	"arevela":  0x9,
-	"arevmda":  0xa,
-	"asante":   0xb,
-	"baku1926": 0xc,
-	"balanka":  0xd,
-	"barla":    0xe,
-	"basiceng": 0xf,
-	"bauddha":  0x10,
-	"biscayan": 0x11,
-	"biske":    0x48,
-	"bohoric":  0x12,
-	"boont":    0x13,
-	"colb1945": 0x14,
-	"cornu":    0x15,
-	"dajnko":   0x16,
-	"ekavsk":   0x17,
-	"emodeng":  0x18,
-	"fonipa":   0x50,
-	"fonnapa":  0x51,
-	"fonupa":   0x52,
-	"fonxsamp": 0x53,
-	"hepburn":  0x19,
-	"heploc":   0x4e,
-	"hognorsk": 0x1a,
-	"hsistemo": 0x1b,
-	"ijekavsk": 0x1c,
-	"itihasa":  0x1d,
-	"jauer":    0x1e,
-	"jyutping": 0x1f,
-	"kkcor":    0x20,
-	"kociewie": 0x21,
-	"kscor":    0x22,
-	"laukika":  0x23,
-	"lipaw":    0x49,
-	"luna1918": 0x24,
-	"metelko":  0x25,
-	"monoton":  0x26,
-	"ndyuka":   0x27,
-	"nedis":    0x28,
-	"newfound": 0x29,
-	"njiva":    0x4a,
-	"nulik":    0x2a,
-	"osojs":    0x4b,
-	"oxendict": 0x2b,
-	"pahawh2":  0x2c,
-	"pahawh3":  0x2d,
-	"pahawh4":  0x2e,
-	"pamaka":   0x2f,
-	"petr1708": 0x30,
-	"pinyin":   0x31,
-	"polyton":  0x32,
-	"puter":    0x33,
-	"rigik":    0x34,
-	"rozaj":    0x35,
-	"rumgr":    0x36,
-	"scotland": 0x37,
-	"scouse":   0x38,
-	"simple":   0x54,
-	"solba":    0x4c,
-	"sotav":    0x39,
-	"spanglis": 0x3a,
-	"surmiran": 0x3b,
-	"sursilv":  0x3c,
-	"sutsilv":  0x3d,
-	"tarask":   0x3e,
-	"uccor":    0x3f,
-	"ucrcor":   0x40,
-	"ulster":   0x41,
-	"unifon":   0x42,
-	"vaidika":  0x43,
-	"valencia": 0x44,
-	"vallader": 0x45,
-	"wadegile": 0x46,
-	"xsistemo": 0x47,
-}
-
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 79
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 33
-
-type likelyLangRegion struct {
-	lang   uint16
-	region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 976 bytes, 244 elements
-var likelyScript = [244]likelyLangRegion{
-	1:   {lang: 0x14e, region: 0x84},
-	3:   {lang: 0x2a2, region: 0x106},
-	4:   {lang: 0x1f, region: 0x99},
-	5:   {lang: 0x3a, region: 0x6b},
-	7:   {lang: 0x3b, region: 0x9c},
-	8:   {lang: 0x1d7, region: 0x28},
-	9:   {lang: 0x13, region: 0x9c},
-	10:  {lang: 0x5b, region: 0x95},
-	11:  {lang: 0x60, region: 0x52},
-	12:  {lang: 0xb9, region: 0xb4},
-	13:  {lang: 0x63, region: 0x95},
-	14:  {lang: 0xa5, region: 0x35},
-	15:  {lang: 0x3e9, region: 0x99},
-	17:  {lang: 0x529, region: 0x12e},
-	18:  {lang: 0x3b1, region: 0x99},
-	19:  {lang: 0x15e, region: 0x78},
-	20:  {lang: 0xc2, region: 0x95},
-	21:  {lang: 0x9d, region: 0xe7},
-	22:  {lang: 0xdb, region: 0x35},
-	23:  {lang: 0xf3, region: 0x49},
-	24:  {lang: 0x4f0, region: 0x12b},
-	25:  {lang: 0xe7, region: 0x13e},
-	26:  {lang: 0xe5, region: 0x135},
-	28:  {lang: 0xf1, region: 0x6b},
-	30:  {lang: 0x1a0, region: 0x5d},
-	31:  {lang: 0x3e2, region: 0x106},
-	33:  {lang: 0x1be, region: 0x99},
-	36:  {lang: 0x15e, region: 0x78},
-	39:  {lang: 0x133, region: 0x6b},
-	40:  {lang: 0x431, region: 0x27},
-	41:  {lang: 0x27, region: 0x6f},
-	43:  {lang: 0x210, region: 0x7d},
-	44:  {lang: 0xfe, region: 0x38},
-	46:  {lang: 0x19b, region: 0x99},
-	47:  {lang: 0x19e, region: 0x130},
-	48:  {lang: 0x3e9, region: 0x99},
-	49:  {lang: 0x136, region: 0x87},
-	50:  {lang: 0x1a4, region: 0x99},
-	51:  {lang: 0x39d, region: 0x99},
-	52:  {lang: 0x529, region: 0x12e},
-	53:  {lang: 0x254, region: 0xab},
-	54:  {lang: 0x529, region: 0x53},
-	55:  {lang: 0x1cb, region: 0xe7},
-	56:  {lang: 0x529, region: 0x53},
-	57:  {lang: 0x529, region: 0x12e},
-	58:  {lang: 0x2fd, region: 0x9b},
-	59:  {lang: 0x1bc, region: 0x97},
-	60:  {lang: 0x200, region: 0xa2},
-	61:  {lang: 0x1c5, region: 0x12b},
-	62:  {lang: 0x1ca, region: 0xaf},
-	65:  {lang: 0x1d5, region: 0x92},
-	67:  {lang: 0x142, region: 0x9e},
-	68:  {lang: 0x254, region: 0xab},
-	69:  {lang: 0x20e, region: 0x95},
-	70:  {lang: 0x200, region: 0xa2},
-	72:  {lang: 0x135, region: 0xc4},
-	73:  {lang: 0x200, region: 0xa2},
-	74:  {lang: 0x3bb, region: 0xe8},
-	75:  {lang: 0x24a, region: 0xa6},
-	76:  {lang: 0x3fa, region: 0x99},
-	79:  {lang: 0x251, region: 0x99},
-	80:  {lang: 0x254, region: 0xab},
-	82:  {lang: 0x88, region: 0x99},
-	83:  {lang: 0x370, region: 0x123},
-	84:  {lang: 0x2b8, region: 0xaf},
-	89:  {lang: 0x29f, region: 0x99},
-	90:  {lang: 0x2a8, region: 0x99},
-	91:  {lang: 0x28f, region: 0x87},
-	92:  {lang: 0x1a0, region: 0x87},
-	93:  {lang: 0x2ac, region: 0x53},
-	95:  {lang: 0x4f4, region: 0x12b},
-	96:  {lang: 0x4f5, region: 0x12b},
-	97:  {lang: 0x1be, region: 0x99},
-	99:  {lang: 0x337, region: 0x9c},
-	100: {lang: 0x4f7, region: 0x53},
-	101: {lang: 0xa9, region: 0x53},
-	104: {lang: 0x2e8, region: 0x112},
-	105: {lang: 0x4f8, region: 0x10b},
-	106: {lang: 0x4f8, region: 0x10b},
-	107: {lang: 0x304, region: 0x99},
-	108: {lang: 0x31b, region: 0x99},
-	109: {lang: 0x30b, region: 0x53},
-	111: {lang: 0x31e, region: 0x35},
-	112: {lang: 0x30e, region: 0x99},
-	113: {lang: 0x414, region: 0xe8},
-	114: {lang: 0x331, region: 0xc4},
-	115: {lang: 0x4f9, region: 0x108},
-	116: {lang: 0x3b, region: 0xa1},
-	117: {lang: 0x353, region: 0xdb},
-	120: {lang: 0x2d0, region: 0x84},
-	121: {lang: 0x52a, region: 0x53},
-	122: {lang: 0x403, region: 0x96},
-	123: {lang: 0x3ee, region: 0x99},
-	124: {lang: 0x39b, region: 0xc5},
-	125: {lang: 0x395, region: 0x99},
-	126: {lang: 0x399, region: 0x135},
-	127: {lang: 0x429, region: 0x115},
-	128: {lang: 0x3b, region: 0x11c},
-	129: {lang: 0xfd, region: 0xc4},
-	130: {lang: 0x27d, region: 0x106},
-	131: {lang: 0x2c9, region: 0x53},
-	132: {lang: 0x39f, region: 0x9c},
-	133: {lang: 0x39f, region: 0x53},
-	135: {lang: 0x3ad, region: 0xb0},
-	137: {lang: 0x1c6, region: 0x53},
-	138: {lang: 0x4fd, region: 0x9c},
-	189: {lang: 0x3cb, region: 0x95},
-	191: {lang: 0x372, region: 0x10c},
-	192: {lang: 0x420, region: 0x97},
-	194: {lang: 0x4ff, region: 0x15e},
-	195: {lang: 0x3f0, region: 0x99},
-	196: {lang: 0x45, region: 0x135},
-	197: {lang: 0x139, region: 0x7b},
-	198: {lang: 0x3e9, region: 0x99},
-	200: {lang: 0x3e9, region: 0x99},
-	201: {lang: 0x3fa, region: 0x99},
-	202: {lang: 0x40c, region: 0xb3},
-	203: {lang: 0x433, region: 0x99},
-	204: {lang: 0xef, region: 0xc5},
-	205: {lang: 0x43e, region: 0x95},
-	206: {lang: 0x44d, region: 0x35},
-	207: {lang: 0x44e, region: 0x9b},
-	211: {lang: 0x45a, region: 0xe7},
-	212: {lang: 0x11a, region: 0x99},
-	213: {lang: 0x45e, region: 0x53},
-	214: {lang: 0x232, region: 0x53},
-	215: {lang: 0x450, region: 0x99},
-	216: {lang: 0x4a5, region: 0x53},
-	217: {lang: 0x9f, region: 0x13e},
-	218: {lang: 0x461, region: 0x99},
-	220: {lang: 0x528, region: 0xba},
-	221: {lang: 0x153, region: 0xe7},
-	222: {lang: 0x128, region: 0xcd},
-	223: {lang: 0x46b, region: 0x123},
-	224: {lang: 0xa9, region: 0x53},
-	225: {lang: 0x2ce, region: 0x99},
-	226: {lang: 0x4ad, region: 0x11c},
-	227: {lang: 0x4be, region: 0xb4},
-	229: {lang: 0x1ce, region: 0x99},
-	232: {lang: 0x3a9, region: 0x9c},
-	233: {lang: 0x22, region: 0x9b},
-	234: {lang: 0x1ea, region: 0x53},
-	235: {lang: 0xef, region: 0xc5},
-}
-
-type likelyScriptRegion struct {
-	region uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5320 bytes, 1330 elements
-var likelyLang = [1330]likelyScriptRegion{
-	0:    {region: 0x135, script: 0x57, flags: 0x0},
-	1:    {region: 0x6f, script: 0x57, flags: 0x0},
-	2:    {region: 0x165, script: 0x57, flags: 0x0},
-	3:    {region: 0x165, script: 0x57, flags: 0x0},
-	4:    {region: 0x165, script: 0x57, flags: 0x0},
-	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
-	6:    {region: 0x165, script: 0x57, flags: 0x0},
-	7:    {region: 0x165, script: 0x1f, flags: 0x0},
-	8:    {region: 0x80, script: 0x57, flags: 0x0},
-	9:    {region: 0x165, script: 0x57, flags: 0x0},
-	10:   {region: 0x165, script: 0x57, flags: 0x0},
-	11:   {region: 0x165, script: 0x57, flags: 0x0},
-	12:   {region: 0x95, script: 0x57, flags: 0x0},
-	13:   {region: 0x131, script: 0x57, flags: 0x0},
-	14:   {region: 0x80, script: 0x57, flags: 0x0},
-	15:   {region: 0x165, script: 0x57, flags: 0x0},
-	16:   {region: 0x165, script: 0x57, flags: 0x0},
-	17:   {region: 0x106, script: 0x1f, flags: 0x0},
-	18:   {region: 0x165, script: 0x57, flags: 0x0},
-	19:   {region: 0x9c, script: 0x9, flags: 0x0},
-	20:   {region: 0x128, script: 0x5, flags: 0x0},
-	21:   {region: 0x165, script: 0x57, flags: 0x0},
-	22:   {region: 0x161, script: 0x57, flags: 0x0},
-	23:   {region: 0x165, script: 0x57, flags: 0x0},
-	24:   {region: 0x165, script: 0x57, flags: 0x0},
-	25:   {region: 0x165, script: 0x57, flags: 0x0},
-	26:   {region: 0x165, script: 0x57, flags: 0x0},
-	27:   {region: 0x165, script: 0x57, flags: 0x0},
-	28:   {region: 0x52, script: 0x57, flags: 0x0},
-	29:   {region: 0x165, script: 0x57, flags: 0x0},
-	30:   {region: 0x165, script: 0x57, flags: 0x0},
-	31:   {region: 0x99, script: 0x4, flags: 0x0},
-	32:   {region: 0x165, script: 0x57, flags: 0x0},
-	33:   {region: 0x80, script: 0x57, flags: 0x0},
-	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
-	35:   {region: 0x165, script: 0x57, flags: 0x0},
-	36:   {region: 0x165, script: 0x57, flags: 0x0},
-	37:   {region: 0x14d, script: 0x57, flags: 0x0},
-	38:   {region: 0x106, script: 0x1f, flags: 0x0},
-	39:   {region: 0x6f, script: 0x29, flags: 0x0},
-	40:   {region: 0x165, script: 0x57, flags: 0x0},
-	41:   {region: 0x165, script: 0x57, flags: 0x0},
-	42:   {region: 0xd6, script: 0x57, flags: 0x0},
-	43:   {region: 0x165, script: 0x57, flags: 0x0},
-	45:   {region: 0x165, script: 0x57, flags: 0x0},
-	46:   {region: 0x165, script: 0x57, flags: 0x0},
-	47:   {region: 0x165, script: 0x57, flags: 0x0},
-	48:   {region: 0x165, script: 0x57, flags: 0x0},
-	49:   {region: 0x165, script: 0x57, flags: 0x0},
-	50:   {region: 0x165, script: 0x57, flags: 0x0},
-	51:   {region: 0x95, script: 0x57, flags: 0x0},
-	52:   {region: 0x165, script: 0x5, flags: 0x0},
-	53:   {region: 0x122, script: 0x5, flags: 0x0},
-	54:   {region: 0x165, script: 0x57, flags: 0x0},
-	55:   {region: 0x165, script: 0x57, flags: 0x0},
-	56:   {region: 0x165, script: 0x57, flags: 0x0},
-	57:   {region: 0x165, script: 0x57, flags: 0x0},
-	58:   {region: 0x6b, script: 0x5, flags: 0x0},
-	59:   {region: 0x0, script: 0x3, flags: 0x1},
-	60:   {region: 0x165, script: 0x57, flags: 0x0},
-	61:   {region: 0x51, script: 0x57, flags: 0x0},
-	62:   {region: 0x3f, script: 0x57, flags: 0x0},
-	63:   {region: 0x67, script: 0x5, flags: 0x0},
-	65:   {region: 0xba, script: 0x5, flags: 0x0},
-	66:   {region: 0x6b, script: 0x5, flags: 0x0},
-	67:   {region: 0x99, script: 0xe, flags: 0x0},
-	68:   {region: 0x12f, script: 0x57, flags: 0x0},
-	69:   {region: 0x135, script: 0xc4, flags: 0x0},
-	70:   {region: 0x165, script: 0x57, flags: 0x0},
-	71:   {region: 0x165, script: 0x57, flags: 0x0},
-	72:   {region: 0x6e, script: 0x57, flags: 0x0},
-	73:   {region: 0x165, script: 0x57, flags: 0x0},
-	74:   {region: 0x165, script: 0x57, flags: 0x0},
-	75:   {region: 0x49, script: 0x57, flags: 0x0},
-	76:   {region: 0x165, script: 0x57, flags: 0x0},
-	77:   {region: 0x106, script: 0x1f, flags: 0x0},
-	78:   {region: 0x165, script: 0x5, flags: 0x0},
-	79:   {region: 0x165, script: 0x57, flags: 0x0},
-	80:   {region: 0x165, script: 0x57, flags: 0x0},
-	81:   {region: 0x165, script: 0x57, flags: 0x0},
-	82:   {region: 0x99, script: 0x21, flags: 0x0},
-	83:   {region: 0x165, script: 0x57, flags: 0x0},
-	84:   {region: 0x165, script: 0x57, flags: 0x0},
-	85:   {region: 0x165, script: 0x57, flags: 0x0},
-	86:   {region: 0x3f, script: 0x57, flags: 0x0},
-	87:   {region: 0x165, script: 0x57, flags: 0x0},
-	88:   {region: 0x3, script: 0x5, flags: 0x1},
-	89:   {region: 0x106, script: 0x1f, flags: 0x0},
-	90:   {region: 0xe8, script: 0x5, flags: 0x0},
-	91:   {region: 0x95, script: 0x57, flags: 0x0},
-	92:   {region: 0xdb, script: 0x21, flags: 0x0},
-	93:   {region: 0x2e, script: 0x57, flags: 0x0},
-	94:   {region: 0x52, script: 0x57, flags: 0x0},
-	95:   {region: 0x165, script: 0x57, flags: 0x0},
-	96:   {region: 0x52, script: 0xb, flags: 0x0},
-	97:   {region: 0x165, script: 0x57, flags: 0x0},
-	98:   {region: 0x165, script: 0x57, flags: 0x0},
-	99:   {region: 0x95, script: 0x57, flags: 0x0},
-	100:  {region: 0x165, script: 0x57, flags: 0x0},
-	101:  {region: 0x52, script: 0x57, flags: 0x0},
-	102:  {region: 0x165, script: 0x57, flags: 0x0},
-	103:  {region: 0x165, script: 0x57, flags: 0x0},
-	104:  {region: 0x165, script: 0x57, flags: 0x0},
-	105:  {region: 0x165, script: 0x57, flags: 0x0},
-	106:  {region: 0x4f, script: 0x57, flags: 0x0},
-	107:  {region: 0x165, script: 0x57, flags: 0x0},
-	108:  {region: 0x165, script: 0x57, flags: 0x0},
-	109:  {region: 0x165, script: 0x57, flags: 0x0},
-	110:  {region: 0x165, script: 0x29, flags: 0x0},
-	111:  {region: 0x165, script: 0x57, flags: 0x0},
-	112:  {region: 0x165, script: 0x57, flags: 0x0},
-	113:  {region: 0x47, script: 0x1f, flags: 0x0},
-	114:  {region: 0x165, script: 0x57, flags: 0x0},
-	115:  {region: 0x165, script: 0x57, flags: 0x0},
-	116:  {region: 0x10b, script: 0x5, flags: 0x0},
-	117:  {region: 0x162, script: 0x57, flags: 0x0},
-	118:  {region: 0x165, script: 0x57, flags: 0x0},
-	119:  {region: 0x95, script: 0x57, flags: 0x0},
-	120:  {region: 0x165, script: 0x57, flags: 0x0},
-	121:  {region: 0x12f, script: 0x57, flags: 0x0},
-	122:  {region: 0x52, script: 0x57, flags: 0x0},
-	123:  {region: 0x99, script: 0xd7, flags: 0x0},
-	124:  {region: 0xe8, script: 0x5, flags: 0x0},
-	125:  {region: 0x99, script: 0x21, flags: 0x0},
-	126:  {region: 0x38, script: 0x1f, flags: 0x0},
-	127:  {region: 0x99, script: 0x21, flags: 0x0},
-	128:  {region: 0xe8, script: 0x5, flags: 0x0},
-	129:  {region: 0x12b, script: 0x31, flags: 0x0},
-	131:  {region: 0x99, script: 0x21, flags: 0x0},
-	132:  {region: 0x165, script: 0x57, flags: 0x0},
-	133:  {region: 0x99, script: 0x21, flags: 0x0},
-	134:  {region: 0xe7, script: 0x57, flags: 0x0},
-	135:  {region: 0x165, script: 0x57, flags: 0x0},
-	136:  {region: 0x99, script: 0x21, flags: 0x0},
-	137:  {region: 0x165, script: 0x57, flags: 0x0},
-	138:  {region: 0x13f, script: 0x57, flags: 0x0},
-	139:  {region: 0x165, script: 0x57, flags: 0x0},
-	140:  {region: 0x165, script: 0x57, flags: 0x0},
-	141:  {region: 0xe7, script: 0x57, flags: 0x0},
-	142:  {region: 0x165, script: 0x57, flags: 0x0},
-	143:  {region: 0xd6, script: 0x57, flags: 0x0},
-	144:  {region: 0x165, script: 0x57, flags: 0x0},
-	145:  {region: 0x165, script: 0x57, flags: 0x0},
-	146:  {region: 0x165, script: 0x57, flags: 0x0},
-	147:  {region: 0x165, script: 0x29, flags: 0x0},
-	148:  {region: 0x99, script: 0x21, flags: 0x0},
-	149:  {region: 0x95, script: 0x57, flags: 0x0},
-	150:  {region: 0x165, script: 0x57, flags: 0x0},
-	151:  {region: 0x165, script: 0x57, flags: 0x0},
-	152:  {region: 0x114, script: 0x57, flags: 0x0},
-	153:  {region: 0x165, script: 0x57, flags: 0x0},
-	154:  {region: 0x165, script: 0x57, flags: 0x0},
-	155:  {region: 0x52, script: 0x57, flags: 0x0},
-	156:  {region: 0x165, script: 0x57, flags: 0x0},
-	157:  {region: 0xe7, script: 0x57, flags: 0x0},
-	158:  {region: 0x165, script: 0x57, flags: 0x0},
-	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
-	160:  {region: 0xc3, script: 0x57, flags: 0x0},
-	161:  {region: 0x165, script: 0x57, flags: 0x0},
-	162:  {region: 0x165, script: 0x57, flags: 0x0},
-	163:  {region: 0xc3, script: 0x57, flags: 0x0},
-	164:  {region: 0x165, script: 0x57, flags: 0x0},
-	165:  {region: 0x35, script: 0xe, flags: 0x0},
-	166:  {region: 0x165, script: 0x57, flags: 0x0},
-	167:  {region: 0x165, script: 0x57, flags: 0x0},
-	168:  {region: 0x165, script: 0x57, flags: 0x0},
-	169:  {region: 0x53, script: 0xe0, flags: 0x0},
-	170:  {region: 0x165, script: 0x57, flags: 0x0},
-	171:  {region: 0x165, script: 0x57, flags: 0x0},
-	172:  {region: 0x165, script: 0x57, flags: 0x0},
-	173:  {region: 0x99, script: 0xe, flags: 0x0},
-	174:  {region: 0x165, script: 0x57, flags: 0x0},
-	175:  {region: 0x9c, script: 0x5, flags: 0x0},
-	176:  {region: 0x165, script: 0x57, flags: 0x0},
-	177:  {region: 0x4f, script: 0x57, flags: 0x0},
-	178:  {region: 0x78, script: 0x57, flags: 0x0},
-	179:  {region: 0x99, script: 0x21, flags: 0x0},
-	180:  {region: 0xe8, script: 0x5, flags: 0x0},
-	181:  {region: 0x99, script: 0x21, flags: 0x0},
-	182:  {region: 0x165, script: 0x57, flags: 0x0},
-	183:  {region: 0x33, script: 0x57, flags: 0x0},
-	184:  {region: 0x165, script: 0x57, flags: 0x0},
-	185:  {region: 0xb4, script: 0xc, flags: 0x0},
-	186:  {region: 0x52, script: 0x57, flags: 0x0},
-	187:  {region: 0x165, script: 0x29, flags: 0x0},
-	188:  {region: 0xe7, script: 0x57, flags: 0x0},
-	189:  {region: 0x165, script: 0x57, flags: 0x0},
-	190:  {region: 0xe8, script: 0x21, flags: 0x0},
-	191:  {region: 0x106, script: 0x1f, flags: 0x0},
-	192:  {region: 0x15f, script: 0x57, flags: 0x0},
-	193:  {region: 0x165, script: 0x57, flags: 0x0},
-	194:  {region: 0x95, script: 0x57, flags: 0x0},
-	195:  {region: 0x165, script: 0x57, flags: 0x0},
-	196:  {region: 0x52, script: 0x57, flags: 0x0},
-	197:  {region: 0x165, script: 0x57, flags: 0x0},
-	198:  {region: 0x165, script: 0x57, flags: 0x0},
-	199:  {region: 0x165, script: 0x57, flags: 0x0},
-	200:  {region: 0x86, script: 0x57, flags: 0x0},
-	201:  {region: 0x165, script: 0x57, flags: 0x0},
-	202:  {region: 0x165, script: 0x57, flags: 0x0},
-	203:  {region: 0x165, script: 0x57, flags: 0x0},
-	204:  {region: 0x165, script: 0x57, flags: 0x0},
-	205:  {region: 0x6d, script: 0x29, flags: 0x0},
-	206:  {region: 0x165, script: 0x57, flags: 0x0},
-	207:  {region: 0x165, script: 0x57, flags: 0x0},
-	208:  {region: 0x52, script: 0x57, flags: 0x0},
-	209:  {region: 0x165, script: 0x57, flags: 0x0},
-	210:  {region: 0x165, script: 0x57, flags: 0x0},
-	211:  {region: 0xc3, script: 0x57, flags: 0x0},
-	212:  {region: 0x165, script: 0x57, flags: 0x0},
-	213:  {region: 0x165, script: 0x57, flags: 0x0},
-	214:  {region: 0x165, script: 0x57, flags: 0x0},
-	215:  {region: 0x6e, script: 0x57, flags: 0x0},
-	216:  {region: 0x165, script: 0x57, flags: 0x0},
-	217:  {region: 0x165, script: 0x57, flags: 0x0},
-	218:  {region: 0xd6, script: 0x57, flags: 0x0},
-	219:  {region: 0x35, script: 0x16, flags: 0x0},
-	220:  {region: 0x106, script: 0x1f, flags: 0x0},
-	221:  {region: 0xe7, script: 0x57, flags: 0x0},
-	222:  {region: 0x165, script: 0x57, flags: 0x0},
-	223:  {region: 0x131, script: 0x57, flags: 0x0},
-	224:  {region: 0x8a, script: 0x57, flags: 0x0},
-	225:  {region: 0x75, script: 0x57, flags: 0x0},
-	226:  {region: 0x106, script: 0x1f, flags: 0x0},
-	227:  {region: 0x135, script: 0x57, flags: 0x0},
-	228:  {region: 0x49, script: 0x57, flags: 0x0},
-	229:  {region: 0x135, script: 0x1a, flags: 0x0},
-	230:  {region: 0xa6, script: 0x5, flags: 0x0},
-	231:  {region: 0x13e, script: 0x19, flags: 0x0},
-	232:  {region: 0x165, script: 0x57, flags: 0x0},
-	233:  {region: 0x9b, script: 0x5, flags: 0x0},
-	234:  {region: 0x165, script: 0x57, flags: 0x0},
-	235:  {region: 0x165, script: 0x57, flags: 0x0},
-	236:  {region: 0x165, script: 0x57, flags: 0x0},
-	237:  {region: 0x165, script: 0x57, flags: 0x0},
-	238:  {region: 0x165, script: 0x57, flags: 0x0},
-	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
-	240:  {region: 0x78, script: 0x57, flags: 0x0},
-	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
-	242:  {region: 0xe7, script: 0x57, flags: 0x0},
-	243:  {region: 0x49, script: 0x17, flags: 0x0},
-	244:  {region: 0x130, script: 0x1f, flags: 0x0},
-	245:  {region: 0x49, script: 0x17, flags: 0x0},
-	246:  {region: 0x49, script: 0x17, flags: 0x0},
-	247:  {region: 0x49, script: 0x17, flags: 0x0},
-	248:  {region: 0x49, script: 0x17, flags: 0x0},
-	249:  {region: 0x10a, script: 0x57, flags: 0x0},
-	250:  {region: 0x5e, script: 0x57, flags: 0x0},
-	251:  {region: 0xe9, script: 0x57, flags: 0x0},
-	252:  {region: 0x49, script: 0x17, flags: 0x0},
-	253:  {region: 0xc4, script: 0x81, flags: 0x0},
-	254:  {region: 0x8, script: 0x2, flags: 0x1},
-	255:  {region: 0x106, script: 0x1f, flags: 0x0},
-	256:  {region: 0x7b, script: 0x57, flags: 0x0},
-	257:  {region: 0x63, script: 0x57, flags: 0x0},
-	258:  {region: 0x165, script: 0x57, flags: 0x0},
-	259:  {region: 0x165, script: 0x57, flags: 0x0},
-	260:  {region: 0x165, script: 0x57, flags: 0x0},
-	261:  {region: 0x165, script: 0x57, flags: 0x0},
-	262:  {region: 0x135, script: 0x57, flags: 0x0},
-	263:  {region: 0x106, script: 0x1f, flags: 0x0},
-	264:  {region: 0xa4, script: 0x57, flags: 0x0},
-	265:  {region: 0x165, script: 0x57, flags: 0x0},
-	266:  {region: 0x165, script: 0x57, flags: 0x0},
-	267:  {region: 0x99, script: 0x5, flags: 0x0},
-	268:  {region: 0x165, script: 0x57, flags: 0x0},
-	269:  {region: 0x60, script: 0x57, flags: 0x0},
-	270:  {region: 0x165, script: 0x57, flags: 0x0},
-	271:  {region: 0x49, script: 0x57, flags: 0x0},
-	272:  {region: 0x165, script: 0x57, flags: 0x0},
-	273:  {region: 0x165, script: 0x57, flags: 0x0},
-	274:  {region: 0x165, script: 0x57, flags: 0x0},
-	275:  {region: 0x165, script: 0x5, flags: 0x0},
-	276:  {region: 0x49, script: 0x57, flags: 0x0},
-	277:  {region: 0x165, script: 0x57, flags: 0x0},
-	278:  {region: 0x165, script: 0x57, flags: 0x0},
-	279:  {region: 0xd4, script: 0x57, flags: 0x0},
-	280:  {region: 0x4f, script: 0x57, flags: 0x0},
-	281:  {region: 0x165, script: 0x57, flags: 0x0},
-	282:  {region: 0x99, script: 0x5, flags: 0x0},
-	283:  {region: 0x165, script: 0x57, flags: 0x0},
-	284:  {region: 0x165, script: 0x57, flags: 0x0},
-	285:  {region: 0x165, script: 0x57, flags: 0x0},
-	286:  {region: 0x165, script: 0x29, flags: 0x0},
-	287:  {region: 0x60, script: 0x57, flags: 0x0},
-	288:  {region: 0xc3, script: 0x57, flags: 0x0},
-	289:  {region: 0xd0, script: 0x57, flags: 0x0},
-	290:  {region: 0x165, script: 0x57, flags: 0x0},
-	291:  {region: 0xdb, script: 0x21, flags: 0x0},
-	292:  {region: 0x52, script: 0x57, flags: 0x0},
-	293:  {region: 0x165, script: 0x57, flags: 0x0},
-	294:  {region: 0x165, script: 0x57, flags: 0x0},
-	295:  {region: 0x165, script: 0x57, flags: 0x0},
-	296:  {region: 0xcd, script: 0xde, flags: 0x0},
-	297:  {region: 0x165, script: 0x57, flags: 0x0},
-	298:  {region: 0x165, script: 0x57, flags: 0x0},
-	299:  {region: 0x114, script: 0x57, flags: 0x0},
-	300:  {region: 0x37, script: 0x57, flags: 0x0},
-	301:  {region: 0x43, script: 0xe0, flags: 0x0},
-	302:  {region: 0x165, script: 0x57, flags: 0x0},
-	303:  {region: 0xa4, script: 0x57, flags: 0x0},
-	304:  {region: 0x80, script: 0x57, flags: 0x0},
-	305:  {region: 0xd6, script: 0x57, flags: 0x0},
-	306:  {region: 0x9e, script: 0x57, flags: 0x0},
-	307:  {region: 0x6b, script: 0x27, flags: 0x0},
-	308:  {region: 0x165, script: 0x57, flags: 0x0},
-	309:  {region: 0xc4, script: 0x48, flags: 0x0},
-	310:  {region: 0x87, script: 0x31, flags: 0x0},
-	311:  {region: 0x165, script: 0x57, flags: 0x0},
-	312:  {region: 0x165, script: 0x57, flags: 0x0},
-	313:  {region: 0xa, script: 0x2, flags: 0x1},
-	314:  {region: 0x165, script: 0x57, flags: 0x0},
-	315:  {region: 0x165, script: 0x57, flags: 0x0},
-	316:  {region: 0x1, script: 0x57, flags: 0x0},
-	317:  {region: 0x165, script: 0x57, flags: 0x0},
-	318:  {region: 0x6e, script: 0x57, flags: 0x0},
-	319:  {region: 0x135, script: 0x57, flags: 0x0},
-	320:  {region: 0x6a, script: 0x57, flags: 0x0},
-	321:  {region: 0x165, script: 0x57, flags: 0x0},
-	322:  {region: 0x9e, script: 0x43, flags: 0x0},
-	323:  {region: 0x165, script: 0x57, flags: 0x0},
-	324:  {region: 0x165, script: 0x57, flags: 0x0},
-	325:  {region: 0x6e, script: 0x57, flags: 0x0},
-	326:  {region: 0x52, script: 0x57, flags: 0x0},
-	327:  {region: 0x6e, script: 0x57, flags: 0x0},
-	328:  {region: 0x9c, script: 0x5, flags: 0x0},
-	329:  {region: 0x165, script: 0x57, flags: 0x0},
-	330:  {region: 0x165, script: 0x57, flags: 0x0},
-	331:  {region: 0x165, script: 0x57, flags: 0x0},
-	332:  {region: 0x165, script: 0x57, flags: 0x0},
-	333:  {region: 0x86, script: 0x57, flags: 0x0},
-	334:  {region: 0xc, script: 0x2, flags: 0x1},
-	335:  {region: 0x165, script: 0x57, flags: 0x0},
-	336:  {region: 0xc3, script: 0x57, flags: 0x0},
-	337:  {region: 0x72, script: 0x57, flags: 0x0},
-	338:  {region: 0x10b, script: 0x5, flags: 0x0},
-	339:  {region: 0xe7, script: 0x57, flags: 0x0},
-	340:  {region: 0x10c, script: 0x57, flags: 0x0},
-	341:  {region: 0x73, script: 0x57, flags: 0x0},
-	342:  {region: 0x165, script: 0x57, flags: 0x0},
-	343:  {region: 0x165, script: 0x57, flags: 0x0},
-	344:  {region: 0x76, script: 0x57, flags: 0x0},
-	345:  {region: 0x165, script: 0x57, flags: 0x0},
-	346:  {region: 0x3b, script: 0x57, flags: 0x0},
-	347:  {region: 0x165, script: 0x57, flags: 0x0},
-	348:  {region: 0x165, script: 0x57, flags: 0x0},
-	349:  {region: 0x165, script: 0x57, flags: 0x0},
-	350:  {region: 0x78, script: 0x57, flags: 0x0},
-	351:  {region: 0x135, script: 0x57, flags: 0x0},
-	352:  {region: 0x78, script: 0x57, flags: 0x0},
-	353:  {region: 0x60, script: 0x57, flags: 0x0},
-	354:  {region: 0x60, script: 0x57, flags: 0x0},
-	355:  {region: 0x52, script: 0x5, flags: 0x0},
-	356:  {region: 0x140, script: 0x57, flags: 0x0},
-	357:  {region: 0x165, script: 0x57, flags: 0x0},
-	358:  {region: 0x84, script: 0x57, flags: 0x0},
-	359:  {region: 0x165, script: 0x57, flags: 0x0},
-	360:  {region: 0xd4, script: 0x57, flags: 0x0},
-	361:  {region: 0x9e, script: 0x57, flags: 0x0},
-	362:  {region: 0xd6, script: 0x57, flags: 0x0},
-	363:  {region: 0x165, script: 0x57, flags: 0x0},
-	364:  {region: 0x10b, script: 0x57, flags: 0x0},
-	365:  {region: 0xd9, script: 0x57, flags: 0x0},
-	366:  {region: 0x96, script: 0x57, flags: 0x0},
-	367:  {region: 0x80, script: 0x57, flags: 0x0},
-	368:  {region: 0x165, script: 0x57, flags: 0x0},
-	369:  {region: 0xbc, script: 0x57, flags: 0x0},
-	370:  {region: 0x165, script: 0x57, flags: 0x0},
-	371:  {region: 0x165, script: 0x57, flags: 0x0},
-	372:  {region: 0x165, script: 0x57, flags: 0x0},
-	373:  {region: 0x53, script: 0x38, flags: 0x0},
-	374:  {region: 0x165, script: 0x57, flags: 0x0},
-	375:  {region: 0x95, script: 0x57, flags: 0x0},
-	376:  {region: 0x165, script: 0x57, flags: 0x0},
-	377:  {region: 0x165, script: 0x57, flags: 0x0},
-	378:  {region: 0x99, script: 0x21, flags: 0x0},
-	379:  {region: 0x165, script: 0x57, flags: 0x0},
-	380:  {region: 0x9c, script: 0x5, flags: 0x0},
-	381:  {region: 0x7e, script: 0x57, flags: 0x0},
-	382:  {region: 0x7b, script: 0x57, flags: 0x0},
-	383:  {region: 0x165, script: 0x57, flags: 0x0},
-	384:  {region: 0x165, script: 0x57, flags: 0x0},
-	385:  {region: 0x165, script: 0x57, flags: 0x0},
-	386:  {region: 0x165, script: 0x57, flags: 0x0},
-	387:  {region: 0x165, script: 0x57, flags: 0x0},
-	388:  {region: 0x165, script: 0x57, flags: 0x0},
-	389:  {region: 0x6f, script: 0x29, flags: 0x0},
-	390:  {region: 0x165, script: 0x57, flags: 0x0},
-	391:  {region: 0xdb, script: 0x21, flags: 0x0},
-	392:  {region: 0x165, script: 0x57, flags: 0x0},
-	393:  {region: 0xa7, script: 0x57, flags: 0x0},
-	394:  {region: 0x165, script: 0x57, flags: 0x0},
-	395:  {region: 0xe8, script: 0x5, flags: 0x0},
-	396:  {region: 0x165, script: 0x57, flags: 0x0},
-	397:  {region: 0xe8, script: 0x5, flags: 0x0},
-	398:  {region: 0x165, script: 0x57, flags: 0x0},
-	399:  {region: 0x165, script: 0x57, flags: 0x0},
-	400:  {region: 0x6e, script: 0x57, flags: 0x0},
-	401:  {region: 0x9c, script: 0x5, flags: 0x0},
-	402:  {region: 0x165, script: 0x57, flags: 0x0},
-	403:  {region: 0x165, script: 0x29, flags: 0x0},
-	404:  {region: 0xf1, script: 0x57, flags: 0x0},
-	405:  {region: 0x165, script: 0x57, flags: 0x0},
-	406:  {region: 0x165, script: 0x57, flags: 0x0},
-	407:  {region: 0x165, script: 0x57, flags: 0x0},
-	408:  {region: 0x165, script: 0x29, flags: 0x0},
-	409:  {region: 0x165, script: 0x57, flags: 0x0},
-	410:  {region: 0x99, script: 0x21, flags: 0x0},
-	411:  {region: 0x99, script: 0xda, flags: 0x0},
-	412:  {region: 0x95, script: 0x57, flags: 0x0},
-	413:  {region: 0xd9, script: 0x57, flags: 0x0},
-	414:  {region: 0x130, script: 0x2f, flags: 0x0},
-	415:  {region: 0x165, script: 0x57, flags: 0x0},
-	416:  {region: 0xe, script: 0x2, flags: 0x1},
-	417:  {region: 0x99, script: 0xe, flags: 0x0},
-	418:  {region: 0x165, script: 0x57, flags: 0x0},
-	419:  {region: 0x4e, script: 0x57, flags: 0x0},
-	420:  {region: 0x99, script: 0x32, flags: 0x0},
-	421:  {region: 0x41, script: 0x57, flags: 0x0},
-	422:  {region: 0x54, script: 0x57, flags: 0x0},
-	423:  {region: 0x165, script: 0x57, flags: 0x0},
-	424:  {region: 0x80, script: 0x57, flags: 0x0},
-	425:  {region: 0x165, script: 0x57, flags: 0x0},
-	426:  {region: 0x165, script: 0x57, flags: 0x0},
-	427:  {region: 0xa4, script: 0x57, flags: 0x0},
-	428:  {region: 0x98, script: 0x57, flags: 0x0},
-	429:  {region: 0x165, script: 0x57, flags: 0x0},
-	430:  {region: 0xdb, script: 0x21, flags: 0x0},
-	431:  {region: 0x165, script: 0x57, flags: 0x0},
-	432:  {region: 0x165, script: 0x5, flags: 0x0},
-	433:  {region: 0x49, script: 0x57, flags: 0x0},
-	434:  {region: 0x165, script: 0x5, flags: 0x0},
-	435:  {region: 0x165, script: 0x57, flags: 0x0},
-	436:  {region: 0x10, script: 0x3, flags: 0x1},
-	437:  {region: 0x165, script: 0x57, flags: 0x0},
-	438:  {region: 0x53, script: 0x38, flags: 0x0},
-	439:  {region: 0x165, script: 0x57, flags: 0x0},
-	440:  {region: 0x135, script: 0x57, flags: 0x0},
-	441:  {region: 0x24, script: 0x5, flags: 0x0},
-	442:  {region: 0x165, script: 0x57, flags: 0x0},
-	443:  {region: 0x165, script: 0x29, flags: 0x0},
-	444:  {region: 0x97, script: 0x3b, flags: 0x0},
-	445:  {region: 0x165, script: 0x57, flags: 0x0},
-	446:  {region: 0x99, script: 0x21, flags: 0x0},
-	447:  {region: 0x165, script: 0x57, flags: 0x0},
-	448:  {region: 0x73, script: 0x57, flags: 0x0},
-	449:  {region: 0x165, script: 0x57, flags: 0x0},
-	450:  {region: 0x165, script: 0x57, flags: 0x0},
-	451:  {region: 0xe7, script: 0x57, flags: 0x0},
-	452:  {region: 0x165, script: 0x57, flags: 0x0},
-	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
-	454:  {region: 0x53, script: 0x89, flags: 0x0},
-	455:  {region: 0x165, script: 0x57, flags: 0x0},
-	456:  {region: 0xe8, script: 0x5, flags: 0x0},
-	457:  {region: 0x99, script: 0x21, flags: 0x0},
-	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
-	459:  {region: 0xe7, script: 0x57, flags: 0x0},
-	460:  {region: 0xe8, script: 0x5, flags: 0x0},
-	461:  {region: 0xe6, script: 0x57, flags: 0x0},
-	462:  {region: 0x99, script: 0x21, flags: 0x0},
-	463:  {region: 0x99, script: 0x21, flags: 0x0},
-	464:  {region: 0x165, script: 0x57, flags: 0x0},
-	465:  {region: 0x90, script: 0x57, flags: 0x0},
-	466:  {region: 0x60, script: 0x57, flags: 0x0},
-	467:  {region: 0x53, script: 0x38, flags: 0x0},
-	468:  {region: 0x91, script: 0x57, flags: 0x0},
-	469:  {region: 0x92, script: 0x57, flags: 0x0},
-	470:  {region: 0x165, script: 0x57, flags: 0x0},
-	471:  {region: 0x28, script: 0x8, flags: 0x0},
-	472:  {region: 0xd2, script: 0x57, flags: 0x0},
-	473:  {region: 0x78, script: 0x57, flags: 0x0},
-	474:  {region: 0x165, script: 0x57, flags: 0x0},
-	475:  {region: 0x165, script: 0x57, flags: 0x0},
-	476:  {region: 0xd0, script: 0x57, flags: 0x0},
-	477:  {region: 0xd6, script: 0x57, flags: 0x0},
-	478:  {region: 0x165, script: 0x57, flags: 0x0},
-	479:  {region: 0x165, script: 0x57, flags: 0x0},
-	480:  {region: 0x165, script: 0x57, flags: 0x0},
-	481:  {region: 0x95, script: 0x57, flags: 0x0},
-	482:  {region: 0x165, script: 0x57, flags: 0x0},
-	483:  {region: 0x165, script: 0x57, flags: 0x0},
-	484:  {region: 0x165, script: 0x57, flags: 0x0},
-	486:  {region: 0x122, script: 0x57, flags: 0x0},
-	487:  {region: 0xd6, script: 0x57, flags: 0x0},
-	488:  {region: 0x165, script: 0x57, flags: 0x0},
-	489:  {region: 0x165, script: 0x57, flags: 0x0},
-	490:  {region: 0x53, script: 0xea, flags: 0x0},
-	491:  {region: 0x165, script: 0x57, flags: 0x0},
-	492:  {region: 0x135, script: 0x57, flags: 0x0},
-	493:  {region: 0x165, script: 0x57, flags: 0x0},
-	494:  {region: 0x49, script: 0x57, flags: 0x0},
-	495:  {region: 0x165, script: 0x57, flags: 0x0},
-	496:  {region: 0x165, script: 0x57, flags: 0x0},
-	497:  {region: 0xe7, script: 0x57, flags: 0x0},
-	498:  {region: 0x165, script: 0x57, flags: 0x0},
-	499:  {region: 0x95, script: 0x57, flags: 0x0},
-	500:  {region: 0x106, script: 0x1f, flags: 0x0},
-	501:  {region: 0x1, script: 0x57, flags: 0x0},
-	502:  {region: 0x165, script: 0x57, flags: 0x0},
-	503:  {region: 0x165, script: 0x57, flags: 0x0},
-	504:  {region: 0x9d, script: 0x57, flags: 0x0},
-	505:  {region: 0x9e, script: 0x57, flags: 0x0},
-	506:  {region: 0x49, script: 0x17, flags: 0x0},
-	507:  {region: 0x97, script: 0x3b, flags: 0x0},
-	508:  {region: 0x165, script: 0x57, flags: 0x0},
-	509:  {region: 0x165, script: 0x57, flags: 0x0},
-	510:  {region: 0x106, script: 0x57, flags: 0x0},
-	511:  {region: 0x165, script: 0x57, flags: 0x0},
-	512:  {region: 0xa2, script: 0x46, flags: 0x0},
-	513:  {region: 0x165, script: 0x57, flags: 0x0},
-	514:  {region: 0xa0, script: 0x57, flags: 0x0},
-	515:  {region: 0x1, script: 0x57, flags: 0x0},
-	516:  {region: 0x165, script: 0x57, flags: 0x0},
-	517:  {region: 0x165, script: 0x57, flags: 0x0},
-	518:  {region: 0x165, script: 0x57, flags: 0x0},
-	519:  {region: 0x52, script: 0x57, flags: 0x0},
-	520:  {region: 0x130, script: 0x3b, flags: 0x0},
-	521:  {region: 0x165, script: 0x57, flags: 0x0},
-	522:  {region: 0x12f, script: 0x57, flags: 0x0},
-	523:  {region: 0xdb, script: 0x21, flags: 0x0},
-	524:  {region: 0x165, script: 0x57, flags: 0x0},
-	525:  {region: 0x63, script: 0x57, flags: 0x0},
-	526:  {region: 0x95, script: 0x57, flags: 0x0},
-	527:  {region: 0x95, script: 0x57, flags: 0x0},
-	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
-	529:  {region: 0x137, script: 0x1f, flags: 0x0},
-	530:  {region: 0x67, script: 0x57, flags: 0x0},
-	531:  {region: 0xc4, script: 0x57, flags: 0x0},
-	532:  {region: 0x165, script: 0x57, flags: 0x0},
-	533:  {region: 0x165, script: 0x57, flags: 0x0},
-	534:  {region: 0xd6, script: 0x57, flags: 0x0},
-	535:  {region: 0xa4, script: 0x57, flags: 0x0},
-	536:  {region: 0xc3, script: 0x57, flags: 0x0},
-	537:  {region: 0x106, script: 0x1f, flags: 0x0},
-	538:  {region: 0x165, script: 0x57, flags: 0x0},
-	539:  {region: 0x165, script: 0x57, flags: 0x0},
-	540:  {region: 0x165, script: 0x57, flags: 0x0},
-	541:  {region: 0x165, script: 0x57, flags: 0x0},
-	542:  {region: 0xd4, script: 0x5, flags: 0x0},
-	543:  {region: 0xd6, script: 0x57, flags: 0x0},
-	544:  {region: 0x164, script: 0x57, flags: 0x0},
-	545:  {region: 0x165, script: 0x57, flags: 0x0},
-	546:  {region: 0x165, script: 0x57, flags: 0x0},
-	547:  {region: 0x12f, script: 0x57, flags: 0x0},
-	548:  {region: 0x122, script: 0x5, flags: 0x0},
-	549:  {region: 0x165, script: 0x57, flags: 0x0},
-	550:  {region: 0x123, script: 0xdf, flags: 0x0},
-	551:  {region: 0x5a, script: 0x57, flags: 0x0},
-	552:  {region: 0x52, script: 0x57, flags: 0x0},
-	553:  {region: 0x165, script: 0x57, flags: 0x0},
-	554:  {region: 0x4f, script: 0x57, flags: 0x0},
-	555:  {region: 0x99, script: 0x21, flags: 0x0},
-	556:  {region: 0x99, script: 0x21, flags: 0x0},
-	557:  {region: 0x4b, script: 0x57, flags: 0x0},
-	558:  {region: 0x95, script: 0x57, flags: 0x0},
-	559:  {region: 0x165, script: 0x57, flags: 0x0},
-	560:  {region: 0x41, script: 0x57, flags: 0x0},
-	561:  {region: 0x99, script: 0x57, flags: 0x0},
-	562:  {region: 0x53, script: 0xd6, flags: 0x0},
-	563:  {region: 0x99, script: 0x21, flags: 0x0},
-	564:  {region: 0xc3, script: 0x57, flags: 0x0},
-	565:  {region: 0x165, script: 0x57, flags: 0x0},
-	566:  {region: 0x99, script: 0x72, flags: 0x0},
-	567:  {region: 0xe8, script: 0x5, flags: 0x0},
-	568:  {region: 0x165, script: 0x57, flags: 0x0},
-	569:  {region: 0xa4, script: 0x57, flags: 0x0},
-	570:  {region: 0x165, script: 0x57, flags: 0x0},
-	571:  {region: 0x12b, script: 0x57, flags: 0x0},
-	572:  {region: 0x165, script: 0x57, flags: 0x0},
-	573:  {region: 0xd2, script: 0x57, flags: 0x0},
-	574:  {region: 0x165, script: 0x57, flags: 0x0},
-	575:  {region: 0xaf, script: 0x54, flags: 0x0},
-	576:  {region: 0x165, script: 0x57, flags: 0x0},
-	577:  {region: 0x165, script: 0x57, flags: 0x0},
-	578:  {region: 0x13, script: 0x6, flags: 0x1},
-	579:  {region: 0x165, script: 0x57, flags: 0x0},
-	580:  {region: 0x52, script: 0x57, flags: 0x0},
-	581:  {region: 0x82, script: 0x57, flags: 0x0},
-	582:  {region: 0xa4, script: 0x57, flags: 0x0},
-	583:  {region: 0x165, script: 0x57, flags: 0x0},
-	584:  {region: 0x165, script: 0x57, flags: 0x0},
-	585:  {region: 0x165, script: 0x57, flags: 0x0},
-	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
-	587:  {region: 0x2a, script: 0x57, flags: 0x0},
-	588:  {region: 0x165, script: 0x57, flags: 0x0},
-	589:  {region: 0x165, script: 0x57, flags: 0x0},
-	590:  {region: 0x165, script: 0x57, flags: 0x0},
-	591:  {region: 0x165, script: 0x57, flags: 0x0},
-	592:  {region: 0x165, script: 0x57, flags: 0x0},
-	593:  {region: 0x99, script: 0x4f, flags: 0x0},
-	594:  {region: 0x8b, script: 0x57, flags: 0x0},
-	595:  {region: 0x165, script: 0x57, flags: 0x0},
-	596:  {region: 0xab, script: 0x50, flags: 0x0},
-	597:  {region: 0x106, script: 0x1f, flags: 0x0},
-	598:  {region: 0x99, script: 0x21, flags: 0x0},
-	599:  {region: 0x165, script: 0x57, flags: 0x0},
-	600:  {region: 0x75, script: 0x57, flags: 0x0},
-	601:  {region: 0x165, script: 0x57, flags: 0x0},
-	602:  {region: 0xb4, script: 0x57, flags: 0x0},
-	603:  {region: 0x165, script: 0x57, flags: 0x0},
-	604:  {region: 0x165, script: 0x57, flags: 0x0},
-	605:  {region: 0x165, script: 0x57, flags: 0x0},
-	606:  {region: 0x165, script: 0x57, flags: 0x0},
-	607:  {region: 0x165, script: 0x57, flags: 0x0},
-	608:  {region: 0x165, script: 0x57, flags: 0x0},
-	609:  {region: 0x165, script: 0x57, flags: 0x0},
-	610:  {region: 0x165, script: 0x29, flags: 0x0},
-	611:  {region: 0x165, script: 0x57, flags: 0x0},
-	612:  {region: 0x106, script: 0x1f, flags: 0x0},
-	613:  {region: 0x112, script: 0x57, flags: 0x0},
-	614:  {region: 0xe7, script: 0x57, flags: 0x0},
-	615:  {region: 0x106, script: 0x57, flags: 0x0},
-	616:  {region: 0x165, script: 0x57, flags: 0x0},
-	617:  {region: 0x99, script: 0x21, flags: 0x0},
-	618:  {region: 0x99, script: 0x5, flags: 0x0},
-	619:  {region: 0x12f, script: 0x57, flags: 0x0},
-	620:  {region: 0x165, script: 0x57, flags: 0x0},
-	621:  {region: 0x52, script: 0x57, flags: 0x0},
-	622:  {region: 0x60, script: 0x57, flags: 0x0},
-	623:  {region: 0x165, script: 0x57, flags: 0x0},
-	624:  {region: 0x165, script: 0x57, flags: 0x0},
-	625:  {region: 0x165, script: 0x29, flags: 0x0},
-	626:  {region: 0x165, script: 0x57, flags: 0x0},
-	627:  {region: 0x165, script: 0x57, flags: 0x0},
-	628:  {region: 0x19, script: 0x3, flags: 0x1},
-	629:  {region: 0x165, script: 0x57, flags: 0x0},
-	630:  {region: 0x165, script: 0x57, flags: 0x0},
-	631:  {region: 0x165, script: 0x57, flags: 0x0},
-	632:  {region: 0x165, script: 0x57, flags: 0x0},
-	633:  {region: 0x106, script: 0x1f, flags: 0x0},
-	634:  {region: 0x165, script: 0x57, flags: 0x0},
-	635:  {region: 0x165, script: 0x57, flags: 0x0},
-	636:  {region: 0x165, script: 0x57, flags: 0x0},
-	637:  {region: 0x106, script: 0x1f, flags: 0x0},
-	638:  {region: 0x165, script: 0x57, flags: 0x0},
-	639:  {region: 0x95, script: 0x57, flags: 0x0},
-	640:  {region: 0xe8, script: 0x5, flags: 0x0},
-	641:  {region: 0x7b, script: 0x57, flags: 0x0},
-	642:  {region: 0x165, script: 0x57, flags: 0x0},
-	643:  {region: 0x165, script: 0x57, flags: 0x0},
-	644:  {region: 0x165, script: 0x57, flags: 0x0},
-	645:  {region: 0x165, script: 0x29, flags: 0x0},
-	646:  {region: 0x123, script: 0xdf, flags: 0x0},
-	647:  {region: 0xe8, script: 0x5, flags: 0x0},
-	648:  {region: 0x165, script: 0x57, flags: 0x0},
-	649:  {region: 0x165, script: 0x57, flags: 0x0},
-	650:  {region: 0x1c, script: 0x5, flags: 0x1},
-	651:  {region: 0x165, script: 0x57, flags: 0x0},
-	652:  {region: 0x165, script: 0x57, flags: 0x0},
-	653:  {region: 0x165, script: 0x57, flags: 0x0},
-	654:  {region: 0x138, script: 0x57, flags: 0x0},
-	655:  {region: 0x87, script: 0x5b, flags: 0x0},
-	656:  {region: 0x97, script: 0x3b, flags: 0x0},
-	657:  {region: 0x12f, script: 0x57, flags: 0x0},
-	658:  {region: 0xe8, script: 0x5, flags: 0x0},
-	659:  {region: 0x131, script: 0x57, flags: 0x0},
-	660:  {region: 0x165, script: 0x57, flags: 0x0},
-	661:  {region: 0xb7, script: 0x57, flags: 0x0},
-	662:  {region: 0x106, script: 0x1f, flags: 0x0},
-	663:  {region: 0x165, script: 0x57, flags: 0x0},
-	664:  {region: 0x95, script: 0x57, flags: 0x0},
-	665:  {region: 0x165, script: 0x57, flags: 0x0},
-	666:  {region: 0x53, script: 0xdf, flags: 0x0},
-	667:  {region: 0x165, script: 0x57, flags: 0x0},
-	668:  {region: 0x165, script: 0x57, flags: 0x0},
-	669:  {region: 0x165, script: 0x57, flags: 0x0},
-	670:  {region: 0x165, script: 0x57, flags: 0x0},
-	671:  {region: 0x99, script: 0x59, flags: 0x0},
-	672:  {region: 0x165, script: 0x57, flags: 0x0},
-	673:  {region: 0x165, script: 0x57, flags: 0x0},
-	674:  {region: 0x106, script: 0x1f, flags: 0x0},
-	675:  {region: 0x131, script: 0x57, flags: 0x0},
-	676:  {region: 0x165, script: 0x57, flags: 0x0},
-	677:  {region: 0xd9, script: 0x57, flags: 0x0},
-	678:  {region: 0x165, script: 0x57, flags: 0x0},
-	679:  {region: 0x165, script: 0x57, flags: 0x0},
-	680:  {region: 0x21, script: 0x2, flags: 0x1},
-	681:  {region: 0x165, script: 0x57, flags: 0x0},
-	682:  {region: 0x165, script: 0x57, flags: 0x0},
-	683:  {region: 0x9e, script: 0x57, flags: 0x0},
-	684:  {region: 0x53, script: 0x5d, flags: 0x0},
-	685:  {region: 0x95, script: 0x57, flags: 0x0},
-	686:  {region: 0x9c, script: 0x5, flags: 0x0},
-	687:  {region: 0x135, script: 0x57, flags: 0x0},
-	688:  {region: 0x165, script: 0x57, flags: 0x0},
-	689:  {region: 0x165, script: 0x57, flags: 0x0},
-	690:  {region: 0x99, script: 0xda, flags: 0x0},
-	691:  {region: 0x9e, script: 0x57, flags: 0x0},
-	692:  {region: 0x165, script: 0x57, flags: 0x0},
-	693:  {region: 0x4b, script: 0x57, flags: 0x0},
-	694:  {region: 0x165, script: 0x57, flags: 0x0},
-	695:  {region: 0x165, script: 0x57, flags: 0x0},
-	696:  {region: 0xaf, script: 0x54, flags: 0x0},
-	697:  {region: 0x165, script: 0x57, flags: 0x0},
-	698:  {region: 0x165, script: 0x57, flags: 0x0},
-	699:  {region: 0x4b, script: 0x57, flags: 0x0},
-	700:  {region: 0x165, script: 0x57, flags: 0x0},
-	701:  {region: 0x165, script: 0x57, flags: 0x0},
-	702:  {region: 0x162, script: 0x57, flags: 0x0},
-	703:  {region: 0x9c, script: 0x5, flags: 0x0},
-	704:  {region: 0xb6, script: 0x57, flags: 0x0},
-	705:  {region: 0xb8, script: 0x57, flags: 0x0},
-	706:  {region: 0x4b, script: 0x57, flags: 0x0},
-	707:  {region: 0x4b, script: 0x57, flags: 0x0},
-	708:  {region: 0xa4, script: 0x57, flags: 0x0},
-	709:  {region: 0xa4, script: 0x57, flags: 0x0},
-	710:  {region: 0x9c, script: 0x5, flags: 0x0},
-	711:  {region: 0xb8, script: 0x57, flags: 0x0},
-	712:  {region: 0x123, script: 0xdf, flags: 0x0},
-	713:  {region: 0x53, script: 0x38, flags: 0x0},
-	714:  {region: 0x12b, script: 0x57, flags: 0x0},
-	715:  {region: 0x95, script: 0x57, flags: 0x0},
-	716:  {region: 0x52, script: 0x57, flags: 0x0},
-	717:  {region: 0x99, script: 0x21, flags: 0x0},
-	718:  {region: 0x99, script: 0x21, flags: 0x0},
-	719:  {region: 0x95, script: 0x57, flags: 0x0},
-	720:  {region: 0x23, script: 0x3, flags: 0x1},
-	721:  {region: 0xa4, script: 0x57, flags: 0x0},
-	722:  {region: 0x165, script: 0x57, flags: 0x0},
-	723:  {region: 0xcf, script: 0x57, flags: 0x0},
-	724:  {region: 0x165, script: 0x57, flags: 0x0},
-	725:  {region: 0x165, script: 0x57, flags: 0x0},
-	726:  {region: 0x165, script: 0x57, flags: 0x0},
-	727:  {region: 0x165, script: 0x57, flags: 0x0},
-	728:  {region: 0x165, script: 0x57, flags: 0x0},
-	729:  {region: 0x165, script: 0x57, flags: 0x0},
-	730:  {region: 0x165, script: 0x57, flags: 0x0},
-	731:  {region: 0x165, script: 0x57, flags: 0x0},
-	732:  {region: 0x165, script: 0x57, flags: 0x0},
-	733:  {region: 0x165, script: 0x57, flags: 0x0},
-	734:  {region: 0x165, script: 0x57, flags: 0x0},
-	735:  {region: 0x165, script: 0x5, flags: 0x0},
-	736:  {region: 0x106, script: 0x1f, flags: 0x0},
-	737:  {region: 0xe7, script: 0x57, flags: 0x0},
-	738:  {region: 0x165, script: 0x57, flags: 0x0},
-	739:  {region: 0x95, script: 0x57, flags: 0x0},
-	740:  {region: 0x165, script: 0x29, flags: 0x0},
-	741:  {region: 0x165, script: 0x57, flags: 0x0},
-	742:  {region: 0x165, script: 0x57, flags: 0x0},
-	743:  {region: 0x165, script: 0x57, flags: 0x0},
-	744:  {region: 0x112, script: 0x57, flags: 0x0},
-	745:  {region: 0xa4, script: 0x57, flags: 0x0},
-	746:  {region: 0x165, script: 0x57, flags: 0x0},
-	747:  {region: 0x165, script: 0x57, flags: 0x0},
-	748:  {region: 0x123, script: 0x5, flags: 0x0},
-	749:  {region: 0xcc, script: 0x57, flags: 0x0},
-	750:  {region: 0x165, script: 0x57, flags: 0x0},
-	751:  {region: 0x165, script: 0x57, flags: 0x0},
-	752:  {region: 0x165, script: 0x57, flags: 0x0},
-	753:  {region: 0xbf, script: 0x57, flags: 0x0},
-	754:  {region: 0xd1, script: 0x57, flags: 0x0},
-	755:  {region: 0x165, script: 0x57, flags: 0x0},
-	756:  {region: 0x52, script: 0x57, flags: 0x0},
-	757:  {region: 0xdb, script: 0x21, flags: 0x0},
-	758:  {region: 0x12f, script: 0x57, flags: 0x0},
-	759:  {region: 0xc0, script: 0x57, flags: 0x0},
-	760:  {region: 0x165, script: 0x57, flags: 0x0},
-	761:  {region: 0x165, script: 0x57, flags: 0x0},
-	762:  {region: 0xe0, script: 0x57, flags: 0x0},
-	763:  {region: 0x165, script: 0x57, flags: 0x0},
-	764:  {region: 0x95, script: 0x57, flags: 0x0},
-	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
-	766:  {region: 0x165, script: 0x57, flags: 0x0},
-	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
-	768:  {region: 0x165, script: 0x5, flags: 0x0},
-	769:  {region: 0x165, script: 0x57, flags: 0x0},
-	770:  {region: 0x165, script: 0x57, flags: 0x0},
-	771:  {region: 0x165, script: 0x57, flags: 0x0},
-	772:  {region: 0x99, script: 0x6b, flags: 0x0},
-	773:  {region: 0x165, script: 0x57, flags: 0x0},
-	774:  {region: 0x165, script: 0x57, flags: 0x0},
-	775:  {region: 0x10b, script: 0x57, flags: 0x0},
-	776:  {region: 0x165, script: 0x57, flags: 0x0},
-	777:  {region: 0x165, script: 0x57, flags: 0x0},
-	778:  {region: 0x165, script: 0x57, flags: 0x0},
-	779:  {region: 0x26, script: 0x3, flags: 0x1},
-	780:  {region: 0x165, script: 0x57, flags: 0x0},
-	781:  {region: 0x165, script: 0x57, flags: 0x0},
-	782:  {region: 0x99, script: 0xe, flags: 0x0},
-	783:  {region: 0xc4, script: 0x72, flags: 0x0},
-	785:  {region: 0x165, script: 0x57, flags: 0x0},
-	786:  {region: 0x49, script: 0x57, flags: 0x0},
-	787:  {region: 0x49, script: 0x57, flags: 0x0},
-	788:  {region: 0x37, script: 0x57, flags: 0x0},
-	789:  {region: 0x165, script: 0x57, flags: 0x0},
-	790:  {region: 0x165, script: 0x57, flags: 0x0},
-	791:  {region: 0x165, script: 0x57, flags: 0x0},
-	792:  {region: 0x165, script: 0x57, flags: 0x0},
-	793:  {region: 0x165, script: 0x57, flags: 0x0},
-	794:  {region: 0x165, script: 0x57, flags: 0x0},
-	795:  {region: 0x99, script: 0x21, flags: 0x0},
-	796:  {region: 0xdb, script: 0x21, flags: 0x0},
-	797:  {region: 0x106, script: 0x1f, flags: 0x0},
-	798:  {region: 0x35, script: 0x6f, flags: 0x0},
-	799:  {region: 0x29, script: 0x3, flags: 0x1},
-	800:  {region: 0xcb, script: 0x57, flags: 0x0},
-	801:  {region: 0x165, script: 0x57, flags: 0x0},
-	802:  {region: 0x165, script: 0x57, flags: 0x0},
-	803:  {region: 0x165, script: 0x57, flags: 0x0},
-	804:  {region: 0x99, script: 0x21, flags: 0x0},
-	805:  {region: 0x52, script: 0x57, flags: 0x0},
-	807:  {region: 0x165, script: 0x57, flags: 0x0},
-	808:  {region: 0x135, script: 0x57, flags: 0x0},
-	809:  {region: 0x165, script: 0x57, flags: 0x0},
-	810:  {region: 0x165, script: 0x57, flags: 0x0},
-	811:  {region: 0xe8, script: 0x5, flags: 0x0},
-	812:  {region: 0xc3, script: 0x57, flags: 0x0},
-	813:  {region: 0x99, script: 0x21, flags: 0x0},
-	814:  {region: 0x95, script: 0x57, flags: 0x0},
-	815:  {region: 0x164, script: 0x57, flags: 0x0},
-	816:  {region: 0x165, script: 0x57, flags: 0x0},
-	817:  {region: 0xc4, script: 0x72, flags: 0x0},
-	818:  {region: 0x165, script: 0x57, flags: 0x0},
-	819:  {region: 0x165, script: 0x29, flags: 0x0},
-	820:  {region: 0x106, script: 0x1f, flags: 0x0},
-	821:  {region: 0x165, script: 0x57, flags: 0x0},
-	822:  {region: 0x131, script: 0x57, flags: 0x0},
-	823:  {region: 0x9c, script: 0x63, flags: 0x0},
-	824:  {region: 0x165, script: 0x57, flags: 0x0},
-	825:  {region: 0x165, script: 0x57, flags: 0x0},
-	826:  {region: 0x9c, script: 0x5, flags: 0x0},
-	827:  {region: 0x165, script: 0x57, flags: 0x0},
-	828:  {region: 0x165, script: 0x57, flags: 0x0},
-	829:  {region: 0x165, script: 0x57, flags: 0x0},
-	830:  {region: 0xdd, script: 0x57, flags: 0x0},
-	831:  {region: 0x165, script: 0x57, flags: 0x0},
-	832:  {region: 0x165, script: 0x57, flags: 0x0},
-	834:  {region: 0x165, script: 0x57, flags: 0x0},
-	835:  {region: 0x53, script: 0x38, flags: 0x0},
-	836:  {region: 0x9e, script: 0x57, flags: 0x0},
-	837:  {region: 0xd2, script: 0x57, flags: 0x0},
-	838:  {region: 0x165, script: 0x57, flags: 0x0},
-	839:  {region: 0xda, script: 0x57, flags: 0x0},
-	840:  {region: 0x165, script: 0x57, flags: 0x0},
-	841:  {region: 0x165, script: 0x57, flags: 0x0},
-	842:  {region: 0x165, script: 0x57, flags: 0x0},
-	843:  {region: 0xcf, script: 0x57, flags: 0x0},
-	844:  {region: 0x165, script: 0x57, flags: 0x0},
-	845:  {region: 0x165, script: 0x57, flags: 0x0},
-	846:  {region: 0x164, script: 0x57, flags: 0x0},
-	847:  {region: 0xd1, script: 0x57, flags: 0x0},
-	848:  {region: 0x60, script: 0x57, flags: 0x0},
-	849:  {region: 0xdb, script: 0x21, flags: 0x0},
-	850:  {region: 0x165, script: 0x57, flags: 0x0},
-	851:  {region: 0xdb, script: 0x21, flags: 0x0},
-	852:  {region: 0x165, script: 0x57, flags: 0x0},
-	853:  {region: 0x165, script: 0x57, flags: 0x0},
-	854:  {region: 0xd2, script: 0x57, flags: 0x0},
-	855:  {region: 0x165, script: 0x57, flags: 0x0},
-	856:  {region: 0x165, script: 0x57, flags: 0x0},
-	857:  {region: 0xd1, script: 0x57, flags: 0x0},
-	858:  {region: 0x165, script: 0x57, flags: 0x0},
-	859:  {region: 0xcf, script: 0x57, flags: 0x0},
-	860:  {region: 0xcf, script: 0x57, flags: 0x0},
-	861:  {region: 0x165, script: 0x57, flags: 0x0},
-	862:  {region: 0x165, script: 0x57, flags: 0x0},
-	863:  {region: 0x95, script: 0x57, flags: 0x0},
-	864:  {region: 0x165, script: 0x57, flags: 0x0},
-	865:  {region: 0xdf, script: 0x57, flags: 0x0},
-	866:  {region: 0x165, script: 0x57, flags: 0x0},
-	867:  {region: 0x165, script: 0x57, flags: 0x0},
-	868:  {region: 0x99, script: 0x57, flags: 0x0},
-	869:  {region: 0x165, script: 0x57, flags: 0x0},
-	870:  {region: 0x165, script: 0x57, flags: 0x0},
-	871:  {region: 0xd9, script: 0x57, flags: 0x0},
-	872:  {region: 0x52, script: 0x57, flags: 0x0},
-	873:  {region: 0x165, script: 0x57, flags: 0x0},
-	874:  {region: 0xda, script: 0x57, flags: 0x0},
-	875:  {region: 0x165, script: 0x57, flags: 0x0},
-	876:  {region: 0x52, script: 0x57, flags: 0x0},
-	877:  {region: 0x165, script: 0x57, flags: 0x0},
-	878:  {region: 0x165, script: 0x57, flags: 0x0},
-	879:  {region: 0xda, script: 0x57, flags: 0x0},
-	880:  {region: 0x123, script: 0x53, flags: 0x0},
-	881:  {region: 0x99, script: 0x21, flags: 0x0},
-	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
-	883:  {region: 0x165, script: 0x57, flags: 0x0},
-	884:  {region: 0x165, script: 0x57, flags: 0x0},
-	885:  {region: 0x84, script: 0x78, flags: 0x0},
-	886:  {region: 0x161, script: 0x57, flags: 0x0},
-	887:  {region: 0x165, script: 0x57, flags: 0x0},
-	888:  {region: 0x49, script: 0x17, flags: 0x0},
-	889:  {region: 0x165, script: 0x57, flags: 0x0},
-	890:  {region: 0x161, script: 0x57, flags: 0x0},
-	891:  {region: 0x165, script: 0x57, flags: 0x0},
-	892:  {region: 0x165, script: 0x57, flags: 0x0},
-	893:  {region: 0x165, script: 0x57, flags: 0x0},
-	894:  {region: 0x165, script: 0x57, flags: 0x0},
-	895:  {region: 0x165, script: 0x57, flags: 0x0},
-	896:  {region: 0x117, script: 0x57, flags: 0x0},
-	897:  {region: 0x165, script: 0x57, flags: 0x0},
-	898:  {region: 0x165, script: 0x57, flags: 0x0},
-	899:  {region: 0x135, script: 0x57, flags: 0x0},
-	900:  {region: 0x165, script: 0x57, flags: 0x0},
-	901:  {region: 0x53, script: 0x57, flags: 0x0},
-	902:  {region: 0x165, script: 0x57, flags: 0x0},
-	903:  {region: 0xce, script: 0x57, flags: 0x0},
-	904:  {region: 0x12f, script: 0x57, flags: 0x0},
-	905:  {region: 0x131, script: 0x57, flags: 0x0},
-	906:  {region: 0x80, script: 0x57, flags: 0x0},
-	907:  {region: 0x78, script: 0x57, flags: 0x0},
-	908:  {region: 0x165, script: 0x57, flags: 0x0},
-	910:  {region: 0x165, script: 0x57, flags: 0x0},
-	911:  {region: 0x165, script: 0x57, flags: 0x0},
-	912:  {region: 0x6f, script: 0x57, flags: 0x0},
-	913:  {region: 0x165, script: 0x57, flags: 0x0},
-	914:  {region: 0x165, script: 0x57, flags: 0x0},
-	915:  {region: 0x165, script: 0x57, flags: 0x0},
-	916:  {region: 0x165, script: 0x57, flags: 0x0},
-	917:  {region: 0x99, script: 0x7d, flags: 0x0},
-	918:  {region: 0x165, script: 0x57, flags: 0x0},
-	919:  {region: 0x165, script: 0x5, flags: 0x0},
-	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
-	921:  {region: 0x135, script: 0x7e, flags: 0x0},
-	922:  {region: 0x165, script: 0x5, flags: 0x0},
-	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
-	924:  {region: 0x165, script: 0x57, flags: 0x0},
-	925:  {region: 0x2c, script: 0x3, flags: 0x1},
-	926:  {region: 0xe7, script: 0x57, flags: 0x0},
-	927:  {region: 0x2f, script: 0x2, flags: 0x1},
-	928:  {region: 0xe7, script: 0x57, flags: 0x0},
-	929:  {region: 0x30, script: 0x57, flags: 0x0},
-	930:  {region: 0xf0, script: 0x57, flags: 0x0},
-	931:  {region: 0x165, script: 0x57, flags: 0x0},
-	932:  {region: 0x78, script: 0x57, flags: 0x0},
-	933:  {region: 0xd6, script: 0x57, flags: 0x0},
-	934:  {region: 0x135, script: 0x57, flags: 0x0},
-	935:  {region: 0x49, script: 0x57, flags: 0x0},
-	936:  {region: 0x165, script: 0x57, flags: 0x0},
-	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
-	938:  {region: 0x165, script: 0x57, flags: 0x0},
-	939:  {region: 0x60, script: 0x57, flags: 0x0},
-	940:  {region: 0x165, script: 0x5, flags: 0x0},
-	941:  {region: 0xb0, script: 0x87, flags: 0x0},
-	943:  {region: 0x165, script: 0x57, flags: 0x0},
-	944:  {region: 0x165, script: 0x57, flags: 0x0},
-	945:  {region: 0x99, script: 0x12, flags: 0x0},
-	946:  {region: 0xa4, script: 0x57, flags: 0x0},
-	947:  {region: 0xe9, script: 0x57, flags: 0x0},
-	948:  {region: 0x165, script: 0x57, flags: 0x0},
-	949:  {region: 0x9e, script: 0x57, flags: 0x0},
-	950:  {region: 0x165, script: 0x57, flags: 0x0},
-	951:  {region: 0x165, script: 0x57, flags: 0x0},
-	952:  {region: 0x87, script: 0x31, flags: 0x0},
-	953:  {region: 0x75, script: 0x57, flags: 0x0},
-	954:  {region: 0x165, script: 0x57, flags: 0x0},
-	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
-	956:  {region: 0x9c, script: 0x5, flags: 0x0},
-	957:  {region: 0x1, script: 0x57, flags: 0x0},
-	958:  {region: 0x24, script: 0x5, flags: 0x0},
-	959:  {region: 0x165, script: 0x57, flags: 0x0},
-	960:  {region: 0x41, script: 0x57, flags: 0x0},
-	961:  {region: 0x165, script: 0x57, flags: 0x0},
-	962:  {region: 0x7a, script: 0x57, flags: 0x0},
-	963:  {region: 0x165, script: 0x57, flags: 0x0},
-	964:  {region: 0xe4, script: 0x57, flags: 0x0},
-	965:  {region: 0x89, script: 0x57, flags: 0x0},
-	966:  {region: 0x69, script: 0x57, flags: 0x0},
-	967:  {region: 0x165, script: 0x57, flags: 0x0},
-	968:  {region: 0x99, script: 0x21, flags: 0x0},
-	969:  {region: 0x165, script: 0x57, flags: 0x0},
-	970:  {region: 0x102, script: 0x57, flags: 0x0},
-	971:  {region: 0x95, script: 0x57, flags: 0x0},
-	972:  {region: 0x165, script: 0x57, flags: 0x0},
-	973:  {region: 0x165, script: 0x57, flags: 0x0},
-	974:  {region: 0x9e, script: 0x57, flags: 0x0},
-	975:  {region: 0x165, script: 0x5, flags: 0x0},
-	976:  {region: 0x99, script: 0x57, flags: 0x0},
-	977:  {region: 0x31, script: 0x2, flags: 0x1},
-	978:  {region: 0xdb, script: 0x21, flags: 0x0},
-	979:  {region: 0x35, script: 0xe, flags: 0x0},
-	980:  {region: 0x4e, script: 0x57, flags: 0x0},
-	981:  {region: 0x72, script: 0x57, flags: 0x0},
-	982:  {region: 0x4e, script: 0x57, flags: 0x0},
-	983:  {region: 0x9c, script: 0x5, flags: 0x0},
-	984:  {region: 0x10c, script: 0x57, flags: 0x0},
-	985:  {region: 0x3a, script: 0x57, flags: 0x0},
-	986:  {region: 0x165, script: 0x57, flags: 0x0},
-	987:  {region: 0xd1, script: 0x57, flags: 0x0},
-	988:  {region: 0x104, script: 0x57, flags: 0x0},
-	989:  {region: 0x95, script: 0x57, flags: 0x0},
-	990:  {region: 0x12f, script: 0x57, flags: 0x0},
-	991:  {region: 0x165, script: 0x57, flags: 0x0},
-	992:  {region: 0x165, script: 0x57, flags: 0x0},
-	993:  {region: 0x73, script: 0x57, flags: 0x0},
-	994:  {region: 0x106, script: 0x1f, flags: 0x0},
-	995:  {region: 0x130, script: 0x1f, flags: 0x0},
-	996:  {region: 0x109, script: 0x57, flags: 0x0},
-	997:  {region: 0x107, script: 0x57, flags: 0x0},
-	998:  {region: 0x12f, script: 0x57, flags: 0x0},
-	999:  {region: 0x165, script: 0x57, flags: 0x0},
-	1000: {region: 0xa2, script: 0x49, flags: 0x0},
-	1001: {region: 0x99, script: 0x21, flags: 0x0},
-	1002: {region: 0x80, script: 0x57, flags: 0x0},
-	1003: {region: 0x106, script: 0x1f, flags: 0x0},
-	1004: {region: 0xa4, script: 0x57, flags: 0x0},
-	1005: {region: 0x95, script: 0x57, flags: 0x0},
-	1006: {region: 0x99, script: 0x57, flags: 0x0},
-	1007: {region: 0x114, script: 0x57, flags: 0x0},
-	1008: {region: 0x99, script: 0xc3, flags: 0x0},
-	1009: {region: 0x165, script: 0x57, flags: 0x0},
-	1010: {region: 0x165, script: 0x57, flags: 0x0},
-	1011: {region: 0x12f, script: 0x57, flags: 0x0},
-	1012: {region: 0x9e, script: 0x57, flags: 0x0},
-	1013: {region: 0x99, script: 0x21, flags: 0x0},
-	1014: {region: 0x165, script: 0x5, flags: 0x0},
-	1015: {region: 0x9e, script: 0x57, flags: 0x0},
-	1016: {region: 0x7b, script: 0x57, flags: 0x0},
-	1017: {region: 0x49, script: 0x57, flags: 0x0},
-	1018: {region: 0x33, script: 0x4, flags: 0x1},
-	1019: {region: 0x9e, script: 0x57, flags: 0x0},
-	1020: {region: 0x9c, script: 0x5, flags: 0x0},
-	1021: {region: 0xda, script: 0x57, flags: 0x0},
-	1022: {region: 0x4f, script: 0x57, flags: 0x0},
-	1023: {region: 0xd1, script: 0x57, flags: 0x0},
-	1024: {region: 0xcf, script: 0x57, flags: 0x0},
-	1025: {region: 0xc3, script: 0x57, flags: 0x0},
-	1026: {region: 0x4c, script: 0x57, flags: 0x0},
-	1027: {region: 0x96, script: 0x7a, flags: 0x0},
-	1028: {region: 0xb6, script: 0x57, flags: 0x0},
-	1029: {region: 0x165, script: 0x29, flags: 0x0},
-	1030: {region: 0x165, script: 0x57, flags: 0x0},
-	1032: {region: 0xba, script: 0xdc, flags: 0x0},
-	1033: {region: 0x165, script: 0x57, flags: 0x0},
-	1034: {region: 0xc4, script: 0x72, flags: 0x0},
-	1035: {region: 0x165, script: 0x5, flags: 0x0},
-	1036: {region: 0xb3, script: 0xca, flags: 0x0},
-	1037: {region: 0x6f, script: 0x57, flags: 0x0},
-	1038: {region: 0x165, script: 0x57, flags: 0x0},
-	1039: {region: 0x165, script: 0x57, flags: 0x0},
-	1040: {region: 0x165, script: 0x57, flags: 0x0},
-	1041: {region: 0x165, script: 0x57, flags: 0x0},
-	1042: {region: 0x111, script: 0x57, flags: 0x0},
-	1043: {region: 0x165, script: 0x57, flags: 0x0},
-	1044: {region: 0xe8, script: 0x5, flags: 0x0},
-	1045: {region: 0x165, script: 0x57, flags: 0x0},
-	1046: {region: 0x10f, script: 0x57, flags: 0x0},
-	1047: {region: 0x165, script: 0x57, flags: 0x0},
-	1048: {region: 0xe9, script: 0x57, flags: 0x0},
-	1049: {region: 0x165, script: 0x57, flags: 0x0},
-	1050: {region: 0x95, script: 0x57, flags: 0x0},
-	1051: {region: 0x142, script: 0x57, flags: 0x0},
-	1052: {region: 0x10c, script: 0x57, flags: 0x0},
-	1054: {region: 0x10c, script: 0x57, flags: 0x0},
-	1055: {region: 0x72, script: 0x57, flags: 0x0},
-	1056: {region: 0x97, script: 0xc0, flags: 0x0},
-	1057: {region: 0x165, script: 0x57, flags: 0x0},
-	1058: {region: 0x72, script: 0x57, flags: 0x0},
-	1059: {region: 0x164, script: 0x57, flags: 0x0},
-	1060: {region: 0x165, script: 0x57, flags: 0x0},
-	1061: {region: 0xc3, script: 0x57, flags: 0x0},
-	1062: {region: 0x165, script: 0x57, flags: 0x0},
-	1063: {region: 0x165, script: 0x57, flags: 0x0},
-	1064: {region: 0x165, script: 0x57, flags: 0x0},
-	1065: {region: 0x115, script: 0x57, flags: 0x0},
-	1066: {region: 0x165, script: 0x57, flags: 0x0},
-	1067: {region: 0x165, script: 0x57, flags: 0x0},
-	1068: {region: 0x123, script: 0xdf, flags: 0x0},
-	1069: {region: 0x165, script: 0x57, flags: 0x0},
-	1070: {region: 0x165, script: 0x57, flags: 0x0},
-	1071: {region: 0x165, script: 0x57, flags: 0x0},
-	1072: {region: 0x165, script: 0x57, flags: 0x0},
-	1073: {region: 0x27, script: 0x57, flags: 0x0},
-	1074: {region: 0x37, script: 0x5, flags: 0x1},
-	1075: {region: 0x99, script: 0xcb, flags: 0x0},
-	1076: {region: 0x116, script: 0x57, flags: 0x0},
-	1077: {region: 0x114, script: 0x57, flags: 0x0},
-	1078: {region: 0x99, script: 0x21, flags: 0x0},
-	1079: {region: 0x161, script: 0x57, flags: 0x0},
-	1080: {region: 0x165, script: 0x57, flags: 0x0},
-	1081: {region: 0x165, script: 0x57, flags: 0x0},
-	1082: {region: 0x6d, script: 0x57, flags: 0x0},
-	1083: {region: 0x161, script: 0x57, flags: 0x0},
-	1084: {region: 0x165, script: 0x57, flags: 0x0},
-	1085: {region: 0x60, script: 0x57, flags: 0x0},
-	1086: {region: 0x95, script: 0x57, flags: 0x0},
-	1087: {region: 0x165, script: 0x57, flags: 0x0},
-	1088: {region: 0x165, script: 0x57, flags: 0x0},
-	1089: {region: 0x12f, script: 0x57, flags: 0x0},
-	1090: {region: 0x165, script: 0x57, flags: 0x0},
-	1091: {region: 0x84, script: 0x57, flags: 0x0},
-	1092: {region: 0x10c, script: 0x57, flags: 0x0},
-	1093: {region: 0x12f, script: 0x57, flags: 0x0},
-	1094: {region: 0x15f, script: 0x5, flags: 0x0},
-	1095: {region: 0x4b, script: 0x57, flags: 0x0},
-	1096: {region: 0x60, script: 0x57, flags: 0x0},
-	1097: {region: 0x165, script: 0x57, flags: 0x0},
-	1098: {region: 0x99, script: 0x21, flags: 0x0},
-	1099: {region: 0x95, script: 0x57, flags: 0x0},
-	1100: {region: 0x165, script: 0x57, flags: 0x0},
-	1101: {region: 0x35, script: 0xe, flags: 0x0},
-	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
-	1103: {region: 0xe9, script: 0x57, flags: 0x0},
-	1104: {region: 0x99, script: 0xd7, flags: 0x0},
-	1105: {region: 0xdb, script: 0x21, flags: 0x0},
-	1106: {region: 0x165, script: 0x57, flags: 0x0},
-	1107: {region: 0x165, script: 0x57, flags: 0x0},
-	1108: {region: 0x165, script: 0x57, flags: 0x0},
-	1109: {region: 0x165, script: 0x57, flags: 0x0},
-	1110: {region: 0x165, script: 0x57, flags: 0x0},
-	1111: {region: 0x165, script: 0x57, flags: 0x0},
-	1112: {region: 0x165, script: 0x57, flags: 0x0},
-	1113: {region: 0x165, script: 0x57, flags: 0x0},
-	1114: {region: 0xe7, script: 0x57, flags: 0x0},
-	1115: {region: 0x165, script: 0x57, flags: 0x0},
-	1116: {region: 0x165, script: 0x57, flags: 0x0},
-	1117: {region: 0x99, script: 0x4f, flags: 0x0},
-	1118: {region: 0x53, script: 0xd5, flags: 0x0},
-	1119: {region: 0xdb, script: 0x21, flags: 0x0},
-	1120: {region: 0xdb, script: 0x21, flags: 0x0},
-	1121: {region: 0x99, script: 0xda, flags: 0x0},
-	1122: {region: 0x165, script: 0x57, flags: 0x0},
-	1123: {region: 0x112, script: 0x57, flags: 0x0},
-	1124: {region: 0x131, script: 0x57, flags: 0x0},
-	1125: {region: 0x126, script: 0x57, flags: 0x0},
-	1126: {region: 0x165, script: 0x57, flags: 0x0},
-	1127: {region: 0x3c, script: 0x3, flags: 0x1},
-	1128: {region: 0x165, script: 0x57, flags: 0x0},
-	1129: {region: 0x165, script: 0x57, flags: 0x0},
-	1130: {region: 0x165, script: 0x57, flags: 0x0},
-	1131: {region: 0x123, script: 0xdf, flags: 0x0},
-	1132: {region: 0xdb, script: 0x21, flags: 0x0},
-	1133: {region: 0xdb, script: 0x21, flags: 0x0},
-	1134: {region: 0xdb, script: 0x21, flags: 0x0},
-	1135: {region: 0x6f, script: 0x29, flags: 0x0},
-	1136: {region: 0x165, script: 0x57, flags: 0x0},
-	1137: {region: 0x6d, script: 0x29, flags: 0x0},
-	1138: {region: 0x165, script: 0x57, flags: 0x0},
-	1139: {region: 0x165, script: 0x57, flags: 0x0},
-	1140: {region: 0x165, script: 0x57, flags: 0x0},
-	1141: {region: 0xd6, script: 0x57, flags: 0x0},
-	1142: {region: 0x127, script: 0x57, flags: 0x0},
-	1143: {region: 0x125, script: 0x57, flags: 0x0},
-	1144: {region: 0x32, script: 0x57, flags: 0x0},
-	1145: {region: 0xdb, script: 0x21, flags: 0x0},
-	1146: {region: 0xe7, script: 0x57, flags: 0x0},
-	1147: {region: 0x165, script: 0x57, flags: 0x0},
-	1148: {region: 0x165, script: 0x57, flags: 0x0},
-	1149: {region: 0x32, script: 0x57, flags: 0x0},
-	1150: {region: 0xd4, script: 0x57, flags: 0x0},
-	1151: {region: 0x165, script: 0x57, flags: 0x0},
-	1152: {region: 0x161, script: 0x57, flags: 0x0},
-	1153: {region: 0x165, script: 0x57, flags: 0x0},
-	1154: {region: 0x129, script: 0x57, flags: 0x0},
-	1155: {region: 0x165, script: 0x57, flags: 0x0},
-	1156: {region: 0xce, script: 0x57, flags: 0x0},
-	1157: {region: 0x165, script: 0x57, flags: 0x0},
-	1158: {region: 0xe6, script: 0x57, flags: 0x0},
-	1159: {region: 0x165, script: 0x57, flags: 0x0},
-	1160: {region: 0x165, script: 0x57, flags: 0x0},
-	1161: {region: 0x165, script: 0x57, flags: 0x0},
-	1162: {region: 0x12b, script: 0x57, flags: 0x0},
-	1163: {region: 0x12b, script: 0x57, flags: 0x0},
-	1164: {region: 0x12e, script: 0x57, flags: 0x0},
-	1165: {region: 0x165, script: 0x5, flags: 0x0},
-	1166: {region: 0x161, script: 0x57, flags: 0x0},
-	1167: {region: 0x87, script: 0x31, flags: 0x0},
-	1168: {region: 0xdb, script: 0x21, flags: 0x0},
-	1169: {region: 0xe7, script: 0x57, flags: 0x0},
-	1170: {region: 0x43, script: 0xe0, flags: 0x0},
-	1171: {region: 0x165, script: 0x57, flags: 0x0},
-	1172: {region: 0x106, script: 0x1f, flags: 0x0},
-	1173: {region: 0x165, script: 0x57, flags: 0x0},
-	1174: {region: 0x165, script: 0x57, flags: 0x0},
-	1175: {region: 0x131, script: 0x57, flags: 0x0},
-	1176: {region: 0x165, script: 0x57, flags: 0x0},
-	1177: {region: 0x123, script: 0xdf, flags: 0x0},
-	1178: {region: 0x32, script: 0x57, flags: 0x0},
-	1179: {region: 0x165, script: 0x57, flags: 0x0},
-	1180: {region: 0x165, script: 0x57, flags: 0x0},
-	1181: {region: 0xce, script: 0x57, flags: 0x0},
-	1182: {region: 0x165, script: 0x57, flags: 0x0},
-	1183: {region: 0x165, script: 0x57, flags: 0x0},
-	1184: {region: 0x12d, script: 0x57, flags: 0x0},
-	1185: {region: 0x165, script: 0x57, flags: 0x0},
-	1187: {region: 0x165, script: 0x57, flags: 0x0},
-	1188: {region: 0xd4, script: 0x57, flags: 0x0},
-	1189: {region: 0x53, script: 0xd8, flags: 0x0},
-	1190: {region: 0xe5, script: 0x57, flags: 0x0},
-	1191: {region: 0x165, script: 0x57, flags: 0x0},
-	1192: {region: 0x106, script: 0x1f, flags: 0x0},
-	1193: {region: 0xba, script: 0x57, flags: 0x0},
-	1194: {region: 0x165, script: 0x57, flags: 0x0},
-	1195: {region: 0x106, script: 0x1f, flags: 0x0},
-	1196: {region: 0x3f, script: 0x4, flags: 0x1},
-	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
-	1198: {region: 0x130, script: 0x1f, flags: 0x0},
-	1199: {region: 0x75, script: 0x57, flags: 0x0},
-	1200: {region: 0x2a, script: 0x57, flags: 0x0},
-	1202: {region: 0x43, script: 0x3, flags: 0x1},
-	1203: {region: 0x99, script: 0xe, flags: 0x0},
-	1204: {region: 0xe8, script: 0x5, flags: 0x0},
-	1205: {region: 0x165, script: 0x57, flags: 0x0},
-	1206: {region: 0x165, script: 0x57, flags: 0x0},
-	1207: {region: 0x165, script: 0x57, flags: 0x0},
-	1208: {region: 0x165, script: 0x57, flags: 0x0},
-	1209: {region: 0x165, script: 0x57, flags: 0x0},
-	1210: {region: 0x165, script: 0x57, flags: 0x0},
-	1211: {region: 0x165, script: 0x57, flags: 0x0},
-	1212: {region: 0x46, script: 0x4, flags: 0x1},
-	1213: {region: 0x165, script: 0x57, flags: 0x0},
-	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
-	1215: {region: 0x165, script: 0x57, flags: 0x0},
-	1216: {region: 0x161, script: 0x57, flags: 0x0},
-	1217: {region: 0x9e, script: 0x57, flags: 0x0},
-	1218: {region: 0x106, script: 0x57, flags: 0x0},
-	1219: {region: 0x13e, script: 0x57, flags: 0x0},
-	1220: {region: 0x11b, script: 0x57, flags: 0x0},
-	1221: {region: 0x165, script: 0x57, flags: 0x0},
-	1222: {region: 0x36, script: 0x57, flags: 0x0},
-	1223: {region: 0x60, script: 0x57, flags: 0x0},
-	1224: {region: 0xd1, script: 0x57, flags: 0x0},
-	1225: {region: 0x1, script: 0x57, flags: 0x0},
-	1226: {region: 0x106, script: 0x57, flags: 0x0},
-	1227: {region: 0x6a, script: 0x57, flags: 0x0},
-	1228: {region: 0x12f, script: 0x57, flags: 0x0},
-	1229: {region: 0x165, script: 0x57, flags: 0x0},
-	1230: {region: 0x36, script: 0x57, flags: 0x0},
-	1231: {region: 0x4e, script: 0x57, flags: 0x0},
-	1232: {region: 0x165, script: 0x57, flags: 0x0},
-	1233: {region: 0x6f, script: 0x29, flags: 0x0},
-	1234: {region: 0x165, script: 0x57, flags: 0x0},
-	1235: {region: 0xe7, script: 0x57, flags: 0x0},
-	1236: {region: 0x2f, script: 0x57, flags: 0x0},
-	1237: {region: 0x99, script: 0xda, flags: 0x0},
-	1238: {region: 0x99, script: 0x21, flags: 0x0},
-	1239: {region: 0x165, script: 0x57, flags: 0x0},
-	1240: {region: 0x165, script: 0x57, flags: 0x0},
-	1241: {region: 0x165, script: 0x57, flags: 0x0},
-	1242: {region: 0x165, script: 0x57, flags: 0x0},
-	1243: {region: 0x165, script: 0x57, flags: 0x0},
-	1244: {region: 0x165, script: 0x57, flags: 0x0},
-	1245: {region: 0x165, script: 0x57, flags: 0x0},
-	1246: {region: 0x165, script: 0x57, flags: 0x0},
-	1247: {region: 0x165, script: 0x57, flags: 0x0},
-	1248: {region: 0x140, script: 0x57, flags: 0x0},
-	1249: {region: 0x165, script: 0x57, flags: 0x0},
-	1250: {region: 0x165, script: 0x57, flags: 0x0},
-	1251: {region: 0xa8, script: 0x5, flags: 0x0},
-	1252: {region: 0x165, script: 0x57, flags: 0x0},
-	1253: {region: 0x114, script: 0x57, flags: 0x0},
-	1254: {region: 0x165, script: 0x57, flags: 0x0},
-	1255: {region: 0x165, script: 0x57, flags: 0x0},
-	1256: {region: 0x165, script: 0x57, flags: 0x0},
-	1257: {region: 0x165, script: 0x57, flags: 0x0},
-	1258: {region: 0x99, script: 0x21, flags: 0x0},
-	1259: {region: 0x53, script: 0x38, flags: 0x0},
-	1260: {region: 0x165, script: 0x57, flags: 0x0},
-	1261: {region: 0x165, script: 0x57, flags: 0x0},
-	1262: {region: 0x41, script: 0x57, flags: 0x0},
-	1263: {region: 0x165, script: 0x57, flags: 0x0},
-	1264: {region: 0x12b, script: 0x18, flags: 0x0},
-	1265: {region: 0x165, script: 0x57, flags: 0x0},
-	1266: {region: 0x161, script: 0x57, flags: 0x0},
-	1267: {region: 0x165, script: 0x57, flags: 0x0},
-	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
-	1269: {region: 0x12b, script: 0x60, flags: 0x0},
-	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
-	1271: {region: 0x53, script: 0x64, flags: 0x0},
-	1272: {region: 0x10b, script: 0x69, flags: 0x0},
-	1273: {region: 0x108, script: 0x73, flags: 0x0},
-	1274: {region: 0x99, script: 0x21, flags: 0x0},
-	1275: {region: 0x131, script: 0x57, flags: 0x0},
-	1276: {region: 0x165, script: 0x57, flags: 0x0},
-	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
-	1278: {region: 0x165, script: 0x57, flags: 0x0},
-	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
-	1280: {region: 0x165, script: 0x57, flags: 0x0},
-	1281: {region: 0x165, script: 0x57, flags: 0x0},
-	1282: {region: 0xdb, script: 0x21, flags: 0x0},
-	1283: {region: 0x165, script: 0x57, flags: 0x0},
-	1284: {region: 0x165, script: 0x57, flags: 0x0},
-	1285: {region: 0xd1, script: 0x57, flags: 0x0},
-	1286: {region: 0x75, script: 0x57, flags: 0x0},
-	1287: {region: 0x165, script: 0x57, flags: 0x0},
-	1288: {region: 0x165, script: 0x57, flags: 0x0},
-	1289: {region: 0x52, script: 0x57, flags: 0x0},
-	1290: {region: 0x165, script: 0x57, flags: 0x0},
-	1291: {region: 0x165, script: 0x57, flags: 0x0},
-	1292: {region: 0x165, script: 0x57, flags: 0x0},
-	1293: {region: 0x52, script: 0x57, flags: 0x0},
-	1294: {region: 0x165, script: 0x57, flags: 0x0},
-	1295: {region: 0x165, script: 0x57, flags: 0x0},
-	1296: {region: 0x165, script: 0x57, flags: 0x0},
-	1297: {region: 0x165, script: 0x57, flags: 0x0},
-	1298: {region: 0x1, script: 0x3b, flags: 0x0},
-	1299: {region: 0x165, script: 0x57, flags: 0x0},
-	1300: {region: 0x165, script: 0x57, flags: 0x0},
-	1301: {region: 0x165, script: 0x57, flags: 0x0},
-	1302: {region: 0x165, script: 0x57, flags: 0x0},
-	1303: {region: 0x165, script: 0x57, flags: 0x0},
-	1304: {region: 0xd6, script: 0x57, flags: 0x0},
-	1305: {region: 0x165, script: 0x57, flags: 0x0},
-	1306: {region: 0x165, script: 0x57, flags: 0x0},
-	1307: {region: 0x165, script: 0x57, flags: 0x0},
-	1308: {region: 0x41, script: 0x57, flags: 0x0},
-	1309: {region: 0x165, script: 0x57, flags: 0x0},
-	1310: {region: 0xcf, script: 0x57, flags: 0x0},
-	1311: {region: 0x4a, script: 0x3, flags: 0x1},
-	1312: {region: 0x165, script: 0x57, flags: 0x0},
-	1313: {region: 0x165, script: 0x57, flags: 0x0},
-	1314: {region: 0x165, script: 0x57, flags: 0x0},
-	1315: {region: 0x53, script: 0x57, flags: 0x0},
-	1316: {region: 0x10b, script: 0x57, flags: 0x0},
-	1318: {region: 0xa8, script: 0x5, flags: 0x0},
-	1319: {region: 0xd9, script: 0x57, flags: 0x0},
-	1320: {region: 0xba, script: 0xdc, flags: 0x0},
-	1321: {region: 0x4d, script: 0x14, flags: 0x1},
-	1322: {region: 0x53, script: 0x79, flags: 0x0},
-	1323: {region: 0x165, script: 0x57, flags: 0x0},
-	1324: {region: 0x122, script: 0x57, flags: 0x0},
-	1325: {region: 0xd0, script: 0x57, flags: 0x0},
-	1326: {region: 0x165, script: 0x57, flags: 0x0},
-	1327: {region: 0x161, script: 0x57, flags: 0x0},
-	1329: {region: 0x12b, script: 0x57, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 388 bytes, 97 elements
-var likelyLangList = [97]likelyScriptRegion{
-	0:  {region: 0x9c, script: 0x7, flags: 0x0},
-	1:  {region: 0xa1, script: 0x74, flags: 0x2},
-	2:  {region: 0x11c, script: 0x80, flags: 0x2},
-	3:  {region: 0x32, script: 0x57, flags: 0x0},
-	4:  {region: 0x9b, script: 0x5, flags: 0x4},
-	5:  {region: 0x9c, script: 0x5, flags: 0x4},
-	6:  {region: 0x106, script: 0x1f, flags: 0x4},
-	7:  {region: 0x9c, script: 0x5, flags: 0x2},
-	8:  {region: 0x106, script: 0x1f, flags: 0x0},
-	9:  {region: 0x38, script: 0x2c, flags: 0x2},
-	10: {region: 0x135, script: 0x57, flags: 0x0},
-	11: {region: 0x7b, script: 0xc5, flags: 0x2},
-	12: {region: 0x114, script: 0x57, flags: 0x0},
-	13: {region: 0x84, script: 0x1, flags: 0x2},
-	14: {region: 0x5d, script: 0x1e, flags: 0x0},
-	15: {region: 0x87, script: 0x5c, flags: 0x2},
-	16: {region: 0xd6, script: 0x57, flags: 0x0},
-	17: {region: 0x52, script: 0x5, flags: 0x4},
-	18: {region: 0x10b, script: 0x5, flags: 0x4},
-	19: {region: 0xae, script: 0x1f, flags: 0x0},
-	20: {region: 0x24, script: 0x5, flags: 0x4},
-	21: {region: 0x53, script: 0x5, flags: 0x4},
-	22: {region: 0x9c, script: 0x5, flags: 0x4},
-	23: {region: 0xc5, script: 0x5, flags: 0x4},
-	24: {region: 0x53, script: 0x5, flags: 0x2},
-	25: {region: 0x12b, script: 0x57, flags: 0x0},
-	26: {region: 0xb0, script: 0x5, flags: 0x4},
-	27: {region: 0x9b, script: 0x5, flags: 0x2},
-	28: {region: 0xa5, script: 0x1f, flags: 0x0},
-	29: {region: 0x53, script: 0x5, flags: 0x4},
-	30: {region: 0x12b, script: 0x57, flags: 0x4},
-	31: {region: 0x53, script: 0x5, flags: 0x2},
-	32: {region: 0x12b, script: 0x57, flags: 0x2},
-	33: {region: 0xdb, script: 0x21, flags: 0x0},
-	34: {region: 0x99, script: 0x5a, flags: 0x2},
-	35: {region: 0x83, script: 0x57, flags: 0x0},
-	36: {region: 0x84, script: 0x78, flags: 0x4},
-	37: {region: 0x84, script: 0x78, flags: 0x2},
-	38: {region: 0xc5, script: 0x1f, flags: 0x0},
-	39: {region: 0x53, script: 0x6d, flags: 0x4},
-	40: {region: 0x53, script: 0x6d, flags: 0x2},
-	41: {region: 0xd0, script: 0x57, flags: 0x0},
-	42: {region: 0x4a, script: 0x5, flags: 0x4},
-	43: {region: 0x95, script: 0x5, flags: 0x4},
-	44: {region: 0x99, script: 0x33, flags: 0x0},
-	45: {region: 0xe8, script: 0x5, flags: 0x4},
-	46: {region: 0xe8, script: 0x5, flags: 0x2},
-	47: {region: 0x9c, script: 0x84, flags: 0x0},
-	48: {region: 0x53, script: 0x85, flags: 0x2},
-	49: {region: 0xba, script: 0xdc, flags: 0x0},
-	50: {region: 0xd9, script: 0x57, flags: 0x4},
-	51: {region: 0xe8, script: 0x5, flags: 0x0},
-	52: {region: 0x99, script: 0x21, flags: 0x2},
-	53: {region: 0x99, script: 0x4c, flags: 0x2},
-	54: {region: 0x99, script: 0xc9, flags: 0x2},
-	55: {region: 0x105, script: 0x1f, flags: 0x0},
-	56: {region: 0xbd, script: 0x57, flags: 0x4},
-	57: {region: 0x104, script: 0x57, flags: 0x4},
-	58: {region: 0x106, script: 0x57, flags: 0x4},
-	59: {region: 0x12b, script: 0x57, flags: 0x4},
-	60: {region: 0x124, script: 0x1f, flags: 0x0},
-	61: {region: 0xe8, script: 0x5, flags: 0x4},
-	62: {region: 0xe8, script: 0x5, flags: 0x2},
-	63: {region: 0x53, script: 0x5, flags: 0x0},
-	64: {region: 0xae, script: 0x1f, flags: 0x4},
-	65: {region: 0xc5, script: 0x1f, flags: 0x4},
-	66: {region: 0xae, script: 0x1f, flags: 0x2},
-	67: {region: 0x99, script: 0xe, flags: 0x0},
-	68: {region: 0xdb, script: 0x21, flags: 0x4},
-	69: {region: 0xdb, script: 0x21, flags: 0x2},
-	70: {region: 0x137, script: 0x57, flags: 0x0},
-	71: {region: 0x24, script: 0x5, flags: 0x4},
-	72: {region: 0x53, script: 0x1f, flags: 0x4},
-	73: {region: 0x24, script: 0x5, flags: 0x2},
-	74: {region: 0x8d, script: 0x39, flags: 0x0},
-	75: {region: 0x53, script: 0x38, flags: 0x4},
-	76: {region: 0x53, script: 0x38, flags: 0x2},
-	77: {region: 0x53, script: 0x38, flags: 0x0},
-	78: {region: 0x2f, script: 0x39, flags: 0x4},
-	79: {region: 0x3e, script: 0x39, flags: 0x4},
-	80: {region: 0x7b, script: 0x39, flags: 0x4},
-	81: {region: 0x7e, script: 0x39, flags: 0x4},
-	82: {region: 0x8d, script: 0x39, flags: 0x4},
-	83: {region: 0x95, script: 0x39, flags: 0x4},
-	84: {region: 0xc6, script: 0x39, flags: 0x4},
-	85: {region: 0xd0, script: 0x39, flags: 0x4},
-	86: {region: 0xe2, script: 0x39, flags: 0x4},
-	87: {region: 0xe5, script: 0x39, flags: 0x4},
-	88: {region: 0xe7, script: 0x39, flags: 0x4},
-	89: {region: 0x116, script: 0x39, flags: 0x4},
-	90: {region: 0x123, script: 0x39, flags: 0x4},
-	91: {region: 0x12e, script: 0x39, flags: 0x4},
-	92: {region: 0x135, script: 0x39, flags: 0x4},
-	93: {region: 0x13e, script: 0x39, flags: 0x4},
-	94: {region: 0x12e, script: 0x11, flags: 0x2},
-	95: {region: 0x12e, script: 0x34, flags: 0x2},
-	96: {region: 0x12e, script: 0x39, flags: 0x2},
-}
-
-type likelyLangScript struct {
-	lang   uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1432 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
-	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
-	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	36:  {lang: 0x0, script: 0x2, flags: 0x1},
-	39:  {lang: 0x2, script: 0x2, flags: 0x1},
-	40:  {lang: 0x4, script: 0x2, flags: 0x1},
-	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	43:  {lang: 0x0, script: 0x57, flags: 0x0},
-	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
-	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	48:  {lang: 0x367, script: 0x57, flags: 0x0},
-	49:  {lang: 0x444, script: 0x57, flags: 0x0},
-	50:  {lang: 0x58, script: 0x57, flags: 0x0},
-	51:  {lang: 0x6, script: 0x2, flags: 0x1},
-	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
-	54:  {lang: 0x367, script: 0x57, flags: 0x0},
-	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
-	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
-	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
-	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	67:  {lang: 0x8, script: 0x2, flags: 0x1},
-	69:  {lang: 0x0, script: 0x57, flags: 0x0},
-	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
-	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
-	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
-	75:  {lang: 0x445, script: 0x57, flags: 0x0},
-	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	83:  {lang: 0xa, script: 0x4, flags: 0x1},
-	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	85:  {lang: 0x0, script: 0x57, flags: 0x0},
-	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	93:  {lang: 0xe, script: 0x2, flags: 0x1},
-	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
-	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	98:  {lang: 0x1, script: 0x57, flags: 0x0},
-	99:  {lang: 0x101, script: 0x57, flags: 0x0},
-	101: {lang: 0x13e, script: 0x57, flags: 0x0},
-	103: {lang: 0x10, script: 0x2, flags: 0x1},
-	104: {lang: 0x13e, script: 0x57, flags: 0x0},
-	105: {lang: 0x13e, script: 0x57, flags: 0x0},
-	106: {lang: 0x140, script: 0x57, flags: 0x0},
-	107: {lang: 0x3a, script: 0x5, flags: 0x0},
-	108: {lang: 0x3a, script: 0x5, flags: 0x0},
-	109: {lang: 0x46f, script: 0x29, flags: 0x0},
-	110: {lang: 0x13e, script: 0x57, flags: 0x0},
-	111: {lang: 0x12, script: 0x2, flags: 0x1},
-	113: {lang: 0x10d, script: 0x57, flags: 0x0},
-	114: {lang: 0x151, script: 0x57, flags: 0x0},
-	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
-	118: {lang: 0x158, script: 0x57, flags: 0x0},
-	120: {lang: 0x15e, script: 0x57, flags: 0x0},
-	122: {lang: 0x15e, script: 0x57, flags: 0x0},
-	123: {lang: 0x14, script: 0x2, flags: 0x1},
-	125: {lang: 0x16, script: 0x3, flags: 0x1},
-	126: {lang: 0x15e, script: 0x57, flags: 0x0},
-	128: {lang: 0x21, script: 0x57, flags: 0x0},
-	130: {lang: 0x245, script: 0x57, flags: 0x0},
-	132: {lang: 0x15e, script: 0x57, flags: 0x0},
-	133: {lang: 0x15e, script: 0x57, flags: 0x0},
-	134: {lang: 0x13e, script: 0x57, flags: 0x0},
-	135: {lang: 0x19, script: 0x2, flags: 0x1},
-	136: {lang: 0x0, script: 0x57, flags: 0x0},
-	137: {lang: 0x13e, script: 0x57, flags: 0x0},
-	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	141: {lang: 0x529, script: 0x39, flags: 0x0},
-	142: {lang: 0x0, script: 0x57, flags: 0x0},
-	143: {lang: 0x13e, script: 0x57, flags: 0x0},
-	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
-	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
-	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
-	148: {lang: 0x13e, script: 0x57, flags: 0x0},
-	149: {lang: 0x1b, script: 0x2, flags: 0x1},
-	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
-	153: {lang: 0x1d, script: 0x3, flags: 0x1},
-	155: {lang: 0x3a, script: 0x5, flags: 0x0},
-	156: {lang: 0x20, script: 0x2, flags: 0x1},
-	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
-	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	161: {lang: 0x3a, script: 0x5, flags: 0x0},
-	162: {lang: 0x200, script: 0x46, flags: 0x0},
-	164: {lang: 0x445, script: 0x57, flags: 0x0},
-	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
-	166: {lang: 0x22, script: 0x3, flags: 0x1},
-	168: {lang: 0x25, script: 0x2, flags: 0x1},
-	170: {lang: 0x254, script: 0x50, flags: 0x0},
-	171: {lang: 0x254, script: 0x50, flags: 0x0},
-	172: {lang: 0x3a, script: 0x5, flags: 0x0},
-	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	175: {lang: 0x27, script: 0x2, flags: 0x1},
-	176: {lang: 0x3a, script: 0x5, flags: 0x0},
-	178: {lang: 0x10d, script: 0x57, flags: 0x0},
-	179: {lang: 0x40c, script: 0xca, flags: 0x0},
-	181: {lang: 0x43b, script: 0x57, flags: 0x0},
-	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
-	183: {lang: 0x15e, script: 0x57, flags: 0x0},
-	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
-	185: {lang: 0x3a, script: 0x5, flags: 0x0},
-	186: {lang: 0x29, script: 0x2, flags: 0x1},
-	187: {lang: 0x15e, script: 0x57, flags: 0x0},
-	188: {lang: 0x2b, script: 0x2, flags: 0x1},
-	189: {lang: 0x432, script: 0x57, flags: 0x0},
-	190: {lang: 0x15e, script: 0x57, flags: 0x0},
-	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
-	194: {lang: 0x2d, script: 0x2, flags: 0x1},
-	195: {lang: 0xa0, script: 0x57, flags: 0x0},
-	196: {lang: 0x2f, script: 0x2, flags: 0x1},
-	197: {lang: 0x31, script: 0x2, flags: 0x1},
-	198: {lang: 0x33, script: 0x2, flags: 0x1},
-	200: {lang: 0x15e, script: 0x57, flags: 0x0},
-	201: {lang: 0x35, script: 0x2, flags: 0x1},
-	203: {lang: 0x320, script: 0x57, flags: 0x0},
-	204: {lang: 0x37, script: 0x3, flags: 0x1},
-	205: {lang: 0x128, script: 0xde, flags: 0x0},
-	207: {lang: 0x13e, script: 0x57, flags: 0x0},
-	208: {lang: 0x31f, script: 0x57, flags: 0x0},
-	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	210: {lang: 0x16, script: 0x57, flags: 0x0},
-	211: {lang: 0x15e, script: 0x57, flags: 0x0},
-	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
-	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
-	216: {lang: 0x13e, script: 0x57, flags: 0x0},
-	217: {lang: 0x367, script: 0x57, flags: 0x0},
-	218: {lang: 0x347, script: 0x57, flags: 0x0},
-	219: {lang: 0x351, script: 0x21, flags: 0x0},
-	225: {lang: 0x3a, script: 0x5, flags: 0x0},
-	226: {lang: 0x13e, script: 0x57, flags: 0x0},
-	228: {lang: 0x13e, script: 0x57, flags: 0x0},
-	229: {lang: 0x15e, script: 0x57, flags: 0x0},
-	230: {lang: 0x486, script: 0x57, flags: 0x0},
-	231: {lang: 0x153, script: 0x57, flags: 0x0},
-	232: {lang: 0x3a, script: 0x3, flags: 0x1},
-	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	234: {lang: 0x15e, script: 0x57, flags: 0x0},
-	236: {lang: 0x13e, script: 0x57, flags: 0x0},
-	237: {lang: 0x3a, script: 0x5, flags: 0x0},
-	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
-	241: {lang: 0x194, script: 0x57, flags: 0x0},
-	243: {lang: 0x3a, script: 0x5, flags: 0x0},
-	258: {lang: 0x15e, script: 0x57, flags: 0x0},
-	260: {lang: 0x3d, script: 0x2, flags: 0x1},
-	261: {lang: 0x432, script: 0x1f, flags: 0x0},
-	262: {lang: 0x3f, script: 0x2, flags: 0x1},
-	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
-	264: {lang: 0x3a, script: 0x5, flags: 0x0},
-	266: {lang: 0x15e, script: 0x57, flags: 0x0},
-	267: {lang: 0x3a, script: 0x5, flags: 0x0},
-	268: {lang: 0x41, script: 0x2, flags: 0x1},
-	271: {lang: 0x416, script: 0x57, flags: 0x0},
-	272: {lang: 0x347, script: 0x57, flags: 0x0},
-	273: {lang: 0x43, script: 0x2, flags: 0x1},
-	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	276: {lang: 0x15e, script: 0x57, flags: 0x0},
-	277: {lang: 0x429, script: 0x57, flags: 0x0},
-	278: {lang: 0x367, script: 0x57, flags: 0x0},
-	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	282: {lang: 0x13e, script: 0x57, flags: 0x0},
-	284: {lang: 0x45, script: 0x2, flags: 0x1},
-	288: {lang: 0x15e, script: 0x57, flags: 0x0},
-	289: {lang: 0x15e, script: 0x57, flags: 0x0},
-	290: {lang: 0x47, script: 0x2, flags: 0x1},
-	291: {lang: 0x49, script: 0x3, flags: 0x1},
-	292: {lang: 0x4c, script: 0x2, flags: 0x1},
-	293: {lang: 0x477, script: 0x57, flags: 0x0},
-	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	295: {lang: 0x476, script: 0x57, flags: 0x0},
-	296: {lang: 0x4e, script: 0x2, flags: 0x1},
-	297: {lang: 0x482, script: 0x57, flags: 0x0},
-	299: {lang: 0x50, script: 0x4, flags: 0x1},
-	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
-	302: {lang: 0x54, script: 0x2, flags: 0x1},
-	303: {lang: 0x445, script: 0x57, flags: 0x0},
-	304: {lang: 0x56, script: 0x3, flags: 0x1},
-	305: {lang: 0x445, script: 0x57, flags: 0x0},
-	309: {lang: 0x512, script: 0x3b, flags: 0x2},
-	310: {lang: 0x13e, script: 0x57, flags: 0x0},
-	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
-	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	315: {lang: 0x13e, script: 0x57, flags: 0x0},
-	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
-	319: {lang: 0x8a, script: 0x57, flags: 0x0},
-	320: {lang: 0x15e, script: 0x57, flags: 0x0},
-	322: {lang: 0x41b, script: 0x57, flags: 0x0},
-	333: {lang: 0x59, script: 0x2, flags: 0x1},
-	350: {lang: 0x3a, script: 0x5, flags: 0x0},
-	351: {lang: 0x5b, script: 0x2, flags: 0x1},
-	356: {lang: 0x423, script: 0x57, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 372 bytes, 93 elements
-var likelyRegionList = [93]likelyLangScript{
-	0:  {lang: 0x148, script: 0x5, flags: 0x0},
-	1:  {lang: 0x476, script: 0x57, flags: 0x0},
-	2:  {lang: 0x431, script: 0x57, flags: 0x0},
-	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
-	5:  {lang: 0x274, script: 0x57, flags: 0x0},
-	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
-	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
-	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
-	9:  {lang: 0x351, script: 0x21, flags: 0x0},
-	10: {lang: 0x529, script: 0x38, flags: 0x0},
-	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
-	12: {lang: 0x523, script: 0x57, flags: 0x0},
-	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
-	14: {lang: 0x136, script: 0x31, flags: 0x0},
-	15: {lang: 0x48a, script: 0x57, flags: 0x0},
-	16: {lang: 0x3a, script: 0x5, flags: 0x0},
-	17: {lang: 0x15e, script: 0x57, flags: 0x0},
-	18: {lang: 0x27, script: 0x29, flags: 0x0},
-	19: {lang: 0x139, script: 0x57, flags: 0x0},
-	20: {lang: 0x26a, script: 0x5, flags: 0x2},
-	21: {lang: 0x512, script: 0x3b, flags: 0x2},
-	22: {lang: 0x210, script: 0x2b, flags: 0x0},
-	23: {lang: 0x5, script: 0x1f, flags: 0x0},
-	24: {lang: 0x274, script: 0x57, flags: 0x0},
-	25: {lang: 0x136, script: 0x31, flags: 0x0},
-	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
-	28: {lang: 0x31f, script: 0x5, flags: 0x0},
-	29: {lang: 0x1be, script: 0x21, flags: 0x0},
-	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	31: {lang: 0x236, script: 0x72, flags: 0x0},
-	32: {lang: 0x148, script: 0x5, flags: 0x0},
-	33: {lang: 0x476, script: 0x57, flags: 0x0},
-	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
-	35: {lang: 0xe6, script: 0x5, flags: 0x0},
-	36: {lang: 0x226, script: 0xdf, flags: 0x0},
-	37: {lang: 0x3a, script: 0x5, flags: 0x0},
-	38: {lang: 0x15e, script: 0x57, flags: 0x0},
-	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
-	40: {lang: 0x226, script: 0xdf, flags: 0x0},
-	41: {lang: 0x3a, script: 0x5, flags: 0x0},
-	42: {lang: 0x15e, script: 0x57, flags: 0x0},
-	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	46: {lang: 0x431, script: 0x57, flags: 0x0},
-	47: {lang: 0x331, script: 0x72, flags: 0x0},
-	48: {lang: 0x213, script: 0x57, flags: 0x0},
-	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
-	50: {lang: 0x242, script: 0x5, flags: 0x0},
-	51: {lang: 0x529, script: 0x39, flags: 0x0},
-	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	53: {lang: 0x3a, script: 0x5, flags: 0x0},
-	54: {lang: 0x15e, script: 0x57, flags: 0x0},
-	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
-	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	57: {lang: 0x88, script: 0x21, flags: 0x0},
-	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	60: {lang: 0xbe, script: 0x21, flags: 0x0},
-	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
-	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	64: {lang: 0x267, script: 0x57, flags: 0x0},
-	65: {lang: 0x444, script: 0x57, flags: 0x0},
-	66: {lang: 0x512, script: 0x3b, flags: 0x0},
-	67: {lang: 0x412, script: 0x57, flags: 0x0},
-	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	69: {lang: 0x3a, script: 0x5, flags: 0x0},
-	70: {lang: 0x15e, script: 0x57, flags: 0x0},
-	71: {lang: 0x15e, script: 0x57, flags: 0x0},
-	72: {lang: 0x35, script: 0x5, flags: 0x0},
-	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
-	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
-	75: {lang: 0x30f, script: 0x72, flags: 0x0},
-	76: {lang: 0x467, script: 0x1f, flags: 0x0},
-	77: {lang: 0x148, script: 0x5, flags: 0x0},
-	78: {lang: 0x3a, script: 0x5, flags: 0x0},
-	79: {lang: 0x15e, script: 0x57, flags: 0x0},
-	80: {lang: 0x48a, script: 0x57, flags: 0x0},
-	81: {lang: 0x58, script: 0x5, flags: 0x0},
-	82: {lang: 0x219, script: 0x1f, flags: 0x0},
-	83: {lang: 0x81, script: 0x31, flags: 0x0},
-	84: {lang: 0x529, script: 0x39, flags: 0x0},
-	85: {lang: 0x48c, script: 0x57, flags: 0x0},
-	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	87: {lang: 0x512, script: 0x3b, flags: 0x0},
-	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	89: {lang: 0x431, script: 0x57, flags: 0x0},
-	90: {lang: 0x432, script: 0x1f, flags: 0x0},
-	91: {lang: 0x15e, script: 0x57, flags: 0x0},
-	92: {lang: 0x446, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
-	lang   uint16
-	region uint16
-	script uint8
-}
-
-// Size: 198 bytes, 33 elements
-var likelyRegionGroup = [33]likelyTag{
-	1:  {lang: 0x139, region: 0xd6, script: 0x57},
-	2:  {lang: 0x139, region: 0x135, script: 0x57},
-	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
-	4:  {lang: 0x139, region: 0x2f, script: 0x57},
-	5:  {lang: 0x139, region: 0xd6, script: 0x57},
-	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
-	7:  {lang: 0x445, region: 0x12f, script: 0x57},
-	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
-	9:  {lang: 0x445, region: 0x4b, script: 0x57},
-	10: {lang: 0x139, region: 0x161, script: 0x57},
-	11: {lang: 0x139, region: 0x135, script: 0x57},
-	12: {lang: 0x139, region: 0x135, script: 0x57},
-	13: {lang: 0x13e, region: 0x59, script: 0x57},
-	14: {lang: 0x529, region: 0x53, script: 0x38},
-	15: {lang: 0x1be, region: 0x99, script: 0x21},
-	16: {lang: 0x1e1, region: 0x95, script: 0x57},
-	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
-	18: {lang: 0x139, region: 0x2f, script: 0x57},
-	19: {lang: 0x139, region: 0xe6, script: 0x57},
-	20: {lang: 0x139, region: 0x8a, script: 0x57},
-	21: {lang: 0x41b, region: 0x142, script: 0x57},
-	22: {lang: 0x529, region: 0x53, script: 0x38},
-	23: {lang: 0x4bc, region: 0x137, script: 0x57},
-	24: {lang: 0x3a, region: 0x108, script: 0x5},
-	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	27: {lang: 0x139, region: 0x7b, script: 0x57},
-	28: {lang: 0x10d, region: 0x60, script: 0x57},
-	29: {lang: 0x139, region: 0xd6, script: 0x57},
-	30: {lang: 0x13e, region: 0x1f, script: 0x57},
-	31: {lang: 0x139, region: 0x9a, script: 0x57},
-	32: {lang: 0x139, region: 0x7b, script: 0x57},
-}
-
-// Size: 358 bytes, 358 elements
-var regionToGroups = [358]uint8{
+var regionToGroups = []uint8{ // 357 elements
 	// Entry 0 - 3F
 	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
 	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
@@ -3343,15 +98,14 @@ var regionToGroups = [358]uint8{
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-}
+	0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 381 bytes
 
-// Size: 18 bytes, 3 elements
-var paradigmLocales = [3][3]uint16{
+var paradigmLocales = [][3]uint16{ // 3 elements
 	0: [3]uint16{0x139, 0x0, 0x7b},
 	1: [3]uint16{0x13e, 0x0, 0x1f},
 	2: [3]uint16{0x3c0, 0x41, 0xee},
-}
+} // Size: 42 bytes
 
 type mutualIntelligibility struct {
 	want     uint16
@@ -3359,7 +113,6 @@ type mutualIntelligibility struct {
 	distance uint8
 	oneway   bool
 }
-
 type scriptIntelligibility struct {
 	wantLang   uint16
 	haveLang   uint16
@@ -3367,7 +120,6 @@ type scriptIntelligibility struct {
 	haveScript uint8
 	distance   uint8
 }
-
 type regionIntelligibility struct {
 	lang     uint16
 	script   uint8
@@ -3378,8 +130,7 @@ type regionIntelligibility struct {
 // matchLang holds pairs of langIDs of base languages that are typically
 // mutually intelligible. Each pair is associated with a confidence and
 // whether the intelligibility goes one or both ways.
-// Size: 678 bytes, 113 elements
-var matchLang = [113]mutualIntelligibility{
+var matchLang = []mutualIntelligibility{ // 113 elements
 	0:   {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
 	1:   {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
 	2:   {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
@@ -3493,12 +244,11 @@ var matchLang = [113]mutualIntelligibility{
 	110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
 	111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
 	112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
-}
+} // Size: 702 bytes
 
 // matchScript holds pairs of scriptIDs where readers of one script
 // can typically also read the other. Each is associated with a confidence.
-// Size: 208 bytes, 26 elements
-var matchScript = [26]scriptIntelligibility{
+var matchScript = []scriptIntelligibility{ // 26 elements
 	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
 	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
 	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
@@ -3525,10 +275,9 @@ var matchScript = [26]scriptIntelligibility{
 	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
 	24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
 	25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
-}
+} // Size: 232 bytes
 
-// Size: 90 bytes, 15 elements
-var matchRegion = [15]regionIntelligibility{
+var matchRegion = []regionIntelligibility{ // 15 elements
 	0:  {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
 	1:  {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
 	2:  {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
@@ -3544,143 +293,6 @@ var matchRegion = [15]regionIntelligibility{
 	12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
 	13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
 	14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
-}
-
-// Size: 264 bytes, 33 elements
-var regionContainment = [33]uint64{
-	// Entry 0 - 1F
-	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
-	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
-	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
-	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
-	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
-	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
-	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
-	// Entry 20 - 3F
-	0x0000000100000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
-	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
-	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
-	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
-	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
-	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
-	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
-	// Entry 40 - 7F
-	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
-	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
-	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
-	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
-	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
-	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
-	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
-	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
-	// Entry 80 - BF
-	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
-	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
-	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
-	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
-	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
-	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
-	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
-	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
-	// Entry C0 - FF
-	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
-	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
-	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
-	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
-	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
-	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
-	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	// Entry 100 - 13F
-	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
-	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
-	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
-	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
-	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
-	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
-	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
-	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
-	// Entry 140 - 17F
-	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
-	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings.  These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 584 bytes, 73 elements
-var regionInclusionBits = [73]uint64{
-	// Entry 0 - 1F
-	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
-	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
-	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
-	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
-	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
-	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
-	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
-	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
-	// Entry 20 - 3F
-	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
-	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
-	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
-	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
-	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
-	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
-	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
-	// Entry 40 - 5F
-	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
-	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
-	0x0000000102020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 73 bytes, 73 elements
-var regionInclusionNext = [73]uint8{
-	// Entry 0 - 3F
-	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
-	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
-	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
-	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
-	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
-	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
-	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
-	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
-	// Entry 40 - 7F
-	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
-	0x43,
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-// Size: 414 bytes, 5 elements
-var parents = [5]parentRel{
-	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
-	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
-	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
-	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
-	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
-}
+} // Size: 114 bytes
 
-// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5
+// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
index de30155..42ea792 100644
--- a/vendor/golang.org/x/text/language/tags.go
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -4,6 +4,8 @@
 
 package language
 
+import "golang.org/x/text/internal/language/compact"
+
 // TODO: Various sets of commonly use tags and regions.
 
 // MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
@@ -61,83 +63,83 @@ var (
 
 	Und Tag = Tag{}
 
-	Afrikaans            Tag = Tag{lang: _af}                //  af
-	Amharic              Tag = Tag{lang: _am}                //  am
-	Arabic               Tag = Tag{lang: _ar}                //  ar
-	ModernStandardArabic Tag = Tag{lang: _ar, region: _001}  //  ar-001
-	Azerbaijani          Tag = Tag{lang: _az}                //  az
-	Bulgarian            Tag = Tag{lang: _bg}                //  bg
-	Bengali              Tag = Tag{lang: _bn}                //  bn
-	Catalan              Tag = Tag{lang: _ca}                //  ca
-	Czech                Tag = Tag{lang: _cs}                //  cs
-	Danish               Tag = Tag{lang: _da}                //  da
-	German               Tag = Tag{lang: _de}                //  de
-	Greek                Tag = Tag{lang: _el}                //  el
-	English              Tag = Tag{lang: _en}                //  en
-	AmericanEnglish      Tag = Tag{lang: _en, region: _US}   //  en-US
-	BritishEnglish       Tag = Tag{lang: _en, region: _GB}   //  en-GB
-	Spanish              Tag = Tag{lang: _es}                //  es
-	EuropeanSpanish      Tag = Tag{lang: _es, region: _ES}   //  es-ES
-	LatinAmericanSpanish Tag = Tag{lang: _es, region: _419}  //  es-419
-	Estonian             Tag = Tag{lang: _et}                //  et
-	Persian              Tag = Tag{lang: _fa}                //  fa
-	Finnish              Tag = Tag{lang: _fi}                //  fi
-	Filipino             Tag = Tag{lang: _fil}               //  fil
-	French               Tag = Tag{lang: _fr}                //  fr
-	CanadianFrench       Tag = Tag{lang: _fr, region: _CA}   //  fr-CA
-	Gujarati             Tag = Tag{lang: _gu}                //  gu
-	Hebrew               Tag = Tag{lang: _he}                //  he
-	Hindi                Tag = Tag{lang: _hi}                //  hi
-	Croatian             Tag = Tag{lang: _hr}                //  hr
-	Hungarian            Tag = Tag{lang: _hu}                //  hu
-	Armenian             Tag = Tag{lang: _hy}                //  hy
-	Indonesian           Tag = Tag{lang: _id}                //  id
-	Icelandic            Tag = Tag{lang: _is}                //  is
-	Italian              Tag = Tag{lang: _it}                //  it
-	Japanese             Tag = Tag{lang: _ja}                //  ja
-	Georgian             Tag = Tag{lang: _ka}                //  ka
-	Kazakh               Tag = Tag{lang: _kk}                //  kk
-	Khmer                Tag = Tag{lang: _km}                //  km
-	Kannada              Tag = Tag{lang: _kn}                //  kn
-	Korean               Tag = Tag{lang: _ko}                //  ko
-	Kirghiz              Tag = Tag{lang: _ky}                //  ky
-	Lao                  Tag = Tag{lang: _lo}                //  lo
-	Lithuanian           Tag = Tag{lang: _lt}                //  lt
-	Latvian              Tag = Tag{lang: _lv}                //  lv
-	Macedonian           Tag = Tag{lang: _mk}                //  mk
-	Malayalam            Tag = Tag{lang: _ml}                //  ml
-	Mongolian            Tag = Tag{lang: _mn}                //  mn
-	Marathi              Tag = Tag{lang: _mr}                //  mr
-	Malay                Tag = Tag{lang: _ms}                //  ms
-	Burmese              Tag = Tag{lang: _my}                //  my
-	Nepali               Tag = Tag{lang: _ne}                //  ne
-	Dutch                Tag = Tag{lang: _nl}                //  nl
-	Norwegian            Tag = Tag{lang: _no}                //  no
-	Punjabi              Tag = Tag{lang: _pa}                //  pa
-	Polish               Tag = Tag{lang: _pl}                //  pl
-	Portuguese           Tag = Tag{lang: _pt}                //  pt
-	BrazilianPortuguese  Tag = Tag{lang: _pt, region: _BR}   //  pt-BR
-	EuropeanPortuguese   Tag = Tag{lang: _pt, region: _PT}   //  pt-PT
-	Romanian             Tag = Tag{lang: _ro}                //  ro
-	Russian              Tag = Tag{lang: _ru}                //  ru
-	Sinhala              Tag = Tag{lang: _si}                //  si
-	Slovak               Tag = Tag{lang: _sk}                //  sk
-	Slovenian            Tag = Tag{lang: _sl}                //  sl
-	Albanian             Tag = Tag{lang: _sq}                //  sq
-	Serbian              Tag = Tag{lang: _sr}                //  sr
-	SerbianLatin         Tag = Tag{lang: _sr, script: _Latn} //  sr-Latn
-	Swedish              Tag = Tag{lang: _sv}                //  sv
-	Swahili              Tag = Tag{lang: _sw}                //  sw
-	Tamil                Tag = Tag{lang: _ta}                //  ta
-	Telugu               Tag = Tag{lang: _te}                //  te
-	Thai                 Tag = Tag{lang: _th}                //  th
-	Turkish              Tag = Tag{lang: _tr}                //  tr
-	Ukrainian            Tag = Tag{lang: _uk}                //  uk
-	Urdu                 Tag = Tag{lang: _ur}                //  ur
-	Uzbek                Tag = Tag{lang: _uz}                //  uz
-	Vietnamese           Tag = Tag{lang: _vi}                //  vi
-	Chinese              Tag = Tag{lang: _zh}                //  zh
-	SimplifiedChinese    Tag = Tag{lang: _zh, script: _Hans} //  zh-Hans
-	TraditionalChinese   Tag = Tag{lang: _zh, script: _Hant} //  zh-Hant
-	Zulu                 Tag = Tag{lang: _zu}                //  zu
+	Afrikaans            Tag = Tag(compact.Afrikaans)
+	Amharic              Tag = Tag(compact.Amharic)
+	Arabic               Tag = Tag(compact.Arabic)
+	ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
+	Azerbaijani          Tag = Tag(compact.Azerbaijani)
+	Bulgarian            Tag = Tag(compact.Bulgarian)
+	Bengali              Tag = Tag(compact.Bengali)
+	Catalan              Tag = Tag(compact.Catalan)
+	Czech                Tag = Tag(compact.Czech)
+	Danish               Tag = Tag(compact.Danish)
+	German               Tag = Tag(compact.German)
+	Greek                Tag = Tag(compact.Greek)
+	English              Tag = Tag(compact.English)
+	AmericanEnglish      Tag = Tag(compact.AmericanEnglish)
+	BritishEnglish       Tag = Tag(compact.BritishEnglish)
+	Spanish              Tag = Tag(compact.Spanish)
+	EuropeanSpanish      Tag = Tag(compact.EuropeanSpanish)
+	LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
+	Estonian             Tag = Tag(compact.Estonian)
+	Persian              Tag = Tag(compact.Persian)
+	Finnish              Tag = Tag(compact.Finnish)
+	Filipino             Tag = Tag(compact.Filipino)
+	French               Tag = Tag(compact.French)
+	CanadianFrench       Tag = Tag(compact.CanadianFrench)
+	Gujarati             Tag = Tag(compact.Gujarati)
+	Hebrew               Tag = Tag(compact.Hebrew)
+	Hindi                Tag = Tag(compact.Hindi)
+	Croatian             Tag = Tag(compact.Croatian)
+	Hungarian            Tag = Tag(compact.Hungarian)
+	Armenian             Tag = Tag(compact.Armenian)
+	Indonesian           Tag = Tag(compact.Indonesian)
+	Icelandic            Tag = Tag(compact.Icelandic)
+	Italian              Tag = Tag(compact.Italian)
+	Japanese             Tag = Tag(compact.Japanese)
+	Georgian             Tag = Tag(compact.Georgian)
+	Kazakh               Tag = Tag(compact.Kazakh)
+	Khmer                Tag = Tag(compact.Khmer)
+	Kannada              Tag = Tag(compact.Kannada)
+	Korean               Tag = Tag(compact.Korean)
+	Kirghiz              Tag = Tag(compact.Kirghiz)
+	Lao                  Tag = Tag(compact.Lao)
+	Lithuanian           Tag = Tag(compact.Lithuanian)
+	Latvian              Tag = Tag(compact.Latvian)
+	Macedonian           Tag = Tag(compact.Macedonian)
+	Malayalam            Tag = Tag(compact.Malayalam)
+	Mongolian            Tag = Tag(compact.Mongolian)
+	Marathi              Tag = Tag(compact.Marathi)
+	Malay                Tag = Tag(compact.Malay)
+	Burmese              Tag = Tag(compact.Burmese)
+	Nepali               Tag = Tag(compact.Nepali)
+	Dutch                Tag = Tag(compact.Dutch)
+	Norwegian            Tag = Tag(compact.Norwegian)
+	Punjabi              Tag = Tag(compact.Punjabi)
+	Polish               Tag = Tag(compact.Polish)
+	Portuguese           Tag = Tag(compact.Portuguese)
+	BrazilianPortuguese  Tag = Tag(compact.BrazilianPortuguese)
+	EuropeanPortuguese   Tag = Tag(compact.EuropeanPortuguese)
+	Romanian             Tag = Tag(compact.Romanian)
+	Russian              Tag = Tag(compact.Russian)
+	Sinhala              Tag = Tag(compact.Sinhala)
+	Slovak               Tag = Tag(compact.Slovak)
+	Slovenian            Tag = Tag(compact.Slovenian)
+	Albanian             Tag = Tag(compact.Albanian)
+	Serbian              Tag = Tag(compact.Serbian)
+	SerbianLatin         Tag = Tag(compact.SerbianLatin)
+	Swedish              Tag = Tag(compact.Swedish)
+	Swahili              Tag = Tag(compact.Swahili)
+	Tamil                Tag = Tag(compact.Tamil)
+	Telugu               Tag = Tag(compact.Telugu)
+	Thai                 Tag = Tag(compact.Thai)
+	Turkish              Tag = Tag(compact.Turkish)
+	Ukrainian            Tag = Tag(compact.Ukrainian)
+	Urdu                 Tag = Tag(compact.Urdu)
+	Uzbek                Tag = Tag(compact.Uzbek)
+	Vietnamese           Tag = Tag(compact.Vietnamese)
+	Chinese              Tag = Tag(compact.Chinese)
+	SimplifiedChinese    Tag = Tag(compact.SimplifiedChinese)
+	TraditionalChinese   Tag = Tag(compact.TraditionalChinese)
+	Zulu                 Tag = Tag(compact.Zulu)
 )
diff --git a/vendor/golang.org/x/text/message/catalog/catalog.go b/vendor/golang.org/x/text/message/catalog/catalog.go
index 34a30d3..de595b5 100644
--- a/vendor/golang.org/x/text/message/catalog/catalog.go
+++ b/vendor/golang.org/x/text/message/catalog/catalog.go
@@ -46,12 +46,12 @@
 // The most common one is plural form, but others exist.
 //
 // Selection messages are provided in packages that provide support for a
-// specific linguistic feature. The following snippet uses plural.Select:
+// specific linguistic feature. The following snippet uses plural.Selectf:
 //
 //   catalog.Set(language.English, "You are %d minute(s) late.",
-//       plural.Select(1,
-//           "one", "You are 1 minute late.",
-//           "other", "You are %d minutes late."))
+//       plural.Selectf(1, "",
+//           plural.One, "You are 1 minute late.",
+//           plural.Other, "You are %d minutes late."))
 //
 // In this example, a message is stored in the Catalog where one of two messages
 // is selected based on the first argument, a number. The first message is
@@ -74,14 +74,14 @@
 //
 //   catalog.Set(language.English, "You are %d minute(s) late.",
 //       catalog.Var("minutes",
-//           plural.Select(1, "one", "minute", "other", "minutes")),
+//           plural.Selectf(1, "", plural.One, "minute", plural.Other, "minutes")),
 //       catalog.String("You are %[1]d ${minutes} late."))
 //
 // Var is defined to return the variable name if the message does not yield a
 // match. This allows us to further simplify this snippet to
 //
 //   catalog.Set(language.English, "You are %d minute(s) late.",
-//       catalog.Var("minutes", plural.Select(1, "one", "minute")),
+//       catalog.Var("minutes", plural.Selectf(1, "", plural.One, "minute")),
 //       catalog.String("You are %d ${minutes} late."))
 //
 // Overall this is still only a minor improvement, but things can get a lot more
@@ -91,20 +91,20 @@
 //   // argument 1: list of hosts, argument 2: list of guests
 //   catalog.Set(language.English, "%[1]v invite(s) %[2]v to their party.",
 //     catalog.Var("their",
-//         plural.Select(1,
-//             "one", gender.Select(1, "female", "her", "other", "his"))),
-//     catalog.Var("invites", plural.Select(1, "one", "invite"))
+//         plural.Selectf(1, ""
+//             plural.One, gender.Select(1, "female", "her", "other", "his"))),
+//     catalog.Var("invites", plural.Selectf(1, "", plural.One, "invite"))
 //     catalog.String("%[1]v ${invites} %[2]v to ${their} party.")),
 //
 // Without variable substitution, this would have to be written as
 //
 //   // argument 1: list of hosts, argument 2: list of guests
 //   catalog.Set(language.English, "%[1]v invite(s) %[2]v to their party.",
-//     plural.Select(1,
-//         "one", gender.Select(1,
+//     plural.Selectf(1, "",
+//         plural.One, gender.Select(1,
 //             "female", "%[1]v invites %[2]v to her party."
 //             "other", "%[1]v invites %[2]v to his party."),
-//         "other", "%[1]v invites %[2]v to their party.")
+//         plural.Other, "%[1]v invites %[2]v to their party.")
 //
 // Not necessarily shorter, but using variables there is less duplication and
 // the messages are more maintenance friendly. Moreover, languages may have up
@@ -119,9 +119,10 @@
 //
 // Where the following macros were defined separately.
 //
-//   catalog.SetMacro(language.English, "invites", plural.Select(1, "one", "invite"))
-//   catalog.SetMacro(language.English, "their", plural.Select(1,
-//      "one", gender.Select(1, "female", "her", "other", "his"))),
+//   catalog.SetMacro(language.English, "invites", plural.Selectf(1, "",
+//      plural.One, "invite"))
+//   catalog.SetMacro(language.English, "their", plural.Selectf(1, "",
+//      plural.One, gender.Select(1, "female", "her", "other", "his"))),
 //
 // Placeholders use parentheses and the arguments to invoke a macro.
 //
diff --git a/vendor/golang.org/x/text/message/doc.go b/vendor/golang.org/x/text/message/doc.go
index 2f7effd..72e8fde 100644
--- a/vendor/golang.org/x/text/message/doc.go
+++ b/vendor/golang.org/x/text/message/doc.go
@@ -17,7 +17,7 @@
 //    p.Printf("%d ducks in a row", 4331) // Prints 4,331 ducks in a row
 //
 //    p := message.NewPrinter(message.MatchLanguage("nl"))
-//    p.Println("Hoogte: %f meter", 1244.9) // Prints Hoogte: 1.244,9 meter
+//    p.Printf("Hoogte: %.1f meter", 1244.9) // Prints Hoogte: 1,244.9 meter
 //
 //    p := message.NewPrinter(message.MatchLanguage("bn"))
 //    p.Println(123456.78) // Prints ১,২৩,৪৫৬.৭৮
@@ -31,6 +31,7 @@
 //   - flag # always resorts to fmt for printing
 //   - verb 'f', 'e', 'g', 'd' use localized formatting unless the '#' flag is
 //     specified.
+//   - verb 'm' inserts a translation of a string argument.
 //
 // See package fmt for more options.
 //
diff --git a/vendor/golang.org/x/text/message/message.go b/vendor/golang.org/x/text/message/message.go
index a3473bf..48d7663 100644
--- a/vendor/golang.org/x/text/message/message.go
+++ b/vendor/golang.org/x/text/message/message.go
@@ -156,6 +156,13 @@ func lookupAndFormat(p *printer, r Reference, a []interface{}) {
 	}
 }
 
+type rawPrinter struct {
+	p *printer
+}
+
+func (p rawPrinter) Render(msg string)     { p.p.WriteString(msg) }
+func (p rawPrinter) Arg(i int) interface{} { return nil }
+
 // Arg implements catmsg.Renderer.
 func (p *printer) Arg(i int) interface{} { // TODO, also return "ok" bool
 	i--
diff --git a/vendor/golang.org/x/text/message/print.go b/vendor/golang.org/x/text/message/print.go
index 777e172..da304cc 100644
--- a/vendor/golang.org/x/text/message/print.go
+++ b/vendor/golang.org/x/text/message/print.go
@@ -467,6 +467,11 @@ func (p *printer) fmtString(v string, verb rune) {
 		p.fmt.fmt_sx(v, udigits)
 	case 'q':
 		p.fmt.fmt_q(v)
+	case 'm':
+		ctx := p.cat.Context(p.tag, rawPrinter{p})
+		if ctx.Execute(v) == catalog.ErrNotFound {
+			p.WriteString(v)
+		}
 	default:
 		p.badVerb(verb)
 	}
diff --git a/vendor/modules.txt b/vendor/modules.txt
index 407647d..a808ab4 100644
--- a/vendor/modules.txt
+++ b/vendor/modules.txt
@@ -4,8 +4,8 @@ github.com/BurntSushi/toml
 github.com/anaskhan96/soup
 # github.com/fatih/color v1.7.0
 github.com/fatih/color
-# github.com/gizak/termui v2.3.0+incompatible
-github.com/gizak/termui
+# github.com/inconshreveable/mousetrap v1.0.0
+github.com/inconshreveable/mousetrap
 # github.com/jroimartin/gocui v0.4.0
 github.com/jroimartin/gocui
 # github.com/konsorten/go-windows-terminal-sequences v1.0.1
@@ -18,7 +18,7 @@ github.com/mattn/go-colorable
 github.com/mattn/go-isatty
 # github.com/mattn/go-runewidth v0.0.4
 github.com/mattn/go-runewidth
-# github.com/miguelmota/go-coinmarketcap v0.1.4
+# github.com/miguelmota/go-coinmarketcap v0.1.5
 github.com/miguelmota/go-coinmarketcap/pro/v1
 github.com/miguelmota/go-coinmarketcap/v2
 github.com/miguelmota/go-coinmarketcap/v2/types
@@ -30,21 +30,27 @@ github.com/nsf/termbox-go
 github.com/patrickmn/go-cache
 # github.com/sirupsen/logrus v1.4.1
 github.com/sirupsen/logrus
+# github.com/spf13/cobra v0.0.5
+github.com/spf13/cobra
+# github.com/spf13/pflag v1.0.3
+github.com/spf13/pflag
 # github.com/tomnomnom/xtermcolor v0.0.0-20160428124646-b78803f00a7e
 github.com/tomnomnom/xtermcolor
-# golang.org/x/net v0.0.0-20190415214537-1da14a5a36f2
+# golang.org/x/net v0.0.0-20190628185345-da137c7871d7
 golang.org/x/net/html
 golang.org/x/net/html/atom
-# golang.org/x/sys v0.0.0-20190416152802-12500544f89f
+# golang.org/x/sys v0.0.0-20190626221950-04f50cda93cb
 golang.org/x/sys/unix
-# golang.org/x/text v0.3.0
+# golang.org/x/text v0.3.2
 golang.org/x/text/language
 golang.org/x/text/message
-golang.org/x/text/internal/tag
+golang.org/x/text/internal/language
+golang.org/x/text/internal/language/compact
 golang.org/x/text/feature/plural
 golang.org/x/text/internal/format
 golang.org/x/text/internal/number
 golang.org/x/text/message/catalog
+golang.org/x/text/internal/tag
 golang.org/x/text/internal/catmsg
-golang.org/x/text/internal
 golang.org/x/text/internal/stringset
+golang.org/x/text/internal